The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Api g 2

Sequence 256600126

Full FASTA alignment

Sequence name:
Query sequence:
MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
GIRIPYPISPSTDCSRVN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Api g 2ACV04796Go!118147.77.8e-38
2Pru av 3Q9M5X8Go!11783.41.8e-18
3Lyc e 3AAB42069Go!11481.56.5e-18
4Sola l 3.0101P93224Go!11481.56.5e-18
5Mal d 3Q9M5X7Go!11581.28.3e-18
6Pun g 1.0201A0A059SSZ0Go!12079.82.2e-17
7Pla or 3.0101ABY21307Go!11878.65.0e-17
8Pyr c 3Q9M5X6Go!11578.45.6e-17
9Rub i 3.0101Q0Z8V0Go!11778.45.6e-17
10Pla a 3.0101CAL07989Go!11877.98.1e-17
11Pru ar 3P81651Go!9177.58.5e-17
12Pru d 3P82534Go!9177.39.5e-17
13Can s 3.0101W0U0V5Go!9177.39.5e-17
14Pun g 1.0301A0A059ST23Go!12077.41.2e-16
15Ara h 9.0101ABX56711Go!11677.01.5e-16
16Fra a 3.0101Q8VX12Go!11776.22.7e-16
17Len c 3.0101A0AT29Go!11876.03.0e-16
18Pha v 3.0101ADC80502Go!11575.83.4e-16
19Pun g 1.0101A0A059STC4Go!12075.93.4e-16
20Fra a 3.0202Q4PLT6Go!11775.73.8e-16
21Lup an 3.0101XP_019446786Go!11675.54.3e-16
22Fra a 3.0201Q4PLU0Go!11775.06.1e-16
23Zea m 14.0101P19656-1Go!12075.06.2e-16
24Pru p 3P81402Go!9174.28.2e-16
25Pru p 3CAB96876Go!9174.28.2e-16
26Hev b 12AAL25839Go!11674.48.8e-16
27Fra a 3.0102Q4PLT9Go!11774.39.9e-16
28Cor a 8AAK28533Go!11573.91.3e-15
29Mor n 3.0101P85894Go!9173.51.3e-15
30Ara h 9.0201ABX75045Go!9273.31.5e-15
31Pha v 3.0201ADC80503Go!11873.32.0e-15
32Zea m 14.0102P19656-2Go!12873.02.6e-15
33Hel a 3.0101P82007Go!11670.81.1e-14
34Pru du 3.0101ACN11576Go!12370.41.6e-14
35Tri tu 14.0101CAH69206Go!11568.94.0e-14
36Hor v 1AAA32970Go!11768.94.0e-14
37Pis s 3.0101A0A161AT60Go!12068.36.5e-14
38Hor v 1CAA42832Go!13468.46.7e-14
39Art ar 3.0102ANC85020Go!11666.71.9e-13
40Art si 3.0102ANC85027Go!11666.71.9e-13
41Art v 3.0202ACE07187Go!11666.71.9e-13
42Art gm 3.0102ANC85023Go!11766.71.9e-13
43Art v 3.0201EU564845Go!11466.52.1e-13
44Art ar 3.0101ANC85019Go!11666.52.1e-13
45Art la 3.0101ANC85024Go!11666.52.1e-13
46Art si 3.0101ANC85026Go!11666.22.7e-13
47Art an 3.0101ANC85017Go!11766.03.1e-13
48Art ca 3.0101ANC85021Go!11766.03.1e-13
49Art gm 3.0101ANC85022Go!11765.83.5e-13
50Art ca 3.0102QIN55516Go!11765.73.9e-13
51Art an 3.0102ANC85018Go!11763.61.6e-12
52Art la 3.0102ANC85025Go!11563.22.1e-12
53Art v 3.0301EU564847Go!11763.12.3e-12
54Sola l 7.0101NP_001316123Go!11562.92.6e-12
55Ara h 17.0101A0A510A9S3Go!9362.33.1e-12
56Tri a 14.010119846220Go!9061.84.5e-12
57Sin a 3.0101ABU95411Go!9260.11.5e-11
58Par j 2O04403Go!13349.43.4e-08
59Amb a 6O04004Go!11849.13.7e-08
60Par j 1Q40905Go!13847.21.6e-07
61Par j 2P55958Go!13346.82.1e-07
62Par j 1O04404Go!17644.21.7e-06
63Par j 1P43217Go!13943.62.0e-06
64Par j 1.0103CAI94601Go!13942.93.3e-06
65Par j 1.0101CAA54587Go!13339.82.8e-05
66Art v 3.0101P0C088Go!3732.41.3e-03
67Sola l 6.0101A0A3Q7F7X3Go!9431.08.8e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 100.00 (118/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           GIRIPYPISPSTDCSRVN
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 2
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 50.00 (59/118)
Sequence 1 ---MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG
           -------K-A--VA----V-V---P-----LTCGQV---L--C--Y--GG
Sequence 2 MACSAMTKLALVVALCMVVSV---P-IAQALTCGQVSSNLAPCIAYVRGG

