The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Dau c 1.0101

Sequence 1335877

Full FASTA alignment

Sequence name:
Query sequence:
LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
DAQNTALFKAIEAYLIAN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Dau c 1.0101AAB01092Go!168211.51.0e-56
2Dau c 1.0102BAA13604Go!154195.46.5e-52
3Dau c 1.0105CAB06416Go!154191.69.0e-51
4Dau c 1.0104CAB03716Go!154191.69.0e-51
5Dau c 1.0103CAB03715Go!154189.05.5e-50
6Api g 1P49372Go!154167.41.8e-43
7Pet c PR10CAA67246Go!155123.72.4e-30
8Dau c 1.0201AAL76932Go!154104.71.3e-24
9Api g 1.0201P92918Go!159104.02.2e-24
10Pru ar 1O50001Go!16096.25.0e-22
11Act c 8.0101CAM31908Go!15995.86.6e-22
12Act d 8.0101CAM31909Go!15794.31.7e-21
13Tar o RAPAAB92255Go!15790.72.1e-20
14Cas s 1CAD10374Go!16090.82.1e-20
15Pru du 1.0101B6CQS9Go!16090.62.4e-20
16Fag s 1.0101ACJ23864Go!16089.45.6e-20
17Mal d 1CAA96535Go!16088.69.7e-20
18Mal d 1CAA96536Go!16087.22.6e-19
19Mal d 1CAA96537Go!16086.83.4e-19
20Bet v 1.2001CAA96543Go!16086.63.9e-19
21Bet v 1.0201CAA54421Go!16086.44.5e-19
22Bet v 1.1401CAA57497Go!16086.25.1e-19
23Bet v 1.0301CAA54481Go!16086.25.1e-19
24Bet v 1.1901CAA96542Go!16086.25.1e-19
25Bet v 1.0901CAA54488Go!16086.05.9e-19
26Bet v 1.1801CAA96540Go!16085.86.8e-19
27Jug r 5.0101APD76154Go!16085.86.8e-19
28Fra a 1Q256S7Go!16085.48.9e-19
29Fra a 1Q256S6Go!16085.48.9e-19
30Fra a 1Q3T923Go!16085.21.0e-18
31Bet v 1P45431Go!15984.91.2e-18
32Que a 1.0301ABZ81046Go!16085.01.2e-18
33Car b 1.0302CAB02217Go!16185.01.2e-18
34Bet v 1.1401P43186Go!15984.71.4e-18
35Bet v 1P43176Go!15984.71.4e-18
36Bet v 1.2101CAA96544Go!16084.81.4e-18
37Bet v 1.2901CAB02160Go!16084.81.4e-18
38Bet v 1P43184Go!15984.51.6e-18
39Aln g 1AAB24432Go!16084.61.6e-18
40Bet v 1CAA05188Go!16084.61.6e-18
41Car b 1.0301CAB02216Go!16184.61.6e-18
42Car b 1.0105CAB02208Go!16084.22.1e-18
43Car b 1.0106CAB02209Go!16084.22.1e-18
44Que a 1.0401ABZ81047Go!16084.02.4e-18
45Pru p 1.0101Q2I6V8Go!16084.02.4e-18
46Fra a 1Q256S2Go!16084.02.4e-18
47Que m 1.0101AUH28179Go!16084.02.4e-18
48Bet v 1.at10CAA07319Go!16084.02.4e-18
49Bet v 1CAA05189Go!16084.02.4e-18
50Mal d 1CAA96534Go!15983.72.7e-18
51Bet v 1.1501CAA96538Go!16083.82.7e-18
52Bet v 1.2801CAB02159Go!16083.82.7e-18
53Bet v 1.1501Q42499Go!16083.82.7e-18
54Bet v 1.at50CAA07326Go!16083.82.7e-18
55Bet v 1.0101CAA33887Go!16083.82.7e-18
56Bet v 1.at59CAA07327Go!16083.82.7e-18
57Bet v 1.2301CAA96545Go!16083.82.7e-18
58Bet v 1.1201CAA54695Go!15983.53.1e-18
59Car b 1.0104CAB02207Go!16083.63.1e-18
60Bet v 1.3001CAB02161Go!16083.63.1e-18
61Cor a 1.0301CAA96549Go!16083.63.1e-18
62Car b 1.0103CAB02206Go!16083.63.1e-18
63Car b 1.0112ABZ81043Go!16083.63.1e-18
64Pru av 1O24248Go!16083.63.1e-18
65Car b 1.0111ABZ81042Go!16083.63.1e-18
66Bet v 1.2501CAB02156Go!16083.63.1e-18
67Car b 1.0110ABZ81041Go!16083.43.6e-18
68Bet v 1.1101CAA54694Go!16083.43.6e-18
69Car b 1.0109ABZ81040Go!16083.43.6e-18
70Aln g 1P38948Go!15983.14.1e-18
71Bet v 1.at5CAA07329Go!16083.14.1e-18
72Bet v 1.1301CAA54696Go!16083.14.1e-18
73Can s 5.0101AFN42528Go!16183.24.1e-18
74Fra a 1Q256S4Go!15982.94.7e-18
75Bet v 1.1601CAA96546Go!16082.94.7e-18
76Bet v 1.at7CAA07330Go!16082.94.7e-18
77Cor a 1.0201CAA96548Go!16082.94.7e-18
78Cor a 1.0103CAA50325Go!16082.75.4e-18
79Car b 1.0108CAB02215Go!16082.75.4e-18
80Bet v 1.1701CAA96539Go!16082.75.4e-18
81Car b 1.0107CAB02213Go!16082.75.4e-18
82Bet v 1CAA05190Go!16082.56.2e-18
83Bet v 1.0101P15494Go!15982.37.1e-18
84Que i 1.0101QGS84240Go!15982.37.1e-18
85Bet v 1.0601CAA54484Go!16082.37.2e-18
86Ost c 1.0101ADK39021Go!16082.37.2e-18
87Bet v 1.at45CAA07325Go!16082.37.2e-18
88Bet v 1.at42CAA07324Go!16081.99.5e-18
89Bet v 1.0401CAA54482Go!16081.99.5e-18
90Bet v 1.0501CAA54483Go!16081.71.1e-17
91Bet v 1.0801CAA54487Go!16081.71.1e-17
92Sola l 4.0201NP_001275580Go!16081.71.1e-17
93Cor a 1.0101CAA50327Go!16081.51.2e-17
94Bet v 1.2601CAB02157Go!16081.51.2e-17
95Car b 1.0113ABZ81044Go!16081.51.2e-17
96Bet v 1CAA05186Go!16081.31.4e-17
97Bet v 1.2201CAA96547Go!16081.11.6e-17
98Bet v 1.1001CAA54489Go!16081.11.6e-17
99Cor a 1.0102CAA50328Go!16081.11.6e-17
100Bet v 1.at37CAA07323Go!16081.11.6e-17
101Bet v 1.0601P43179Go!15980.91.9e-17
102Bet v 1.at8CAA07318Go!16080.91.9e-17
103Bet v 1.2401CAB02155Go!16080.91.9e-17
104Bet v 1.0401P43177Go!15980.52.5e-17
105Cor a 1.0104CAA50326Go!16080.52.5e-17
106Bet v 1P43178Go!15980.32.9e-17
107Bet v 1P43183Go!15980.32.9e-17
108Que a 1.0201ABZ81045Go!15980.13.3e-17
109Cor a 1Q08407Go!15980.13.3e-17
110Car b 1.0102CAA47357Go!15979.93.8e-17
111Bet v 1.0701CAA54485Go!16079.93.8e-17
112Bet v 1P43185Go!15979.74.3e-17
113Car b 1P38950Go!15979.35.7e-17
114Bet v 1.2701CAB02158Go!16079.35.7e-17
115Bet v 1P43180Go!15978.51.0e-16
116Cor a 1.0404AAG40331Go!16178.21.3e-16
117Cor a 1.0402AAG40329Go!16178.21.3e-16
118Mal d 1AAD26559Go!15977.71.7e-16
119Car b 1P38949Go!15977.32.3e-16
120Pyr c 1O65200Go!15976.93.0e-16
121Mal d 1AAD26555Go!15976.93.0e-16
122Mal d 1AAD26548Go!15976.93.0e-16
123Cor a 1.0401AAD48405Go!16177.03.0e-16
124Cor a 1.0403AAG40330Go!16177.03.0e-16
125Que ac 1.0101QOL10866Go!15976.54.0e-16
126Mal d 1AAD26547Go!15976.54.0e-16
127Mal d 1CAA58646Go!15976.34.6e-16
128Mal d 1AAD26554Go!15976.15.3e-16
129Mal d 1AAD26558Go!15976.15.3e-16
130Mal d 1AAD26546Go!15975.96.1e-16
131Mal d 1AAD26552Go!15975.77.0e-16
132Mal d 1AAD26553Go!15975.58.0e-16
133Mal d 1CAA88833Go!15975.39.2e-16
134Sola l 4.0101AHC08073Go!16075.39.2e-16
135Mal d 1P43211Go!15874.91.2e-15
136Pha v 1CAA43637Go!15672.56.4e-15
137Ara h 8.0201EF436550Go!15372.18.3e-15
138Pha v 1P25985Go!15571.11.7e-14
139Vig r 1.0101Q2VU97Go!15570.72.2e-14
140Rub i 1.0101Q0Z8U9Go!13769.44.8e-14
141Gly m 4CAA42646Go!15868.97.8e-14
142Lyc e 4.0101CAA75803Go!17868.61.1e-13
143Pha v 1CAA43636Go!15568.11.3e-13
144Ara h 8.0101AAQ91847Go!15765.96.2e-13
145Bet v 1.at87CAA07328Go!12065.37.3e-13
146Bet v 1.at14CAA07320Go!12065.18.4e-13
147Fra a 1.0101Q5ULZ4Go!10040.51.7e-05
148Vig r 6.0101Q9ZWP8Go!15534.12.3e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Dau c 1.0101, Sequence: AAB01092
Sequence identity: 100.00 (168/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
Sequence 2 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
Sequence 2 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
Sequence 2 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA

