The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Phl p 5.0201

Sequence Q40963

Full FASTA alignment

Sequence name:
Query sequence:
AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
QPATGAATVAAGAATTAAGAASGAATVAAGGYKV

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Phl p 5.0201Q40963Go!284346.18.7e-97
2Phl p 5.0202CAB05371Go!281338.12.2e-94
3Phl p 5.0204AAC25996Go!265318.12.2e-88
4Phl p 5.02059249029Go!265314.42.8e-87
5Poa p 5.0101Q9FPR0Go!303266.48.7e-73
6Lol p 5AAD20386Go!301249.51.1e-67
7Hol l 5.0101CAB10765Go!264248.51.9e-67
8Dac g 5.02AAK62277Go!265247.83.2e-67
9Dac g 5.01AAK62276Go!265246.48.3e-67
10Hol l 5.0201CAB10766Go!240207.34.4e-55
11Poa p 5P22285Go!333183.11.2e-47
12Phl p 5.0101CAA52753Go!312181.72.8e-47
13Pha a 5P56164Go!320180.09.7e-47
14Phl p 5.0107AAC16527Go!276179.61.1e-46
15Phl p 5.0106AAC16526Go!276179.61.1e-46
16Poa p 5P22284Go!373179.51.7e-46
17Phl p 5.0109CAD87529Go!284179.01.7e-46
18Phl p 5.0102Q40962Go!286178.82.0e-46
19Phl p 5.0108AAC16528Go!276178.62.2e-46
20Poa p 5P22286Go!307177.74.7e-46
21Phl p 5AAK25823Go!275176.31.1e-45
22Phl p 5.0105AAC16525Go!276175.71.7e-45
23Phl p 5.0104CAB05372Go!276173.48.4e-45
24Pha a 5P56167Go!175160.44.2e-41
25Sec c 5.0101CBG76811Go!292154.93.2e-39
26Lol p 5Q40237Go!339153.21.2e-38
27Lol p 5Q40240Go!308144.83.6e-36
28Pha a 5P56166Go!294140.56.8e-35
29Hor v 5.0101U57845Go!313139.81.2e-34
30Pha a 5P56165Go!305125.03.3e-30
31Phl p 6.0101P43215Go!13292.77.5e-21
32Phl p 6.0102CAA76556Go!13891.61.7e-20

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Phl p 5.0201, Sequence: Q40963
Sequence identity: 100.00 (284/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
Sequence 2 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
           NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
Sequence 2 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS

Sequence 1 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
           VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
Sequence 2 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI

Sequence 1 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
           PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
Sequence 2 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY

Sequence 1 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
           DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
Sequence 2 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS

Sequence 1 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
Sequence 2 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 2
Sequence 1:
Sequence 2: Allergen Phl p 5.0202, Sequence: CAB05371
Sequence identity: 97.18 (276/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           ---AVPRRGPRGGPGRSY-ADAGYAPATPAAAGA-AGKATTEEQKLIEDI
Sequence 2 ---AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
           NVGFKAAVAAAASVPA-DKFKTFEAAFTSSSKAA-AKAPGLVPKLDAAYS
Sequence 2 NVGFKAAVAAAASVPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYS

Sequence 1 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
           VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
Sequence 2 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI

Sequence 1 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
           PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
Sequence 2 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY

Sequence 1 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
           DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
Sequence 2 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS

Sequence 1 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QPATGAATVAAGAATTA-GAASGAATVAAGGYKV
Sequence 2 QPATGAATVAAGAATTATGAASGAATVAAGGYKV



Alignment 3
Sequence 1:
Sequence 2: Allergen Phl p 5.0204, Sequence: AAC25996
Sequence identity: 92.61 (263/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------ADAGYAPATPAAAGA-AGKATTEEQKLIEDI
Sequence 2 -------------------ADAGYAPATPAAAGAEAGKATTEEQKLIEDI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
           NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAA-AKAPGLVPKLDAAYS
Sequence 2 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYS

Sequence 1 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
           VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
Sequence 2 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI

Sequence 1 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
           PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
Sequence 2 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY

Sequence 1 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
           DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
Sequence 2 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS

Sequence 1 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
Sequence 2 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 4
Sequence 1:
Sequence 2: Allergen Phl p 5.0205, Sequence: 9249029
Sequence identity: 91.55 (260/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------ADAGYAPATPAAAGA-AGKATTEEQKLIEDI
Sequence 2 -------------------ADAGYAPATPAAAGAEAGKATTEEQKLIEDI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
           NVGF-AAVAAAASVPAADKFKTFEAAFTSSSKAA-AKAPGLVPKLDAAYS
Sequence 2 NVGFNAAVAAAASVPAADKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYS

Sequence 1 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
           VAYKAAVGATPEAKFDS-VASLTEALRVIAGALEVHAVKPVTEEPGMAKI
Sequence 2 VAYKAAVGATPEAKFDSLVASLTEALRVIAGALEVHAVKPVTEEPGMAKI

Sequence 1 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
           PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
Sequence 2 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY

Sequence 1 DTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
           DTYKCIPSLEAAVKQ-YAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS
Sequence 2 DTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVS

Sequence 1 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QPATGAATVAAGAATTAAGAASGAATVAAGGYKV
Sequence 2 QPATGAATVAAGAATTAAGAASGAATVAAGGYKV