Sequence 1 DAQNTALFKAIEAYLIAN
           DAQNTALFKAIEAYLIAN
Sequence 2 DAQNTALFKAIEAYLIAN



Alignment 2
Sequence 1:
Sequence 2: Allergen Dau c 1.0102, Sequence: BAA13604
Sequence identity: 90.48 (152/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MGAQSHSLEITSSVSAEKIF--IVLDVDTVIPKAAP
Sequence 2 --------------MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAP

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
Sequence 2 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
Sequence 2 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA

Sequence 1 DAQNTALFKAIEAYLIAN
           DAQNTALFKAIEAYLIAN
Sequence 2 DAQNTALFKAIEAYLIAN



Alignment 3
Sequence 1:
Sequence 2: Allergen Dau c 1.0105, Sequence: CAB06416
Sequence identity: 88.69 (149/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MGAQSHSLEITSSVSAEKIF--IVLDVDTVIPKAAP
Sequence 2 --------------MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAP

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSV-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
Sequence 2 GAYKSVEVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILL-FIESIETH-VVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
Sequence 2 DGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA

Sequence 1 DAQNTALFKAIEAYLIAN
           DAQNTALFKAIEAYLIAN
Sequence 2 DAQNTALFKAIEAYLIAN



Alignment 4
Sequence 1:
Sequence 2: Allergen Dau c 1.0104, Sequence: CAB03716
Sequence identity: 88.69 (149/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MGAQSHSLEITSSVSAEKIF--IVLDVDTVIPKAAP
Sequence 2 --------------MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAP

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
Sequence 2 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILL-FIESIETH-VVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
Sequence 2 DGDILLGFIESIETHLVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA

Sequence 1 DAQNTALFKAIEAYLIAN
           D-QNTALFKAIEAYLIAN
Sequence 2 DEQNTALFKAIEAYLIAN



Alignment 5
Sequence 1:
Sequence 2: Allergen Dau c 1.0103, Sequence: CAB03715
Sequence identity: 87.50 (147/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MGAQSHSLEITSSVSAEKIF--IVLDVDTVIPKAA-
Sequence 2 --------------MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAAT

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSV-VKGDGGAGTVRIITLPEGSPIT-MTVRTDAVNKEAL-YDSTVI
Sequence 2 GAYKSVEVKGDGGAGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILL-FIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
Sequence 2 DGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA

Sequence 1 DAQNTALFKAIEAYLIAN
           DAQNTALFKAIEAYLIAN
Sequence 2 DAQNTALFKAIEAYLIAN



Alignment 6
Sequence 1:
Sequence 2: Allergen Api g 1, Sequence: P49372
Sequence identity: 72.62 (122/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG-Q-H-LE-TSSVSAEKIF---V-DVDTV-PKAAP
Sequence 2 --------------MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAP

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           GAYKSV--KGDGG-GT--IITLP-G-PIT-MT-R-D-VNKEALT-D--VI
Sequence 2 GAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVI

Sequence 1 DGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFA
           DGDILL-FIESIE-H-V-VPTADGGSI-KTTAIFHTKGDAVVPEENIK-A
Sequence 2 DGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYA

Sequence 1 DAQNTALFKAIEAYLIAN
           --QNTALFKA-EAYLIAN
Sequence 2 NEQNTALFKALEAYLIAN



Alignment 7
Sequence 1:
Sequence 2: Allergen Pet c PR10, Sequence: CAA67246
Sequence identity: 50.60 (85/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG-Q-----ITSSV-A-K-F----LD-DT--P---P
Sequence 2 --------------MGVQKSEVVITSSVPAAKLFKALCLDIDTLLPQVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           GA-K------GDGG-GTV---TL---SP---M----DA--KEA-T-----
Sequence 2 GAIKGGEILEGDGGVGTVKLVTLGDASPYKTMKQKIDAIDKEAFTFSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           IDGDILL--I-SI--H---VPTADGG-----TA-F-TKGDAVVPEENIKF
Sequence 2 IDGDILLGYIDSINNHLSFVPTADGGCTATSTAVFNTKGDAVVPEENIKF

Sequence 1 ADAQNTALFKAIEAYLIAN
           A--QN---FKA-EAYL-AN
Sequence 2 ANDQNNLIFKAVEAYLLAN



Alignment 8
Sequence 1:
Sequence 2: Allergen Dau c 1.0201, Sequence: AAL76932
Sequence identity: 45.83 (77/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG-Q----E--S-VSAEK------LD-DTV-PK--P
Sequence 2 --------------MGVQKTEVEAPSTVSAEKMYQGFLLDMDTVFPKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV----GDGG-GTVR---L-E----T-M----D---K--L-Y--T-
Sequence 2 QLIKSVEILEGDGGVGTVRLVHLGEATEYTTMKQKVDVIDKAGLGYTYTT

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GDIL-E--ES-----VVVPT-DGG-I-K-T-I--TKGDAV-PE---K-
Sequence 2 IGGDILVEGLESVVNQFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKVKE

Sequence 1 ADAQNTALFKAIEAYLIAN
           A-------FKA-EAYL-AN
Sequence 2 ATEKSALAFKAVEAYLLAN



Alignment 9
Sequence 1:
Sequence 2: Allergen Api g 1.0201, Sequence: P92918
Sequence identity: 45.24 (76/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG-Q----E--S-VSAEK------LD-DTV-PK--P
Sequence 2 --------------MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV----GDGG-GTV----L-E----T-M----D---K--L-Y--T-
Sequence 2 QLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTT

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GDIL----ES-----VVVPT-DGG-I-K-T-I--TKGDAV-PE--IK-
Sequence 2 IGGDILVDVLESVVNEFVVVPT-DGGCIVKNTTIYNTKGDAVLPEDKIKE

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A-------FKA-EAYL-AN-----
Sequence 2 ATEKSALAFKAVEAYLLANLQFLA



Alignment 10
Sequence 1:
Sequence 2: Allergen Pru ar 1, Sequence: O50001
Sequence identity: 39.88 (67/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS----EK-F----LD-D--IPK-AP
Sequence 2 --------------MGVFTYETEFTSVIPPEKLFKAFILDADNLIPKVAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT----T--EGS-------R-D---K--L-Y--T-
Sequence 2 TAVKGTEILEGDGGVGTIKKVTFGEGSQYAYVKHRVDGIDKDNLSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V---DGGSI-KTT---HTKGD----EE--K-
Sequence 2 IEGDALSDVIENIAYDIKLVASPDGGSIVKTTSHYHTKGDVEIKEEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK--EAYL-AN-----
Sequence 2 GKEKAAGLFKLVEAYLLANPDAYN



Alignment 11
Sequence 1:
Sequence 2: Allergen Act c 8.0101, Sequence: CAM31908
Sequence identity: 41.67 (70/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------EI-S-V---K------LD-DT--PK--P
Sequence 2 --------------MGVVTYDMEIPSKVPPVKLYKAFILDGDTLVPKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K-V----GDG-AGT----T--EGS-------R-DA--K--LTY--T-
Sequence 2 HAIKCVKILEGDGCAGTIKEVTFGEGSHHKCVKQRVDAIDKDNLTYSYTI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L-E--ESI--H---V---DGGSI-K---I--TKGD--V-EE-IK-
Sequence 2 IEGDVLAEKFESISYHIKIVACPDGGSICKNRSIYTTKGDCKVSEEEIKL

Sequence 1 ADAQNTALFKAIEAYLIAN----
           --------FKA-EAYL-AN----
Sequence 2 GKEKAAEIFKALEAYLLANPDYC



Alignment 12
Sequence 1:
Sequence 2: Allergen Act d 8.0101, Sequence: CAM31909
Sequence identity: 43.45 (73/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MGA-----EI-SS-SAEK-F---VLD-DT-IPKA-P
Sequence 2 --------------MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A---V----GDGG-GT----T--EGS---S---R-D---KE--TY----
Sequence 2 HAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L--F-ESI--H---V-T-DGG-I-K---I---K-DA-V-EE-IK-
Sequence 2 IEGGALDVF-ESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKA

Sequence 1 ADAQNTALFKAIEAYLIAN---
           --------FK--EAYL-AN---
Sequence 2 GKERASGIFKKVEAYLLANPDC



Alignment 13
Sequence 1:
Sequence 2: Allergen Tar o RAP, Sequence: AAB92255
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ----------------------EITSS-S---IF---V-D-DT--PKA-P
Sequence 2 ----------------MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           --YKS-----GDGG-GT---IT---G-P-TS-----DA----------T-
Sequence 2 ETYKSIKTIEGDGGVGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --GD-L---IES---H----P-ADGGS--K----F--KGDA----EN---
Sequence 2 FEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSL

Sequence 1 ADAQNTALFKAIEAYLIAN----
           --------FKAIE-Y-I------
Sequence 2 MKEGLKKTFKAIETYVISHPEAC



Alignment 14
Sequence 1:
Sequence 2: Allergen Cas s 1, Sequence: CAD10374
Sequence identity: 38.10 (64/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG---H--EITS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFTHENEITSAIPPGRLFKAFVLDADNLIPKLAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--EGS-------R-D-------TY---V
Sequence 2 HAIKSAEIIEGNGGPGTIKKITFGEGSQFKYVKHRIDEIDQANFTYCYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD---E--E-I------V---DGGSI-K-T---HTKG-----EE----
Sequence 2 IEGDVVNELLEKISYEIKIVASPDGGSILKNTSKYHTKGEQEIKEEKVMA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFKA-EAYL-A------
Sequence 2 GKEKAAGLFKAVEAYLLAHSDAYN



Alignment 15
Sequence 1:
Sequence 2: Allergen Pru du 1.0101, Sequence: B6CQS9
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VL--DT-IPK-AP
Sequence 2 --------------MGIFTYTDESTSVIPPPRLFKALVLEADTLIPKIAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KS---V-GDGG-GT---I---EGS---------D---K----Y----
Sequence 2 QSVKSAEIVEGDGGVGTIKKISFGEGSHYSYVKHQIDGLDKDNFVYNYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --GD-L----E-I------V--ADGGS--K-T---HTKGD----EE--K-
Sequence 2 VEGDALSDKVEKISYEIKLVASADGGSVIKSTSNYHTKGDVEIKEEDVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -----T-LFK-IE-YL-AN-----
Sequence 2 GKEKATGLFKLIENYLVANPDAYN



Alignment 16
Sequence 1:
Sequence 2: Allergen Fag s 1.0101, Sequence: ACJ23864
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-T--------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFTYESETTTVITPARLFKAFVLDADNLIPKVAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--EGS-------R-D-------TY--T-
Sequence 2 QAIKSSEIIEGSGGPGTIKKITFGEGSQFNYVKHRIDEIDNANFTYACTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD---E--E-I------V---DGGSI-K-T---HTKGD----E--IK-
Sequence 2 IEGDAISETLEKIAYEIKLVASPDGGSILKSTSKYHTKGDHEIKEDQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           --------FKA-EAYL-AN-----
Sequence 2 GKEEASGIFKAVEAYLLANPAAYH



Alignment 17
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96535
Sequence identity: 38.10 (64/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAPRLFKAFILDGDNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----GDGG-GT----T--EGS-------R-----K---TY----
Sequence 2 QAIKSTEIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSM

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L----E-I--ET-----P--DGGSI-KTT---H-KGD----EE--
Sequence 2 IEGDTLSDKLEKITYETKLIASP--DGGSIIKTTSHYHAKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK--EAYL-A------
Sequence 2 KAGKEKASGLFKLLEAYLLAHSDAYN



Alignment 18
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96536
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----GDGG-GT----T--EGS-------R-----K---TY----
Sequence 2 QAIKSTKIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSM

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L----E-I--ET-----P--DGGSI-KT----H-KGD----EE--
Sequence 2 IEGDTLSDKLEKITYETKLIASP--DGGSIIKTNSHYHAKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK--EAYL-A------
Sequence 2 KAGKEKASGLFKLLEAYLLAHSDAYN



Alignment 19
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96537
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----GDGG-GT----T--EGS-------R-----K---TY----
Sequence 2 QAIKSTEIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSM

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L----E-I--ET-----P--DGGSI-KTT-----KGD----EE--
Sequence 2 IEGDTLSDKLEKITYETKLIASP--DGGSIIKTTSHYRAKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK--EAYL-A------
Sequence 2 KAGKEKASGLFKLLEAYLLAHSDAYN



Alignment 20
Sequence 1:
Sequence 2: Allergen Bet v 1.2001, Sequence: CAA96543
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 21
Sequence 1:
Sequence 2: Allergen Bet v 1.0201, Sequence: CAA54421
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--DT-IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 22
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: CAA57497
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYESETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 23
Sequence 1:
Sequence 2: Allergen Bet v 1.0301, Sequence: CAA54481
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--DT-IPK-AP
Sequence 2 --------------MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 24
Sequence 1:
Sequence 2: Allergen Bet v 1.1901, Sequence: CAA96542
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYAYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 25
Sequence 1:
Sequence 2: Allergen Bet v 1.0901, Sequence: CAA54488
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--DT-IPK-AP
Sequence 2 --------------MGVFNYESETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 26
Sequence 1:
Sequence 2: Allergen Bet v 1.1801, Sequence: CAA96540
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKAEALLRAVESYLLAHSDAYN



Alignment 27
Sequence 1:
Sequence 2: Allergen Jug r 5.0101, Sequence: APD76154
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK--P
Sequence 2 --------------MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---I---EGS-------RTDA------TY---V
Sequence 2 QAVKSSEIIEGNGGPGTIKKINFGEGSQYKYVKHRTDAIDEANFTYAYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----GGSI-K-----H-KGD----EE--K-
Sequence 2 IEGDALADKIEKISYETKIVASHEGGSILKSISHYHSKGDHEIKEEDVKD

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFKA-E-YL-A------
Sequence 2 GKEKASGLFKAVEGYLLAHPDAYN



Alignment 28
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S7
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A-K-F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS-------------KE--TY----
Sequence 2 QAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----GG-I-KTT---HTKGD----EE--K-
Sequence 2 IEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKASHLFKLIEGYLKDHPSEYN



Alignment 29
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S6
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A-K-F---VLD-D--IPK-AP
Sequence 2 --------------MGGYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS-------------KE--TY----
Sequence 2 QAIKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----GG-I-KTT---HTKGD----EE--K-
Sequence 2 IEGDALSDNIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKASHLFKLIEGYLKDHPSEYN



Alignment 30
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q3T923
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A-K-F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS-------------KE--TY----
Sequence 2 QAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----GG---KTT---HTKGD----EE--K-
Sequence 2 IEGDALSDNIEKIDYETKLVSAPHGGTVIKTTSKYHTKGDVEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKASHLFKLIEGYLKDHPSEYN



Alignment 31
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P45431
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----L--DT-IPK-AP
Sequence 2 ---------------GVFNYETETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 32
Sequence 1:
Sequence 2: Allergen Que a 1.0301, Sequence: ABZ81046
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S-------F---VLD-D--IPK--P
Sequence 2 --------------MGVFTYESEDASVIPPARLFKAFVLDSDNLIPKVVP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--EGS-------R-D----E--TY---V
Sequence 2 QALKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E---T----V---DGGSI-K-T----TKGD-----E-I--
Sequence 2 IEGDALFDKLENVSTETKIVASPDGGSIVKSTSKYQTKGDFQLTDELIRG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           --------FKA-EAYL-A------
Sequence 2 GKEKASEVFKAVEAYLVAHPDLYK



Alignment 33
Sequence 1:
Sequence 2: Allergen Car b 1.0302, Sequence: CAB02217
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD----IPK-AP
Sequence 2 --------------MGVFNYEAETTSVIPAARLFKAFILDGNNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R---V------Y--TV
Sequence 2 QAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V---DGGSI-K-T---HTKGD--VP-E-IK-
Sequence 2 IEGGPVGDKVEKICNEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKG

Sequence 1 ADAQNTALFKAIEAYLIAN------
           -------L-K--EAYL-A-------
Sequence 2 GKERVEGLLKPVEAYLLAHTAEYNN



Alignment 34
Sequence 1:
Sequence 2: Allergen Bet v 1.1401, Sequence: P43186
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D--IPK-AP
Sequence 2 ---------------GVFNYESETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 35
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43176
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----L--DT-IPK-AP
Sequence 2 ---------------GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDQEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 36
Sequence 1:
Sequence 2: Allergen Bet v 1.2101, Sequence: CAA96544
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKASILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEGSP------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGSPFKYVKERVDEVDRVNFKYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E--------V---DGGSI-K----FHTKGD-----E-IK-
Sequence 2 IEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKI

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L-KA-E-YL-A------
Sequence 2 EKEKAVGLLKAVESYLLAHSDAYN



Alignment 37
Sequence 1:
Sequence 2: Allergen Bet v 1.2901, Sequence: CAB02160
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPMGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 38
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43184
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----L--DT-IPK-AP
Sequence 2 ---------------GVFNYESETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 39
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: AAB24432
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 EAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E--------V---DGGSI-K----FHTKGD-----E-IK-
Sequence 2 IEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKI

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L-KA-E-YL-A------
Sequence 2 EKEKAVGLLKAVESYLLAHSDAYN



Alignment 40
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05188
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 41
Sequence 1:
Sequence 2: Allergen Car b 1.0301, Sequence: CAB02216
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD----IPK--P
Sequence 2 --------------MGVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R---V------Y--TV
Sequence 2 QAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEVDHTNFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V---DGGSI-K-T---HTKGD--VP-E-IK-
Sequence 2 IEGGFVGDKVEKICNEIKIVAAPDGGSILKITSKYHTKGDHEVPAEHIKG

Sequence 1 ADAQNTALFKAIEAYLIAN------
           -------L-K--EAYL-A-------
Sequence 2 GKERVEGLLKPVEAYLLAHTAEYNN



Alignment 42
Sequence 1:
Sequence 2: Allergen Car b 1.0105, Sequence: CAB02208
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTDEYN



Alignment 43
Sequence 1:
Sequence 2: Allergen Car b 1.0106, Sequence: CAB02209
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 44
Sequence 1:
Sequence 2: Allergen Que a 1.0401, Sequence: ABZ81047
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG---H----TS-------F----LD-D--I-K--P
Sequence 2 --------------MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--EGS-------R-D----E--TY---V
Sequence 2 QAIKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHRIDVIDPENFTYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E---T----V---DGGSI-K-T----TKGD-----E-I--
Sequence 2 IEGDALFDKLENVSTETKIVASPDGGSIAKSTSKYQTKGDFQLTDELIRG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           --------FKA-EAYL-A------
Sequence 2 GKEKASGVFKAVEAYLVAHPDLYK



Alignment 45
Sequence 1:
Sequence 2: Allergen Pru p 1.0101, Sequence: Q2I6V8
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D---PK-AP
Sequence 2 --------------MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D---KE---Y--T-
Sequence 2 QAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L----E-I--ET--V--P---GGSI-K-T---HTKGD----EE--
Sequence 2 IEGDALGDNLEKISYETKLVASPS--GGSIIKSTSHYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL--------
Sequence 2 KAGKEKASNLFKLIETYLKGHPDAYN



Alignment 46
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S2
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A-K-F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS-------------K---TY----
Sequence 2 QAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKVNHTYSYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L-E-IE-I------V----GG-I-KTT---HTKGD----EE--K-
Sequence 2 IEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAAHLFKLIEGYLKDHPSEYN



Alignment 47
Sequence 1:
Sequence 2: Allergen Que m 1.0101, Sequence: AUH28179
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S-------F---VLD-D--IPK--P
Sequence 2 --------------MGVVAYESEDASVIPPARLFKAFVLDSDNLIPKVVP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--EGS-------R-D----E--T----V
Sequence 2 QALKSTEIIEGNGGPGTIKKITFGEGSHLKHAKHRIDVIDPENFTFSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E---T----V---DGGSI-K-T----TKGD-----E-I--
Sequence 2 IEGDALFDKLENVSTETKIVASPDGGSIVKSTCKYQTKGDFQLTDELIRG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           --------FKA-EAYL-A------
Sequence 2 GKEKASGVFKAVEAYLVAHPDGYY



Alignment 48
Sequence 1:
Sequence 2: Allergen Bet v 1.at10, Sequence: CAA07319
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVEGYLLAHSDAYN



Alignment 49
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05189
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPMGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 50
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA96534
Sequence identity: 38.10 (64/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYETEFTSVIPPARLFNAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----GDGG-GT---I---EGS-------R-D-V-KE---Y---V
Sequence 2 QAVKSAEILEGDGGVGTIKKINFGEGSTYSYVKHRIDGVDKENFVYKYSV

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD---E-IE-I--ET--V-------GS--K-T---HTK-D----EE--
Sequence 2 IEGDAISETIEKISYETKLVA---SGSGSVIKSTSHYHTKSDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL-A------
Sequence 2 KAGKEKASHLFKLIENYLLAHSDAYN



Alignment 51
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: CAA96538
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 52
Sequence 1:
Sequence 2: Allergen Bet v 1.2801, Sequence: CAB02159
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 53
Sequence 1:
Sequence 2: Allergen Bet v 1.1501, Sequence: Q42499
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 54
Sequence 1:
Sequence 2: Allergen Bet v 1.at50, Sequence: CAA07326
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSLIPAARLFRAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPMGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 55
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: CAA33887
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 56
Sequence 1:
Sequence 2: Allergen Bet v 1.at59, Sequence: CAA07327
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--DT-IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILEGDTLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y----
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHANFKYSYSM

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGALGDTLEKICNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 57
Sequence 1:
Sequence 2: Allergen Bet v 1.2301, Sequence: CAA96545
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFFLDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFRYVKDRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V-EE-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKEEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 58
Sequence 1:
Sequence 2: Allergen Bet v 1.1201, Sequence: CAA54695
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D--IPK-AP
Sequence 2 ---------------GVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A---V----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 QAVSCVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------VP---GGSI-K-----HTKG------E-IK-
Sequence 2 IEGGAVGDTLEKICNEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------ALF-A-E-YL-A------
Sequence 2 SKEKAEALFRAVESYLLAHSDAYN



Alignment 59
Sequence 1:
Sequence 2: Allergen Car b 1.0104, Sequence: CAB02207
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDNLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTDEYN



Alignment 60
Sequence 1:
Sequence 2: Allergen Bet v 1.3001, Sequence: CAB02161
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMRETLLRAVESYLLAHSDAYN



Alignment 61
Sequence 1:
Sequence 2: Allergen Cor a 1.0301, Sequence: CAA96549
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---I---EGSP-----------------Y---V
Sequence 2 KAIKSIEIIEGNGGPGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E-I------V----GGSI-K-----HT-GD-----E-IK-
Sequence 2 IEGDALSDKLEKINYEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFKA-E-YL-A------
Sequence 2 GKEKASGLFKAVEGYLLAHSDAYN



Alignment 62
Sequence 1:
Sequence 2: Allergen Car b 1.0103, Sequence: CAB02206
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTDEYN



Alignment 63
Sequence 1:
Sequence 2: Allergen Car b 1.0112, Sequence: ABZ81043
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 64
Sequence 1:
Sequence 2: Allergen Pru av 1, Sequence: O24248
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D---PK-AP
Sequence 2 --------------MGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D---KE---Y--T-
Sequence 2 QAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L----E-I--ET--V--P---GGSI-K-T---HTKG-----EE--
Sequence 2 IEGDALGDTLEKISYETKLVASPS--GGSIIKSTSHYHTKGNVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL--------
Sequence 2 KAGKEKASNLFKLIETYLKGHPDAYN



Alignment 65
Sequence 1:
Sequence 2: Allergen Car b 1.0111, Sequence: ABZ81042
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEKMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 66
Sequence 1:
Sequence 2: Allergen Bet v 1.2501, Sequence: CAB02156
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 67
Sequence 1:
Sequence 2: Allergen Car b 1.0110, Sequence: ABZ81041
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGS--K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSVVKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 68
Sequence 1:
Sequence 2: Allergen Bet v 1.1101, Sequence: CAA54694
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -----V----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 QTVSCVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDHVNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------VP---GGSI-K-----HTKG------E-IK-
Sequence 2 IEGGAVGDTLEKICNEIKIVPAPGGGSILKISNKYHTKGNHEMKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------ALF-A-E-YL-A------
Sequence 2 SKEKAEALFRAVESYLLAHSDAYN



Alignment 69
Sequence 1:
Sequence 2: Allergen Car b 1.0109, Sequence: ABZ81040
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 70
Sequence 1:
Sequence 2: Allergen Aln g 1, Sequence: P38948
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E--S---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 EAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E--------V---DGGSI-K----FHTKGD-----E-IK-
Sequence 2 IEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKI

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L-KA-E-YL-A------
Sequence 2 EKEKAVGLLKAVESYLLAHSDAYN



Alignment 71
Sequence 1:
Sequence 2: Allergen Bet v 1.at5, Sequence: CAA07329
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-------HTKGD-----E--K-
Sequence 2 IEGGPIGDTLEKISNEIKLVATPDGGSILEISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ------AL--A-E-YL-A------
Sequence 2 IKEKGEALLRAVESYLLAHSDAYN



Alignment 72
Sequence 1:
Sequence 2: Allergen Bet v 1.1301, Sequence: CAA54696
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----S-----G-GG-GT---IT-PEGS----M--R-D--------Y----
Sequence 2 ENVSSAENIEGNGGPGTIKKITFPEGSHFKYMKHRVDEIDHANFKYCYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L----E-I------V----GGSI-K-T---HTKGD----EE-IK-
Sequence 2 IEGGPLGDTLEKISYEIKIVAAPGGGSILKITSKYHTKGDISLNEEEIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFKA-E-YL-A------
Sequence 2 GKEKGAGLFKAVENYLVAHPNAYN



Alignment 73
Sequence 1:
Sequence 2: Allergen Can s 5.0101, Sequence: AFN42528
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TSS------F---VLD-D---PK-AP
Sequence 2 --------------MGVFTYESEFTSSIAPARLFKAFVLDGDNLVPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A---V----G-GG-GT---IT---G-P---------A--KE-LTY----
Sequence 2 QAVEKVEILEGNGGVGTIKKITFGQGVPFKYVKHKIEAIDKESLTYSYSI

Sequence 1 IDGDILL-EFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK
           I-GD-L-----E-I------V---DGG---KT-------GDA-V-EE--K
Sequence 2 IEGDALEGNQLEKITHESKLVASGDGGNVIKTVSKYYSAGDAQVNEEKVK

Sequence 1 FADAQNTALFKAIEAYLIAN-----
           ----Q-T---K--EAYL--------
Sequence 2 EGEKQATQMLKTVEAYLKDHPEAYN



Alignment 74
Sequence 1:
Sequence 2: Allergen Fra a 1, Sequence: Q256S4
Sequence identity: 38.69 (65/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A-K-F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS-------------KE--TY----
Sequence 2 QAVKCAEILEGDGGPGTIKKITFGEGSHYGYVKHKIHSIDKENHTYSYSL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L---IE-I--ET--V--P----G-I-KTT---HTKGD----EE--
Sequence 2 IEGDALSDNIEKIDYETKLVSAPH---GTIIKTTSKYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL--------
Sequence 2 KAGKEKASHLFKLIEGYLKDHPSEYN



Alignment 75
Sequence 1:
Sequence 2: Allergen Bet v 1.1601, Sequence: CAA96546
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETPSVIPAARLFKAFILDGDKLLPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 EAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E--------V---DGGSI-K----FHTKGD-----E-IK-
Sequence 2 IEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKI

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L-KA-E-Y--A------
Sequence 2 EKEKAEGLLKAVESYHLAHSDAYN



Alignment 76
Sequence 1:
Sequence 2: Allergen Bet v 1.at7, Sequence: CAA07330
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--D--IPK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILEGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---IT-PEGSP------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKITFPEGSPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 77
Sequence 1:
Sequence 2: Allergen Cor a 1.0201, Sequence: CAA96548
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD----IPK-AP
Sequence 2 --------------MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R---V------Y--TV
Sequence 2 QAVSSVENVEGNGGPGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V---DGGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDKVEKICNEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LF-A-EAYL-A------
Sequence 2 GKEKVEGLFRAVEAYLLAHSDAYN



Alignment 78
Sequence 1:
Sequence 2: Allergen Cor a 1.0103, Sequence: CAA50325
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGS-------R-D-V-----TY--TV
Sequence 2 QAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD-----E-IK-
Sequence 2 IEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVETYLLAHSAEYN



Alignment 79
Sequence 1:
Sequence 2: Allergen Car b 1.0108, Sequence: CAB02215
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVMPAARLFKSYVLDFDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V---------TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSLELTIVAAPGGGSILKISGKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 80
Sequence 1:
Sequence 2: Allergen Bet v 1.1701, Sequence: CAA96539
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGIPFKYVKDRVDEVDHANFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVERYLLAHSDAYN



Alignment 81
Sequence 1:
Sequence 2: Allergen Car b 1.0107, Sequence: CAB02213
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V---------TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKFSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSLELKIVAAPGGGSILKISGKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 82
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05190
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKGD--V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 83
Sequence 1:
Sequence 2: Allergen Bet v 1.0101, Sequence: P15494
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD--V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 84
Sequence 1:
Sequence 2: Allergen Que i 1.0101, Sequence: QGS84240
Sequence identity: 37.50 (63/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG---H----TS-------F---VLD-D--IPK--P
Sequence 2 --------------MGVSTHESQETSVIPPARLFKAFVLDSDNLIPKVLP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--E-S-------R-DA---E--TY---V
Sequence 2 QAIKSIERIEGNGGPGTIKKITFGEASKFKYSKHRIDALDPENCTYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L-----S--T----V---DGGSI-K-T----TKGD----EE-I--
Sequence 2 IEGDALTDMV-SVSTEIKFVASPDGGSIKKSTTKYQTKGDFQLKEEQIQA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -----T-L-KA-EAYL-A------
Sequence 2 TIEKITGLSKAVEAYLLAHPDLYT