Alignment 5
Sequence 1:
Sequence 2: Allergen Poa p 5.0101, Sequence: Q9FPR0
Sequence identity: 78.52 (223/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKAT-TEE
           --------A---------GP--SY-ADAGYAPATPAAAGAAAGK-T-T-E
Sequence 2 MAVQKYTVALFLTVALVAGPAASYAADAGYAPATPAAAGAAAGKITPTQE

Sequence 1 QKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAK-----A
           QKL-EDINVGFKAAVAAAA--P-ADKFKTF-AAF--S--A-AAK-----A
Sequence 2 QKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFSASVEASAAKLNAAQA

Sequence 1 PGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAV
           PG-V----A-----YKAAVGATPEAKFDSFVA--TEALR-IAG-L-VHAV
Sequence 2 PGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVLKVHAV

Sequence 1 KPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAF
           KP-TEE-G-AKIPAGE-QIIDKIDAAFKVAATAA--APA-DKFTVFEAAF
Sequence 2 KPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAF

Sequence 1 NKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTK
           N-AIKESTGGAYDTYK-IPSLEAAVKQAYAAT-AAAP-VK-AVF-AALTK
Sequence 2 NNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTK

Sequence 1 AITAMSEVQKVSQPATGAATVAAGAATT-------AAGAASGAATVAAGG
           AITAM-EVQKVS-P--GAATVAAGAAT--------AAGAA-GAATV-AGG
Sequence 2 AITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGG

Sequence 1 YKV
           YKV
Sequence 2 YKV



Alignment 6
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: AAD20386
Sequence identity: 75.00 (213/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPA------TPAAAGAAAG-
           --------A---------GP--SY-ADAGY-PA------TPAA--AAAG-
Sequence 2 MAVQKYTVALFLAVALVAGPAASYAADAGYTPAAAATPATPAATPAAAGG

Sequence 1 KATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----
           KATT-EQKL-ED-N-GFKAAVAAAA--P-ADKFK-FEAAF--SSK-----
Sequence 2 KATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLAT

Sequence 1 AAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -AAKAPGL-PKLD-AY-VAYKAA-GATPEAK-D-FV--LTEALRVIAGAL
Sequence 2 SAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRVIAGAL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP-TEE---AKIP-GELQI-DKIDAAFK-AATAA--AP--DKFTV
Sequence 2 EVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FE-AFNKA--E-TGGAY-TYK-IPSLEAAVKQAYAATVAAAP-VKYAVFE
Sequence 2 FESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           AALTKAITAM---QK---PA--AAT-AA--AT-AA-AA-GAAT-AAGGYK
Sequence 2 AALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK

Sequence 1 V
           -
Sequence 2 A



Alignment 7
Sequence 1:
Sequence 2: Allergen Hol l 5.0101, Sequence: CAB10765
Sequence identity: 71.48 (203/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------ADAGY-PA-PAAAGA--GKATT-EQKL-ED-
Sequence 2 -------------------ADAGYTPAAPAAAGAG-GKATTDEQKLLEDV

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSK----AAAAKAPGLVPKLD
           N-GFK-AVAAAA-VP-ADK-KTFEAAFT-SSK----AAA-KAPGL-P-L-
Sequence 2 NAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIAAAATKAPGLIPQLN

Sequence 1 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG
           AA---AY-AA-GATPEAK-D-FV--LTEALRVIAGALEVHAVKP-TEE-G
Sequence 2 AATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVG

Sequence 1 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST
           -AKIPAGELQI-DKIDAAF--AATAA--AP--DKFTVFE-AFNKAIKEST
Sequence 2 AAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKEST

Sequence 1 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV
           GGAY--YK-IPSLE-AVKQAYAATVA-AP-VKY-VFE-AL-KAITAMSE-
Sequence 2 GGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEA

Sequence 1 QKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QK---P---A-----GAAT-AAG-A-GAAT-AAGGYKV
Sequence 2 QKEAKPVAAAT----GAATAAAGVAAGAATAAAGGYKV



Alignment 8
Sequence 1:
Sequence 2: Allergen Dac g 5.02, Sequence: AAK62277
Sequence identity: 72.18 (205/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------ADAGY-PA--A---AA-GKA-TEEQKLIED-
Sequence 2 -------------------ADAGYTPAAAATPAAAGGKAMTEEQKLIEDV

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----AAAKAPGLVPKLD
           N-GFKAAVAAA-S-P-ADKFKTFEA-FT---KA----AA-K-P--V-KLD
Sequence 2 NAGFKAAVAAASSAPPADKFKTFEATFTAACKANIAAAATKVPLFVAKLD

Sequence 1 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG
           AAY-VAYK-A-G-TPEAK-D-FVA-LTEALRVIAGALEVHAVKP--EE--
Sequence 2 AAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAAEEVP

Sequence 1 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST
           -AKIPAGELQI-DKIDAA-K-AATAA--APA-DKFTVFE-AFNKAIKEST
Sequence 2 AAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKEST

Sequence 1 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV
           GGAY--YK-IP-LEAAVKQAYAATVAAAP-VKYAVFEAALTKAITAMSE-
Sequence 2 GGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEA

Sequence 1 QKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QKV--PA--A-----GAAT-AA-AA-GAAT-AAGGYKV
Sequence 2 QKVATPAAAAT----GAATAAASAATGAATAAAGGYKV



Alignment 9
Sequence 1:
Sequence 2: Allergen Dac g 5.01, Sequence: AAK62276
Sequence identity: 71.83 (204/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------ADAGY-PA--A----A-GKA-TEEQ-LIED-
Sequence 2 -------------------ADAGYTPAAAATPATAGGKAMTEEQTLIEDV

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----AAAKAPGLVPKLD
           N-GFKAAVAAA-S-P-ADKFKTFEA-FT---KA----AA-K-P--V-KLD
Sequence 2 NAGFKAAVAAASSAPPADKFKTFEATFTAACKANIAAAATKVPLFVAKLD

Sequence 1 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG
           AAY-VAYK-A-G-TPEAK-D-FVA-LTEALRVIAGALEVHAVKP--EE--
Sequence 2 AAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGALEVHAVKPAAEEVP

Sequence 1 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST
           -AKIPAGELQI-DKIDAA-K-AATAA--APA-DKFTVFE-AFNKAIKEST
Sequence 2 AAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKEST

Sequence 1 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV
           GGAY--YK-IP-LEAAVKQAYAATVAAAP-VKYAVFEAALTKAITAMSE-
Sequence 2 GGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEA

Sequence 1 QKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           QKV--PA-----VA-GAAT-AA-AA-GAAT-AAGGYKV
Sequence 2 QKVATPAA----VATGAATAAASAATGAATAAAGGYKV



Alignment 10
Sequence 1:
Sequence 2: Allergen Hol l 5.0201, Sequence: CAB10766
Sequence identity: 60.92 (173/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------------------------------QKL-ED-
Sequence 2 -------------------------------------------QKLLEDV

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFT-------SSSKAAAAKAPGLVP
           N--FKAAVAAAA-VP-ADK-KTF--AFT---------SKA---K-P-L--
Sequence 2 NASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSS

Sequence 1 KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTE
           KL--AY--A-KA--G-T-EAK-D-FV--LTEALRVIAGALEVHAVKP-TE
Sequence 2 KLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATE

Sequence 1 EPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIK
           E---AKIPAG-LQ--DKIDA-FK-AATAA--APA-DKFTVFE-AFNKA-K
Sequence 2 EVPAAKIPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALK

Sequence 1 ESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM
           ESTGGAY--YK-IPSLEAAVKQAYA-TVAAAP-VKYAVFEAALTKAITAM
Sequence 2 ESTGGAYESYKFIPSLEAAVKQAYASTVAAAPEVKYAVFEAALTKAITAM

Sequence 1 SEVQKVSQPA---TGAATVAAGAATTAAGAASGAATVAAGGYKV
           S--QKV-QPA---TGAATVAAGAATTAAG---------------
Sequence 2 SQAQKVAQPAAAATGAATVAAGAATTAAGGYKV-----------



Alignment 11
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22285
Sequence identity: 70.07 (199/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGY-APAT---------------
           --------A---------GP--SY-AD-GY-APAT---------------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADVGYGAPATLATPATPAAPAAGYT

Sequence 1 PAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAF-
           PAA---AA-KATT-EQKLIE-IN-GFKAAVAAAA-VPA-DK-KTF-A-F-
Sequence 2 PAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFG

Sequence 1 TSSSKA-------------AAAKAPGLVPKLDAAYSVAYKAAVGATPEAK
           T-S-KA-------------AA-----L--KLDAAY--AYK-A-GATPEAK
Sequence 2 TASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAK

Sequence 1 FDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAA
           -D--VA-L-EALR-IAG-LEVHAVKP--EE-----IPAGELQ-IDK-DAA
Sequence 2 YDAYVATLSEALRIIAGTLEVHAVKPAGEE--VKAIPAGELQVIDKVDAA

Sequence 1 FKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVK
           FKVAATAA--APA-DKFTVFEAAFN-AIK-STGGAY--YK-IP-LEAAVK
Sequence 2 FKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVK

Sequence 1 QAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAATVAA
           Q-YAATVA-AP-VKY-VFE-AL-KAITAMS--QK---PA---T--AT-A-
Sequence 2 QSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAV

Sequence 1 GAATTAAGAASGAATVAAGGYKV------------
           GAAT-A-GAA-GAAT-AAGGYK-------------
Sequence 2 GAATGAVGAATGAATAAAGGYKTGAATPTAGGYKV



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 5.0101, Sequence: CAA52753
Sequence identity: 68.31 (194/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPA--AAG---------
           --------A---------GP--SY-AD-GY-PATPA--AAG---------
Sequence 2 MAVHQYTVALFLAVALVAGPAASYAADLGYGPATPAAPAAGYTPATPAAP

Sequence 1 ---AAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAF-TS
           ---A-AGKATTEEQKLIE-IN-GFKAA-AAAA-V--ADK--TF-A-F---
Sequence 2 AEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAA

Sequence 1 SSKAAAAKAPG-------------LVPKLDAAYSVAYKAAVGATPEAKFD
           S-KA-A----G-------------L--KLDAAY--AYK-A-GATPEAK-D
Sequence 2 SNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD

Sequence 1 SFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFK
           --VA-L-EALR-IAG-LEVHAVKP--EE-----IPAGELQ-I-K-DAAFK
Sequence 2 AYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFK

Sequence 1 VAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQA
           VAATAA--APA-DKFTVFEAAFN-AIK-STGGAY--YK-IP-LEAAVKQA
Sequence 2 VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQA

Sequence 1 YAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATT
           YAATVA-AP-VKY-VFE-AL-KAITAMSE-QK---PA--A---A----T-
Sequence 2 YAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATA----TA

Sequence 1 AAGAASGAATVAAGGYKV
           A-GAA-GAAT-A-GGYKV
Sequence 2 AVGAATGAATAATGGYKV



Alignment 13
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56164
Sequence identity: 58.10 (165/284)
Sequence 1 --AAAAVPRRGPRGGPGRSYTADAGYAPATPA--AAGAAAGKATTEEQKL
           ---------------------A-----P-TP-------A--KAT------
Sequence 2 MAVQKYTMALFLAVALVAGPAAPTPPTPRTPPLLPPPRARDKATLTSRS-

Sequence 1 IEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----AAAKAPGLV
           -EDIN--------A--SVP-ADKFKTF---------A----AA-KAP-L-
Sequence 2 VEDINAASRRPWWA--SVPPADKFKTFADHVLCVPNADVTSAATKAPQLK

Sequence 1 PKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVT
           -KLDAAY-VAY-AA-G-TPEAK-D-F-A-LTEALRVIAGA-EVHAVKP-T
Sequence 2 AKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPAT

Sequence 1 EEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAI
           EE------P-GELQI-DKIDAAFK-AATAA--APA-DKFTVFE-AFNKAI
Sequence 2 EE--VVADPVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAI

Sequence 1 KESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA
           KEST-GAY-TYK-IPSLEAAVKQAY-ATVA-AP-VKYAVFEA-LTKAITA
Sequence 2 KESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITA

Sequence 1 MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV--------
           MSE-QKV--P-----------------AA-GAATVAA-------------
Sequence 2 MSEAQKVAKPP-----LSPQPPQVLPLAAGGAATVAAASDVRVCRSHGTL

Sequence 1 ------------------------------
           ------------------------------
Sequence 2 QDACLLRCRGGCQPVVWRGGSHRARGGYKV



Alignment 14
Sequence 1:
Sequence 2: Allergen Phl p 5.0107, Sequence: AAC16527
Sequence identity: 66.55 (189/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYA-PATPAAAGAA--AGKATTEEQKLI
           -------------------AD-GY--PATPAA---A--AGKATTEEQKLI
Sequence 2 -------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLI

Sequence 1 EDINVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAA----AKAPG--
           E-IN-GFKAA-AAAA-VP-ADK-KTF-A-F---S-KA-A----A---G--
Sequence 2 EKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAA

Sequence 1 -------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -------L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-L
Sequence 2 ESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP--EE-----IPAGELQ-I-K-D-AFKVAATAA--APA-DKFTV
Sequence 2 EVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FEAAFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE
Sequence 2 FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           -AL-KAITAMSE-QK---PA--A---A----T-A-GAA-GA-T-AAGGYK
Sequence 2 TALKKAITAMSEAQKAAKPAAAATATA----TSAVGAATGATTAAAGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 15
Sequence 1:
Sequence 2: Allergen Phl p 5.0106, Sequence: AAC16526
Sequence identity: 66.90 (190/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYA-PATPAAAGAA--AGKATTEEQKLI
           -------------------AD-GY--PATPAA---A--AGKATTEEQKLI
Sequence 2 -------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLI

Sequence 1 EDINVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAA----AKAPG--
           E-IN-GFKAA-AAAA-VP-ADK-KTF-A-F---S-KA-A----A---G--
Sequence 2 EKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAA

Sequence 1 -------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -------L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-L
Sequence 2 ESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP--EE-----IPAGELQ-I-K-D-AFKVAATAA--APA-DKFTV
Sequence 2 EVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FEAAFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE
Sequence 2 FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           -AL-KAITAMSE-QK---PAT-A---A----T-A-GAA-GAAT-A-GGYK
Sequence 2 TALKKAITAMSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 16
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22284
Sequence identity: 65.85 (187/284)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKK

Sequence 1 ----------------------------------AAAAVPRRGPRGGPGR
           -----------------------------------A-AV--------P--
Sequence 2 LDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKAPPASKFPAK

Sequence 1 SYTADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPA
           -----A-Y-PA-PA-A---A-KATT-EQKLIE-INVGFKAAVAAAA-VPA
Sequence 2 PAPKVAAYTPAAPAGA---APKATTDEQKLIEKINVGFKAAVAAAAGVPA

Sequence 1 ADKFKTFEAAFTSSSKAAAAKAPGLVPK--------------LDAAYSVA
           A-K-KTF-A-F---S--A-A-A----PK--------------LDAAY--A
Sequence 2 ASKYKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLA

Sequence 1 YKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPA
           YK-A-GATPEAK-D--VA-L-EALR-IAG-LEVH-VKP--EE-----IPA
Sequence 2 YKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHGVKPAAEE--VKAIPA

Sequence 1 GELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDT
           GELQ-IDK-DAAFKVAATAA--APA-DKFTVFEAAFN-AIK-STGGAY--
Sequence 2 GELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQS

Sequence 1 YKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQP
           YK-IP-LEAAVKQ-YAATVA-AP-VKY-VFE-AL-KAITAMS--QK---P
Sequence 2 YKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKP

Sequence 1 ATGAATVAAGAATTAAGAASGAATVAAGGYKV
           A--------G-AT-A-GAA-GAAT-AAGGYKV
Sequence 2 AAAVT----GTATSAVGAATGAATAAAGGYKV



Alignment 17
Sequence 1:
Sequence 2: Allergen Phl p 5.0109, Sequence: CAD87529
Sequence identity: 65.85 (187/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           ------------GP-------AGY-PA-PA-A---AGKATTEEQKLIE-I
Sequence 2 -------ADLGYGPATPAAPAAGYTPAAPAGA-EPAGKATTEEQKLIEKI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAAAKAPG---------
           N-GFKAA-AAAA-VP-ADK--TF-A-F---S-KA-A----G---------
Sequence 2 NAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESS

Sequence 1 ----LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVH
           ----L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-LEVH
Sequence 2 SKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVH

Sequence 1 AVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEA
           AVKP--EE-----IPAGELQ-I-K-DAAFKVAATAA--APA-DKFTVFEA
Sequence 2 AVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEA

Sequence 1 AFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL
           AFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE-AL
Sequence 2 AFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL

Sequence 1 TKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           -KAITAMSE-QK---PA--A---A----T-A-GAA-GAAT-A-GGYKV
Sequence 2 KKAITAMSEAQKAAKPAAAATATA----TSAVGAATGAATAATGGYKV



Alignment 18
Sequence 1:
Sequence 2: Allergen Phl p 5.0102, Sequence: Q40962
Sequence identity: 66.20 (188/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAA-AGA-AAGKATTEEQKLIE
           ------------GP-------AGY-PATPAA-AGA-AAGKATTEEQKLIE
Sequence 2 -------ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIE

Sequence 1 DINVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAAAKAPG-------
           -IN-GFKAA-A-A---PA-DK--TF-A-F---S-KA-A----G-------
Sequence 2 KINAGFKAALAGAGVQPA-DKYRTFVATFGPASNKAFAEGLSGEPKGAAE

Sequence 1 ------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALE
           ------L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-LE
Sequence 2 SSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE

Sequence 1 VHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVF
           VHAVKP--EE-----IPAGELQ-I-K-DAAFKVAATAA--APA-DKFTVF
Sequence 2 VHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVF

Sequence 1 EAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEA
           EAAFN--IK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE-
Sequence 2 EAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET

Sequence 1 ALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           AL-KAITAMSE-QK---PA--A---A----T-A-GAA-GAAT-A-GGYKV
Sequence 2 ALKKAITAMSEAQKAAKPAAAATATA----TAAVGAATGAATAATGGYKV



Alignment 19
Sequence 1:
Sequence 2: Allergen Phl p 5.0108, Sequence: AAC16528
Sequence identity: 66.55 (189/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYA-PATPAAAGAA--AGKATTEEQKLI
           -------------------AD-GY--PATPAA---A--AGKATTEEQKLI
Sequence 2 -------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLI

Sequence 1 EDINVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAA----AKAPG--
           E-IN-GFKAA-AAAA-VP-ADK-KTF-A-F---S-KA-A----A---G--
Sequence 2 EKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAA

Sequence 1 -------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -------L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-L
Sequence 2 ESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP--EE-----IPAGELQ-I-K-D-AFKVAATAA--APA-DKFTV
Sequence 2 EVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FEAAFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE
Sequence 2 FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           -AL-KA-TAMSE-QK---PAT-A---A----T-A-GAA-GAAT-A-GGYK
Sequence 2 TALKKAFTAMSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 20
Sequence 1:
Sequence 2: Allergen Poa p 5, Sequence: P22286
Sequence identity: 67.61 (192/284)
Sequence 1 -----AAAAVPRRGPRGGPGRSYTADAGY-APATPAAAGA---------A
           --------A--------GP--SY-AD--Y-APATPAA--A---------A
Sequence 2 MAVQKYTVALFLVALVVGPAASYAADLSYGAPATPAAPAAGYTPAAPAGA

Sequence 1 AGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAA
           A-KATT-EQK-IE-INVGFKAAVAAA--VPAA-K-KTF-A-F---S--A-
Sequence 2 APKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASNKAF

Sequence 1 AKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVAS
           A-A----P-----------L--KLDAAY--AYK-A-GATPEAK-D--VA-
Sequence 2 AEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVAT

Sequence 1 LTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATA
           L-EALR-IAG-LEVH-VKP--EE------PAGELQ-IDK-DAAFKVAATA
Sequence 2 LSEALRIIAGTLEVHGVKPAAEE--VKATPAGELQVIDKVDAAFKVAATA

Sequence 1 AATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATV
           A--APA-DKFTVFEAAFN-AIK-STGGAY--YK-IP-LEAAVKQ-YAATV
Sequence 2 ANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATV

Sequence 1 AAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAA
           A-AP-VKY-VFE-AL-KAITAMS--QK---PA--A-----G-AT-A-GAA
Sequence 2 ATAPAVKYTVFETALKKAITAMSQAQKAAKPAAAAT----GTATAAVGAA

Sequence 1 SGAATVAAGGYKV
           -GAAT-AAGGYKV
Sequence 2 TGAATAAAGGYKV



Alignment 21
Sequence 1:
Sequence 2: Allergen Phl p 5, Sequence: AAK25823
Sequence identity: 54.93 (156/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------------P--P---------------------
Sequence 2 -----------------PISVTAPPPQLPRPPATPPPPPPPQLGASPYKL

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAAAKAPG---------
           ----KA-----A-VP-ADK--TF-A-F---S-KA-A----G---------
Sequence 2 GPSPKARSERPAIVPPADKYRTFVATFGAASNKAFAEGLSGEPKGGAESS

Sequence 1 ----LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVH
           ----L--KLDAAY--AYK-A-GATPEAK-D--VA-L-EALR-IAG-LEVH
Sequence 2 SKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVH

Sequence 1 AVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEA
           AVKP--EE-----IPAGELQ-I-K-DAAFKVAATAA--APA-DKFTVFEA
Sequence 2 AVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEA

Sequence 1 AFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL
           AFN-AIK--TGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE-AL
Sequence 2 AFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL

Sequence 1 TKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           -KAITAMSE-QK---PA--A---A----T-A-GA--GA-T-AAGGYKV
Sequence 2 KKAITAMSEAQKAAKPAAAATATA----TSAVGAPTGATTAAAGGYKV



Alignment 22
Sequence 1:
Sequence 2: Allergen Phl p 5.0105, Sequence: AAC16525
Sequence identity: 65.85 (187/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYA-PATPAAAGAA--AGKATTEEQKLI
           -------------------AD-GY--PATPAA---A--AGKATTEEQKLI
Sequence 2 -------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLI

Sequence 1 EDINVGFKAAVAAAASVPAADKFKTFEAAF-TSSSKAAA----AKAPG--
           E-IN-GFKAA-AAAA-VP-ADK-KTF-A-F---S-KA-A----A---G--
Sequence 2 EKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAA

Sequence 1 -------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -------L--KLDAAY--AYK-A-GATPEA--D--VA-L-EALR-IAG-L
Sequence 2 ESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATLSEALRIIAGTL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP--EE-----IPAGELQ-I-K-D-A-KVAATAA--APA-DKFTV
Sequence 2 EVHAVKPAAEE--VKVIPAGELQVIEKVDSALKVAATAANAAPANDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FEAAFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE
Sequence 2 FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           -AL-KAITA-SE-QK---PAT-A---A----T-A-GAA-GAAT-A-GGYK
Sequence 2 TALKKAITATSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 23
Sequence 1:
Sequence 2: Allergen Phl p 5.0104, Sequence: CAB05372
Sequence identity: 64.79 (184/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYA-PATPAAAGAA--AGKATTEEQKLI
           -------------------AD-GY--PATPAA---A--AGKATTEEQKLI
Sequence 2 -------------------ADLGYGGPATPAAPAEAAPAGKATTEEQKLI

Sequence 1 EDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSK-------------AA
           E-IN-GFKAA-AAAA-VP-ADK-KTF-A-F---S--------------AA
Sequence 2 EKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAA

Sequence 1 AAKAPG-LVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL
           -----G-L--KL-AAY--AYK---GATPEAK-D--VA-L-EALR-IAG-L
Sequence 2 ESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGTL

Sequence 1 EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
           EVHAVKP--EE-----IPAGELQ-I-K-D-A-KVAATAA--A-A-DKFTV
Sequence 2 EVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTV

Sequence 1 FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFE
           FEAAFN-AIK-STGGAY--YK-IP-LEAAVKQAYAATVA-AP-VKY-VFE
Sequence 2 FEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE

Sequence 1 AALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYK
           -AL-KAITAMSE-QK---PAT-A---A----T-A-GAA-GAAT-A-GGYK
Sequence 2 TALKKAITAMSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYK

Sequence 1 V
           V
Sequence 2 V



Alignment 24
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56167
Sequence identity: 45.77 (130/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKI
           ------------AK-D-F-A-LTEALRVIAGA-EVHAVKP-TEE---AKI
Sequence 2 ------------AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKI

Sequence 1 PAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAY
           PAGELQI-DKIDAAFK-AATAA--APA-DKFTVFE-AFNKAIKE--GGAY
Sequence 2 PAGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKERHGGAY

Sequence 1 DTYKCIPSLEAA-VKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKV
           -TYK-IPSLEA---KQAY-ATVA-AP-VKYAVFEA-LTKAITAMSE-QKV
Sequence 2 ETYKFIPSLEASRSKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKV

Sequence 1 SQPATGAATVAAGAATTAAGAASGAAT--VAAGGYKV
           --P-------AAGAAT-A-GAA--AA-----AGGYKV
Sequence 2 AKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV



Alignment 25
Sequence 1:
Sequence 2: Allergen Sec c 5.0101, Sequence: CBG76811
Sequence identity: 57.39 (163/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQ
           --------A---------GP--SY-----YAPA-P--------KATT-EQ
Sequence 2 MAVQQYTVALFLAVALVAGPAVSYGT---YAPAAPGTQP----KATTPEQ