Alignment 85
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: CAA54484
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 86
Sequence 1:
Sequence 2: Allergen Ost c 1.0101, Sequence: ADK39021
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A---V--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISKVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSILKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 87
Sequence 1:
Sequence 2: Allergen Bet v 1.at45, Sequence: CAA07325
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKG---V--E--K-
Sequence 2 IEGGPMGDTLEKISNEIKIVATPDGGSILKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 88
Sequence 1:
Sequence 2: Allergen Bet v 1.at42, Sequence: CAA07324
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K-----HTKGD-----E--K-
Sequence 2 IEGGPVGDTLEKISNEIKLVATPDGGSILKISNKYHTKGDHEMKAEHMKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 IKEKGETLLRAVESYLLAHSDAYN



Alignment 89
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: CAA54482
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 90
Sequence 1:
Sequence 2: Allergen Bet v 1.0501, Sequence: CAA54483
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 91
Sequence 1:
Sequence 2: Allergen Bet v 1.0801, Sequence: CAA54487
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 92
Sequence 1:
Sequence 2: Allergen Sola l 4.0201, Sequence: NP_001275580
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-T--------F---VLD-D---PK---
Sequence 2 --------------MGVNTFTHESTTTIAPTRLFKGLVLDFDSLVPKLLS

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KS---V-GDGGAG--------EG-PI--------------L------
Sequence 2 HDVKSIEIVEGDGGAGSIKQMNFVEGGPIKYLKHKIHVIDDKNLVTKYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----ESI----------DGG---KTT---HTKGD-VV-EE----
Sequence 2 IEGDVLGDKLESIAYDVKFEAAGDGGCVCKTTTEYHTKGDHVVSEEEHNV

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFKAIEAYL-AN-----
Sequence 2 GKGKAIDLFKAIEAYLLANPSVYA



Alignment 93
Sequence 1:
Sequence 2: Allergen Cor a 1.0101, Sequence: CAA50327
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGS-------R-D-V-----TY--TV
Sequence 2 QAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD-----E--K-
Sequence 2 IEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVETYLLAHSAEYN



Alignment 94
Sequence 1:
Sequence 2: Allergen Bet v 1.2601, Sequence: CAB02157
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPIGDILEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 95
Sequence 1:
Sequence 2: Allergen Car b 1.0113, Sequence: ABZ81044
Sequence identity: 36.31 (61/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EG-P------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD--V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGDHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 96
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: CAA05186
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 97
Sequence 1:
Sequence 2: Allergen Bet v 1.2201, Sequence: CAA96547
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVAHKNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DG-SI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGRSILKISNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 98
Sequence 1:
Sequence 2: Allergen Bet v 1.1001, Sequence: CAA54489
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETEATSVIPAARMFKAFILDGDKLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 99
Sequence 1:
Sequence 2: Allergen Cor a 1.0102, Sequence: CAA50328
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S---A---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGS-------R-D-V------Y--TV
Sequence 2 QAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD-----E--K-
Sequence 2 IEGDVLGDKLEKVCSELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVETYLLAHSAEYN



Alignment 100
Sequence 1:
Sequence 2: Allergen Bet v 1.at37, Sequence: CAA07323
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 101
Sequence 1:
Sequence 2: Allergen Bet v 1.0601, Sequence: P43179
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYEIEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 102
Sequence 1:
Sequence 2: Allergen Bet v 1.at8, Sequence: CAA07318
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVTTPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 103
Sequence 1:
Sequence 2: Allergen Bet v 1.2401, Sequence: CAB02155
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 104
Sequence 1:
Sequence 2: Allergen Bet v 1.0401, Sequence: P43177
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYEIETTSVIPAARLFKAFILDGDNLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 105
Sequence 1:
Sequence 2: Allergen Cor a 1.0104, Sequence: CAA50326
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E--S--SA---F---VLD-D--IPK-AP
Sequence 2 --------------MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGS-------R-D-V------Y--TV
Sequence 2 QAITSVENVGGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGS--K----FH-KGD-----E--K-
Sequence 2 IEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVETYLLAHSAEYN



Alignment 106
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43178
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGIPFKYVKGRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 107
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43183
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYETEATSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T--GGSI-K-----HTKGD--V--E-IK-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHEVKAEQIKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 108
Sequence 1:
Sequence 2: Allergen Que a 1.0201, Sequence: ABZ81045
Sequence identity: 36.90 (62/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG---H----TS-------F----LD-D--I-K--P
Sequence 2 --------------MGVFTHESQETSVIAPARLFKALFLDSDNLIQKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT---IT--E-S-------R-DA---E--TY---V
Sequence 2 QAIKSTEIIEGNGGPGTIKKITFGEASKFKYAKHRIDALDPENCTYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----ES--T----V---DGGSI-K-T----TKGD----EE-I--
Sequence 2 IEGDALT-VMESVSTEIKCVASPDGGSIMKSTTKYQTKGDFQLKEEQIQA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L-KA-EAYL-A------
Sequence 2 AIEKAAGLLKAVEAYLVAHPDLYK



Alignment 109
Sequence 1:
Sequence 2: Allergen Cor a 1, Sequence: Q08407
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E--S---A---F---VLD-D--IPK-AP
Sequence 2 ---------------GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGS-------R-D-V-----TY--TV
Sequence 2 QAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KGD-----E--K-
Sequence 2 IEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVETYLLAHSAEYN



Alignment 110
Sequence 1:
Sequence 2: Allergen Car b 1.0102, Sequence: CAA47357
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E--S---A---F---VLD-D--IPK-AP
Sequence 2 ---------------GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R-D-V------Y--TV
Sequence 2 QAISSVENVGGNGGPGTIKNITFAEGSPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KG---V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 111
Sequence 1:
Sequence 2: Allergen Bet v 1.0701, Sequence: CAA54485
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----L--D--IPK-AP
Sequence 2 --------------MGVFNYESETTSVIPAARLFKAFILEGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 112
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43185
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD-D---PK-AP
Sequence 2 ---------------GVFNYETEATSVIPAARMFKAFILDGDKLVPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 113
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38950
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----LD----IPK--P
Sequence 2 ---------------GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV--V-G-GG-GT---IT--EGSP------R----------Y--TV
Sequence 2 QAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KG---V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 114
Sequence 1:
Sequence 2: Allergen Bet v 1.2701, Sequence: CAB02158
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--P-G-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPGGLPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 115
Sequence 1:
Sequence 2: Allergen Bet v 1, Sequence: P43180
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS---A---F----L--D--IPK-AP
Sequence 2 ---------------GVFNYESETTSVIPAARLFKAFILEGDNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKINFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGG---K-----HTKG---V--E--K-
Sequence 2 IEGGPVGDTLEKISNEIKIVATPDGGCVLKISNKYHTKGNHEVKAEQVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------L--A-E-YL-A------
Sequence 2 SKEMGETLLRAVESYLLAHSDAYN



Alignment 116
Sequence 1:
Sequence 2: Allergen Cor a 1.0404, Sequence: AAG40331
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG--S---E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----S-----G-GG-GT---IT--EG-----M-------------Y----
Sequence 2 QHFTSAENLEGNGGPGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSI

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-G--L----E-I--E--M---P---GGSI-K-T---HTKG-A---EE-I
Sequence 2 IEGGPLGHTLEKIPYEIKMAAAPHG-GGSILKITSKYHTKGNASINEEEI

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFKA-EAYL-A------
Sequence 2 KAGKEKAAGLFKAVEAYLLAHPDAYC



Alignment 117
Sequence 1:
Sequence 2: Allergen Cor a 1.0402, Sequence: AAG40329
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG--S---E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----------G-GG-GT---IT--EGS----M-------------Y----
Sequence 2 QHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSI

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-G--L----E-I--E--M---P---GGSI-K-T---HTKG-A---EE-I
Sequence 2 IEGGPLGHTLEKISYEIKMAAAPHG-GGSILKITSKYHTKGNASISEEEI

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFKA-EAYL-A------
Sequence 2 KAGKEKAAGLFKAVEAYLLAHPDTYC



Alignment 118
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26559
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D-V------Y--T-
Sequence 2 QAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L---IE----ET--V-------GSI-K-----HTKGD----EE--
Sequence 2 IEGDALTDTIEKVSYETKLVA---SGSGSIIKSISHYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL--------
Sequence 2 KAGKEKAHGLFKLIESYLKGHPDAYN



Alignment 119
Sequence 1:
Sequence 2: Allergen Car b 1, Sequence: P38949
Sequence identity: 34.52 (58/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E--S---A---F---VLD-D--IPK-AP
Sequence 2 ---------------GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----SV--V-G-GG-GT---IT--EG-P------R-D-V------Y--TV
Sequence 2 QVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L----E--------V----GGSI-K----FH-KG---V--E--K-
Sequence 2 IEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKG

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A------L--A-E-YL-A------
Sequence 2 AKEMAEKLLRAVESYLLAHTAEYN



Alignment 120
Sequence 1:
Sequence 2: Allergen Pyr c 1, Sequence: O65200
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGLYTFENEFTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKHAEILEGNGGPGTIKKITFGEGSQYGYVKHRVDSIDEASYSYAYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKGD----EE--K-
Sequence 2 IEGDALTDTIEKISYEAKLVASGSGSTI-KSISHYHTKGDIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 121
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26555
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           --A----LFK-IE-YL--------
Sequence 2 GKAKAHGLFKLIESYLKGHPDAYN



Alignment 122
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26548
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D-V------Y--T-
Sequence 2 QAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L---IE----ET----------GSI-K-----HTKGD----EE--
Sequence 2 IEGDALTDTIEKVSYETKLMA---SGSGSIIKSISHYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE-YL--------
Sequence 2 KAGKEKAHGLFKLIESYLKGHPDAYN



Alignment 123
Sequence 1:
Sequence 2: Allergen Cor a 1.0401, Sequence: AAD48405
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----S-----G-GG-GT---IT--EG-----M-------------Y----
Sequence 2 QHFTSAENLEGNGGPGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSI

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-G--L----E-I--E--M---P---GGSI-K-T---HTKG-A---EE-I
Sequence 2 IEGGPLGHTLEKISYEIKMAAAPHG-GGSILKITSKYHTKGNASINEEEI

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFKA-EAYL-A------
Sequence 2 KAGKEKAAGLFKAVEAYLLAHPDAYC



Alignment 124
Sequence 1:
Sequence 2: Allergen Cor a 1.0403, Sequence: AAG40330
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ----------G-GG-GT---IT--EGS----M-------------Y----
Sequence 2 QHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSI

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-G--L----E-I--E--M---P---GGSI-K-T---HTKG-A---EE-I
Sequence 2 IEGGPLGHTLEKISYEIKMAAAPHG-GGSILKITSKYHTKGNASISEEEI

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFKA-EAYL-A------
Sequence 2 KAGKEKAAGLFKAVEAYLLAHPDTYC



Alignment 125
Sequence 1:
Sequence 2: Allergen Que ac 1.0101, Sequence: QOL10866
Sequence identity: 35.71 (60/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG--------TS-------F---VLD-D--I-K--P
Sequence 2 --------------MGVYNYESQETSVIPPARLFKAFVLDSDNLISKVLP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KS-----G-GG-GT----T--E-S-------R-D----E---Y---V
Sequence 2 HAVKSTEIIEGNGGPGTIKKFTFGEASKVKYAKHRIDTLDPENCSYSFSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G--L---I-SI-T----V---DGGSI-K-T----TKG-----EE-I--
Sequence 2 IEGEALTD-IASISTEVKFVASPDGGSIMKSTTKYQTKGGFQLKEEQIQA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           A----T-LFKA-EAYL-A------
Sequence 2 AVEKGTGLFKAVEAYLLAHPDLYN



Alignment 126
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26547
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D-V------Y--T-
Sequence 2 QAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L---IE----ET--V-------GSI-K-----HTKGD----EE--
Sequence 2 IEGDALTDTIEKVSYETKLVA---SGSGSIIKSISHYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           K--------LFK-IE--L--------
Sequence 2 KAGKEKAHGLFKLIESHLKGHPDAYN



Alignment 127
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA58646
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKV

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 128
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26554
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIENISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 129
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26558
Sequence identity: 35.12 (59/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------GDGG-GT---IT--EGS---------D-V------Y--T-
Sequence 2 QAIKHAEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSVDEANYSYAYTL

Sequence 1 IDGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENI
           I-GD-L---IE----ET--V-------GSI-K-----HTKGD----EE--
Sequence 2 IEGDALTDTIEKVSYETKLVA---SGSGSIIKSISHYHTKGDVEIKEEHV

Sequence 1 KFADAQNTALFKAIEAYLIAN-----
           ---------LFK-IE-YL--------
Sequence 2 MAGKEKAHGLFKLIESYLKGHPDAYN



Alignment 130
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26546
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKGHPDAYN



Alignment 131
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26552
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEYTSEIPPPRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 132
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: AAD26553
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVCTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKA

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 133
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: CAA88833
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-------F---VLD-D--IPK-AP
Sequence 2 --------------MGVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----H-KG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGATI-KSISHYHPKGNIEIKEEHVKV

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKGHGLFKLIESYLKGHPDAYN



Alignment 134
Sequence 1:
Sequence 2: Allergen Sola l 4.0101, Sequence: AHC08073
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-T---S----F---VLD-D---PK---
Sequence 2 --------------MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLS

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---K------GDGG-G--------EG-PI--------------L------
Sequence 2 QHVKNNETIEGDGGVGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GDIL-E--ESI-----------GG---KTT---HTKGD-VV-EE----
Sequence 2 IEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNV

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           ---------KA-EAYL-AN-----
Sequence 2 GRERIMNISKAVEAYLLANPSVYA



Alignment 135
Sequence 1:
Sequence 2: Allergen Mal d 1, Sequence: P43211
Sequence identity: 32.74 (55/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G------E-TS-------F---VLD-D--IPK-AP
Sequence 2 ---------------GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-K------G-GG-GT---IT--EGS-------R-D--------Y--T-
Sequence 2 QAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GD-L---IE-I------V----G--I-K-----HTKG-----EE--K-
Sequence 2 IEGDALTDTIEKISYETKLVACGSGSTI-KSISHYHTKGNIEIKEEHVKV

Sequence 1 ADAQNTALFKAIEAYLIAN-----
           -------LFK-IE-YL--------
Sequence 2 GKEKAHGLFKLIESYLKDHPDAYN



Alignment 136
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43637
Sequence identity: 30.95 (52/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG--------TS-V-----------D-DT--PKA-P
Sequence 2 --------------MGVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV--V-G-GG-GT---I---E------------------L-Y----
Sequence 2 DSFKSVEIVEGNGGPGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L-E--E-I-----------GGS--K-----H-KGDA---E---K-
Sequence 2 VGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKA

Sequence 1 ADAQNTALFKAIEAYLIAN-
           --A----LFKA-EAYL-AN-
Sequence 2 GKAKSDSLFKAVEAYLLANP



Alignment 137
Sequence 1:
Sequence 2: Allergen Ara h 8.0201, Sequence: EF436550
Sequence identity: 33.33 (56/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS-V---K-F---V-D-D---PK--P
Sequence 2 --------------MGVHTFEEESTSPVPPAKLFKATVVDGDELTPKLIP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--S---V-G-GG-GTV---T--E-----------DA------TYD-T-
Sequence 2 -AIQSIEIVEGNGGPGTVKKVTAVEDGKTSYVLHKIDAIDEATYTYDYTI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G----E--E-----------ADGGS--K----FHTKGDA--P-E----
Sequence 2 SGGTGFQEILEKV-SFKTKLEAADGGSKIKVSVTFHTKGDAPLPDEVHQD

Sequence 1 ADAQNTALFKAIEAYLIAN
           --------FKAIE-Y---N
Sequence 2 VKQKSQGIFKAIEGYVLSN



Alignment 138
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: P25985
Sequence identity: 30.36 (51/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ---------------G--------TS-V-----------D-DT--PKA-P
Sequence 2 ---------------GVFTFEDQTTSPVAPATLYKAVAKDADTIFPKALP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV--V-G-GG-GT---I---E------------------L-Y----
Sequence 2 DSFKSVEIVEGNGGPGTIKKISFVEDGETKFVLHKIESIDEANLGYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L-E--E-I-----------GGS--K-----H-KGDA---E---K-
Sequence 2 VGGVALPETAEKITFDSKLSDGPNGGSLIKLSITYHSKGDAPPNEDELKA