Sequence 1 KLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS-SSKAAA----AKAP
           KL-E-IN-GFKAAV-AAA-V--ADK-KTF---F---S-KA-A----A-A-
Sequence 2 KLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKAFADVLTAAAS

Sequence 1 GLVP-----------KLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRV
           G--P------------L---Y--AY--A-GATPE-K-D--VASLTE-LRV
Sequence 2 GQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRV

Sequence 1 IAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPAD
           I-GA-EVHAVKP--EE------PA--L---D-IDAA---AATAA--AP--
Sequence 2 ISGAFEVHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAPTN

Sequence 1 DKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVK
           DKF-VFE--FNKAIKE-TGGAY--Y---P-LE-AVKQAYAATVA-AP-VK
Sequence 2 DKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVK

Sequence 1 YAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVA
           YAVF-AAL-KAI-AM-E--K---PA--AA--A---AT---GAA-GAA---
Sequence 2 YAVFQAALSKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---

Sequence 1 AGGYKV
           AGGYK-
Sequence 2 AGGYKA



Alignment 26
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40237
Sequence identity: 64.79 (184/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAA--------
           --------A---------GP--SY-ADAGYAPATPA---A-A--------
Sequence 2 MAVQKHTVALFLAVALVAGPAASYAADAGYAPATPATPAAPATAATPATP

Sequence 1 -----------GKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEA
           -----------GKATTEEQKLIE-IN-GFKAAVAAAA-VP-ADK-KTF--
Sequence 2 ATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVE

Sequence 1 AF-TSSSKA-AAAKAPG--------LVPKLDAAYSVAYKAAVGATPEAKF
           -F-T---KA-----A-G--------L--KLDAA---AY-AA-GATPEAK-
Sequence 2 TFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKY

Sequence 1 DSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAF
           D--VA-LTEALRVIAG-LEVHAVKP--EE-----IPA-E-Q-IDK-DAA-
Sequence 2 DAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAY

Sequence 1 KVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQ
           --AATAA--APA-DKFTVFE--FN-AIK-S-G-AYD-YK-IP-L-AAVKQ
Sequence 2 RTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQ

Sequence 1 AYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGA---------
           AYAA--A-AP-VKY-V-E-AL-KA-TAMSE--K---PA--A---------
Sequence 2 AYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAA

Sequence 1 ---ATVAAGAATTAAGAASGAAT--------VAAGGYKV
           ---AT-AA--AT----AA---AT---------AAGGYKV
Sequence 2 TATATPAAAYATATPAAATATATPAAATATPAAAGGYKV



Alignment 27
Sequence 1:
Sequence 2: Allergen Lol p 5, Sequence: Q40240
Sequence identity: 52.46 (149/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPA---TPAA-AGAAAGKAT
           --------A---RRGPRGGPGRSY-ADAGY-PA---TPA--A---AG---
Sequence 2 MAVQKYTVALFLRRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWR

Sequence 1 TEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS----------S
           -------E----G-----A-----P-------------S----------S
Sequence 2 EGDDRRAE--AAGGRQRLASRQPWPPLPTPLRRTSSRSSRPPSPSPPRAS

Sequence 1 SKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIA
           S---AAKAPGL-PKLD-AY-VAYKAA--A-P--------------LRVIA
Sequence 2 SPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHRSLRVIA

Sequence 1 GALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDK
           GALEVHAVKP-TEE---AKIP-GELQI-DKIDAAFK-AATAA--AP--DK
Sequence 2 GALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDK

Sequence 1 FTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYA
           FTVFE-AFNKA--E-TGGA-------P---------------AAP-VKYA
Sequence 2 FTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYA

Sequence 1 VFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAG
           VFEAALTKAITAM---QK---PA--AAT-AA--AT-AA-AA---------
Sequence 2 VFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLV

Sequence 1 GYKV-------
           -----------
Sequence 2 VQSLISLLIYY



Alignment 28
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56166
Sequence identity: 61.27 (174/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGY--APATPAAAGAAAGKATTE
           --------A---------GP--SY-ADAG----PATPA--GAAAGKATT-
Sequence 2 MAVQKYTVALFLAMALVAGPAASYAADAGTPPTPATPAVPGAAAGKATTH

Sequence 1 EQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLV
           EQKLIEDIN--FK------AS-P-ADK-KTFE-AF-S----A-A---GL-
Sequence 2 EQKLIEDINAAFKWW---PASAPPADKYKTFETAF-SKANIAGASTKGL-

Sequence 1 PKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVT
           ---DAAYSV-Y--A-GATPEAK-DSFV--LTEALR--AG-LEVHAVKP-T
Sequence 2 ---DAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTLEVHAVKPAT

Sequence 1 EE--PGMAKIPAGELQIIDKIDAAFKVAAT---------AAATAPADDKF
           EE--P--AKI--------------FK-AAT---------AA--APA-DKF
Sequence 2 EEEVPS-AKILRANSRSSTR-SSRFKIAATVATPLSHSTAANSAPANDKF

Sequence 1 TVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAV
           TVFE-AFNKAIKE--GG---TYK-IPSLEAAVKQAY-ATVA-AP-VKYAV
Sequence 2 TVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAV

Sequence 1 FEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAAS-GAATVAAG
           FEA-LTKAITAMSE-QKV--P--------------A-GAA---AA----G
Sequence 2 FEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRG

Sequence 1 GYKV
           GYKV
Sequence 2 GYKV



Alignment 29
Sequence 1:
Sequence 2: Allergen Hor v 5.0101, Sequence: U57845
Sequence identity: 42.61 (121/284)
Sequence 1 --------------------------------AAAAVPRRGPRGGPGRSY
           -----------------------------------------P-----R--
Sequence 2 MANSGREHSAVPRRRNLVALVPRHGCYAEFSLYVCVGNINAPFPVFNRTT

Sequence 1 TADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAAD
           --------A--------------------------------------A--
Sequence 2 FIANAGIEAELEPHFLLLLFTFSSSSSFFTLLKTMIHFTDRSDNKNKAMM

Sequence 1 KFKTFEAAFTSSSKAAAA-KAPG-------LVPKLDAAYSVAYKAAVGAT
           ----F--AF----K-AA-----G-------L---L---Y--AY--A-GAT
Sequence 2 RGREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGAT

Sequence 1 PEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDK
           PEAK-D--VA-LTE-LRVI-G-LEVH-VKP--EE------PAGEL--ID-
Sequence 2 PEAKYDAYVATLTESLRVISGTLEVHSVKPAAEE--VKGVPAGELKAIDQ

Sequence 1 IDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLE
           -DAAF--AATAA--APA-DKFTVFE-----------GGAY--YK-IP-LE
Sequence 2 VDAAFRTAATAADAAPANDKFTVFESLQQGPSRKPRGGAYESYKFIPALE

Sequence 1 AAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAA
           AAVKQAYAATVAAAP-VK--VF--AL-KAI-AM----KV--PA---T--A
Sequence 2 AAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGKVAKPAAAATATA

Sequence 1 TVAAGAATTAAGAASGAATVAAGGYKV
           TVAAGAA-TA-----------------
Sequence 2 TVAAGAAATAGNYKV------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Pha a 5, Sequence: P56165
Sequence identity: 46.83 (133/284)
Sequence 1 ------AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKAT---T
           --------A---------GP---Y--D-GYAPATPAA----A--AT----
Sequence 2 MAVQKYTVALFLAVALVAGPAALYAGD-GYAPATPAASATLATPATPAAS

Sequence 1 EEQKLIEDINVGFKAAVAA--AASVPAADKFKTFEAA----FTSSSKAAA
           -------------KA-------A-----D--K---------F--S----A
Sequence 2 PQHAGTTEYHIVRKAGLNEEKNAARQTDDEQKRSDEINCPDFNKSVHCRA

Sequence 1 AKAP------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVI
           ---P----------K-D-A----Y----G-------D--V-S------VI
Sequence 2 DRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVGSVSSEFHVI

Sequence 1 AGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADD
           --A-EV-------EE-----IPAGE---I-K--AAF--AATAA--APA-D
Sequence 2 ESAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPAND

Sequence 1 KFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKY
           KFTVF---FNKAIKE-TGGAY--YK-IP-LEAAVKQAYAA--A-AP-VKY
Sequence 2 KFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKY

Sequence 1 AVFEAALTKAITAMSEVQKVSQPAT--GAAT--VAAGAATTAAGAAS--G
           AVFE-AL-KAI-AMSE-QK---PA----AAT----A--AT-AA------G
Sequence 2 AVFETALKKAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLG

Sequence 1 AATVAA--GGYKV
           -AT-AA--GGYKV
Sequence 2 TATPAAVAGGYKV



Alignment 31
Sequence 1:
Sequence 2: Allergen Phl p 6.0101, Sequence: P43215
Sequence identity: 26.06 (74/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------A--------P-A-G---GKATTEEQKLIED-
Sequence 2 -----------MVAMFLAVAVVLGLATSPTAEG---GKATTEEQKLIEDV

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----AAAKAPGLVPKLD
           N--F-AA-A--A-VP-ADK-KTFEAAFT-SSK-----A--KAP-LVPKLD
Sequence 2 NASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLD

Sequence 1 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG
           --Y--AY-AA--A-PE-K---FV----EALR-IAG--EVHAVKP------
Sequence 2 EVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA----

Sequence 1 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 6.0102, Sequence: CAA76556
Sequence identity: 26.06 (74/284)
Sequence 1 AAAAVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDI
           -------------------A--------P-A-G---GKATTEEQKLIEDI
Sequence 2 -----MAAHKFMVAMFLAVAVVLGLATSPTAEG---GKATTEEQKLIEDI

Sequence 1 NVGFKAAVAAAASVPAADKFKTFEAAFTSSSKA----AAAKAPGLVPKLD
           N--F-AA-A--A-VP-ADK-KTFEAAFT-SSK-----A--KAP-LVPKLD
Sequence 2 NASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLD

Sequence 1 AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPG
           --Y--AY-AA--A-PE-K---FV----EAL--IAG--EVHAVKP------
Sequence 2 EVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKPGA----

Sequence 1 MAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKEST
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
           --------------------------------------
Sequence 2 --------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.