Sequence 1 ADAQNTALFKAIEAYLIAN-
           --A----LFKA-EAYL-AN-
Sequence 2 GKAKSDSLFKAVEAYLLANP



Alignment 139
Sequence 1:
Sequence 2: Allergen Vig r 1.0101, Sequence: Q2VU97
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------M---------TS-V-----------D-D--IPKA--
Sequence 2 --------------MAVFTFDDQATSPVAPATLYNALAKDADNIIPKAV-

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           G---SV--V-G-GG-GT---I---E-------------V----L-Y----
Sequence 2 GSFQSVEIVEGNGGPGTIKKISFVEDGETKFVLHKIESVDEANLGYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L----E-I---------ADGGS--K-T---H-KGDA---E---K-
Sequence 2 VGGVALPDTAEKITIDTKISDGADGGSLIKLTISYHGKGDAPPNEDELKA

Sequence 1 ADAQNTALFKAIEAYLIAN-
           --A---ALFKA-EAYL-AN-
Sequence 2 GKAKSDALFKAVEAYLLANP



Alignment 140
Sequence 1:
Sequence 2: Allergen Rub i 1.0101, Sequence: Q0Z8U9
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           ------------------------TS-----K-F---VLD-D--IPK-AP
Sequence 2 -----------------------YTSVIPPPKLFKAFVLDADNLIPKIAP

Sequence 1 GAYKSVDV-KGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A-KSV----GDGG-GTV--I-L-EG----------D---K----Y----
Sequence 2 QAVKSVEIIEGDGGVGTVKKIHLGEGTEHSYVKHKIDGLDKVNFVYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --GD-L---IE-I------V----G-SI-KTT---H-KG-A---EE--K-
Sequence 2 TEGDALGDKIEKISYEIKLVASGRG-SIIKTTSHYHCKGGAEIKEEQVKD

Sequence 1 ADAQNTALFKAIEAYLIAN
           -------LFK---------
Sequence 2 GKERAAGLFKI--------



Alignment 141
Sequence 1:
Sequence 2: Allergen Gly m 4, Sequence: CAA42646
Sequence identity: 33.93 (57/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------EI-S-V---------V-D-D-VIPKA--
Sequence 2 --------------MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALD

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV--V-G-GG-GT---IT--E------------------L-Y---V
Sequence 2 -SFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L----E-I------V----GGS--K-T----TKGDA-------K-
Sequence 2 VGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKT

Sequence 1 ADAQNTALFKAIEAYLIAN----
           --A---ALFKAIEAYL-A-----
Sequence 2 GKAKADALFKAIEAYLLAHPDYN



Alignment 142
Sequence 1:
Sequence 2: Allergen Lyc e 4.0101, Sequence: CAA75803
Sequence identity: 28.57 (48/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-T---S----F---VLD-D---PK---
Sequence 2 --------------MGVNTYTYESTTTISPTRLFKALVLDFDNLVPKLLS

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---K------GDGG-G--------EG-PI--------------L------
Sequence 2 QHVKNNETIEGDGGVGSIKQMNFVEGGPIKYLKHKIHVIDDKNLETKYSL

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-GDIL-E--ESI-----------GG---KTT---HTKGD-VV-EE----
Sequence 2 IEGDILGEKLESITYDIKFEANDNGGCVYKTTTEYHTKGDHVVSEEEHNV

Sequence 1 ADAQNTALFKAIEAYLIAN-----------------------
           ----N---F---------------------------------
Sequence 2 GRRENHEYFQGCRSIPSRESFCLRLNIDEKESGLHVRNYACT



Alignment 143
Sequence 1:
Sequence 2: Allergen Pha v 1, Sequence: CAA43636
Sequence identity: 30.36 (51/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------M---------TS-V---------V-D-DT--PKA--
Sequence 2 --------------MAVFTFEDQTTSPVAPATLYKALVKDADTIVPKAVD

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV--V-G-GG-GT---I---E------------------L-Y----
Sequence 2 -SFKSVEIVEGNGGPGTIKKISFVEDGETKFVLHKIEEIDEANLGYSYSI

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L----E-I-----------GGS--K-----H-KGDA---E---K-
Sequence 2 VGGAALPDTAEKISIDSKLSDGPNGGSVVKLSIKYHSKGDAPPNEDELKA

Sequence 1 ADAQNTALFKAIEAYLIAN-
           --A---ALFK-IEAYL-AN-
Sequence 2 GKAKSDALFKVIEAYLLANP



Alignment 144
Sequence 1:
Sequence 2: Allergen Ara h 8.0101, Sequence: AAQ91847
Sequence identity: 32.14 (54/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------EITS-V---K-------D-D---PK---
Sequence 2 --------------MGVFTFEDEITSTVPPAKLYNAMK-DADSITPKIID

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           ---KSV--V-G-GG-GT----T--E--------------------Y---V
Sequence 2 DV-KSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           --G--L----E-I------V----GGSI-K-T---HTKGDA---EE--K-
Sequence 2 VGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKK

Sequence 1 ADAQNTALFKAIEAYLIAN----
           --A----LF-AIE-Y--AN----
Sequence 2 GKAKGEGLFRAIEGYVLANPTQY



Alignment 145
Sequence 1:
Sequence 2: Allergen Bet v 1.at87, Sequence: CAA07328
Sequence identity: 26.19 (44/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K--------------------
Sequence 2 IEGGPMGDTLEKISNEIKIVATPDGGSILKISNN----------------

Sequence 1 ADAQNTALFKAIEAYLIAN
           -------------------
Sequence 2 -------------------



Alignment 146
Sequence 1:
Sequence 2: Allergen Bet v 1.at14, Sequence: CAA07320
Sequence identity: 26.19 (44/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------MG------E-TS---A---F----LD-D---PK-AP
Sequence 2 --------------MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAP

Sequence 1 GAYKSVD-VKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTV
           -A--SV----G-GG-GT---I--PEG-P------R-D-V------Y---V
Sequence 2 QAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSV

Sequence 1 IDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKF
           I-G-------E-I------V-T-DGGSI-K--------------------
Sequence 2 IEGGPIGDTLEKISNEIKIVATPDGGSILKISNN----------------

Sequence 1 ADAQNTALFKAIEAYLIAN
           -------------------
Sequence 2 -------------------



Alignment 147
Sequence 1:
Sequence 2: Allergen Fra a 1.0101, Sequence: Q5ULZ4
Sequence identity: 17.86 (30/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GAYKSVDVKGDGGAGTVRIITLPEGSPITSMTVRTDAVNKEALTYDSTVI
           ----------------------------------------E---Y-----
Sequence 2 -----------------------AFVLDADNLIPKKITFGEGSQYGYVKV

Sequence 1 DGDILLEFIESI--ETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK
           -GD-L----E-I--ET--V--P------I-KTT---HTKGD----EE--K
Sequence 2 EGDALSDTLEKIDYETKLVSAPSSS--TIIKTTSKYHTKGDVEIKEEHVK

Sequence 1 FADAQNTALFKAIEAYLIAN-----
           --------LFK-IE-YL--------
Sequence 2 AGKEKAAHLFKLIEGYLKDHPSEYN



Alignment 148
Sequence 1:
Sequence 2: Allergen Vig r 6.0101, Sequence: Q9ZWP8
Sequence identity: 20.83 (35/168)
Sequence 1 LIFLLILSNNILNIMGAQSHSLEITSSVSAEKIFXXIVLDVDTVIPKAAP
           --------------------------SV--E--------D--TV-PK--P
Sequence 2 ---------------MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLP

Sequence 1 GAYKSVD-VKGDGGAGTVRIIT-LPEGSPITSMTVRTDAVNKEALTYDST
           ---K-V----GDGG-GT--I---LPE-SP---------------------
Sequence 2 HIVKDVQLIEGDGGVGTILIFNFLPEVSP-SYQREEITEFDESSHEIGLQ

Sequence 1 VIDGDILLEFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIK
           VI-G--L--------T------------------------D----E----
Sequence 2 VIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISYDHDSD--IEEKVTP

Sequence 1 FADAQNTALF-KAIEAYLIAN--
           ----Q-T-------E-YL-----
Sequence 2 TKTSQSTLMYLRRLERYLSNGSA


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.