Sequence 1 GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALP
           G---PACC-G----N-LAKT-ADR--AC-CLK-L--SV-G-N---A-ALP
Sequence 2 GAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALP

Sequence 1 GKCGIRIPYPISPSTDCSRVN
           GKCG---PY-ISPST-C--V-
Sequence 2 GKCGVNVPYKISPSTNCATVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 56.78 (67/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           -----K-A--V-V--MVVV--H----E-L-CG-VT--L--CL-YL-G-G-
Sequence 2 MEMFGKIACFV-VFCMVVVAPH---AESLSCGEVTSGLAPCLPYLEGRG-

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           P---CCGGVKGL---AKTP-DRK-AC-CLK--A-S-KGI--G-A--LPG-
Sequence 2 PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGV

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-ISPSTDCS-V-
Sequence 2 CGVNIPYKISPSTDCSTVQ



Alignment 4
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 56.78 (67/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           -----K-A--V-V--MVVV--H----E-L-CG-VT--L--CL-YL-G-G-
Sequence 2 MEMFGKIACFV-VFCMVVVAPH---AESLSCGEVTSGLAPCLPYLEGRG-

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           P---CCGGVKGL---AKTP-DRK-AC-CLK--A-S-KGI--G-A--LPG-
Sequence 2 PLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGV

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-ISPSTDCS-V-
Sequence 2 CGVNIPYKISPSTDCSTVQ



Alignment 5
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 49.15 (58/118)
Sequence 1 ---MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG
           -----V-K-A--VA---M-V---H-------TCGQVT--L--C-GY---G
Sequence 2 MASSAVTKLALVVA-LCMAVSVAH-----AITCGQVTSSLAPCIGYVRSG

Sequence 1 GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALP
           G---PACC-G----N-LA-T-ADR--AC-CLK-LAGS--G-N---A--LP
Sequence 2 GAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLP

Sequence 1 GKCGIRIPYPISPSTDCSRVN
           GKCG---PY-IS-ST-C--V-
Sequence 2 GKCGVNVPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 50.00 (59/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-G
           ----------V-------V-----V----TCGQVT--L--C--Y--G---
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 YPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG
           -PS-ACC-GV--LN--AKT--DR--AC-CLK--A-S--GINYG---ALPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGIRIPYPISPSTDCSRVN
           KCG--IPY-ISPSTDCSRV-
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 48.31 (57/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M--S-VA------L---V---P------TCG-V---L--CL-YL--GG--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-GVK-LN--AKT--DR--AC-CLKT---S--GI--G-A--L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-ISP--DCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 49.15 (58/118)
Sequence 1 ---MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG
           -----V-K-A--VA---M-V---H-------TC-QV---L--C--Y---G
Sequence 2 MASSAVIKLALVVA-LCMAVSVAH-----AITCSQVSANLAPCINYVRSG

Sequence 1 GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALP
           G---PACC-G-K--N-LAKT--DR--AC-CLK-LAGSV-G-N-G-A--LP
Sequence 2 GAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLP

Sequence 1 GKCGIRIPYPISPSTDCSRVN
           GKCG---PY-IS-ST-C--V-
Sequence 2 GKCGVNVPYKISTSTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 49.15 (58/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M--S-V-----V-L---V---P-V----TCGQVT-----C--Y-K-GG--
Sequence 2 MACSAVMKLALVALLCIVVAVP-VAQAITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           --ACC-GV--LNS-AKT-ADR-Q-C-CLK--AGS--G-N---A--LPGKC
Sequence 2 PAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-IS-ST-C--V-
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 47.46 (56/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M--S-VA------L---V---P------TCG-V---L--CL--L--GG--
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-GVK-LN--AKT--DR--AC-CLKT---S--GI--G-A--L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-ISP--DCS-V-
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--C-GY--GGG--
Sequence 2 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-G----N-LA-T--DR--AC-CLK-L-GS--G-N---A-ALPGKC
Sequence 2 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS-ST-C--V-
Sequence 2 GVNIPYKISASTNCATVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--C--Y-KGGG--
Sequence 2 ---------------------------ITCGQVSSNLAPCINYVKGGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-G----N-LA-T-ADR--AC-CLK-L-GS--G-N---A-ALPGKC
Sequence 2 PPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-IS-ST-C--V-
Sequence 2 GVNVPYKISASTNCATVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 45.76 (54/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--CL-YLK-GG--
Sequence 2 ---------------------------ITCGQVASSLAPCLSYLKVGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC---K-L---AKTPADR--AC-CLK--A-S-KG-N---AS-LPGKC
Sequence 2 PDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-ISPSTDCS-V-
Sequence 2 GVSIPYKISPSTDCSSVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 47.46 (56/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY-
           M--S---------L------------G-TCGQV---L-GC--Y--G-G--
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 PSP-ACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG
           P-P-ACC-G---LNS-AKT--DR--AC-CLK-LA-S--GINYG-----PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGIRIPYPISPSTDCSRVN
           KCG--IPY-I-PST-C--V-
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 44.07 (52/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           -----------VML----------V----CGQV---L--C---L--GG-P
Sequence 2 ---MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAP

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-GV-GL-----T-ADR--AC-CLK--AGS--G-N-G-A-ALPG-C
Sequence 2 PPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRC

Sequence 1 GIRIPYPISPSTDCSRVN-
           G--IPY-IS-ST-C-----
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 16
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 44.92 (53/118)
Sequence 1 MGVSKVAIAVA-VMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           ---S--A-----V-L---V---P------TCGQV------CL-Y-K-GG-
Sequence 2 -MASSTAMKLSLVALLCIVVALP-IAQAITCGQVASNISPCLTYVKSGGA

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           ---ACC-G---LN--AKT-ADR--AC-CLK--AG--KG-N---A--LPGK
Sequence 2 VPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG---PY-IS--T-C--V-
Sequence 2 CGVSVPYKISTTTNCAAVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 49.15 (58/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           -----K-A--V-V--MVV----P-------CG-VT--L--CL-YL-GG--
Sequence 2 MARGMKLACVVLVICMVVIA--PMAEGAISCGAVTSDLSPCLTYLTGGPG

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PSP-CCGGVK-L---A-T--DR--AC-CLK--AGS----N---A-ALPGK
Sequence 2 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK

Sequence 1 CGIRIPYPISPSTDCSRVN-
           CG--IPY-IS--T-C--V--
Sequence 2 CGVNIPYKISTTTNCNTVKF



Alignment 18
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 46.61 (55/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---S-----V-V--MVVV--H-A---G-TCGQV---L--C---L--GG--
Sequence 2 -MASVKFACVVVLCMVVVGAHTA--QGMTCGQVQSNLVPCVTFLQNGGFV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GV------A---ADR---C-CLKT-AG-V-G-N---A-ALPGKC
Sequence 2 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS-ST-C---N
Sequence 2 GVNIPYKISTSTNCASIN



Alignment 19
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 50.85 (60/118)
Sequence 1 ---MGVSKVAIAV-AVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLK-
           ----G--K-A-AV-AV-L----I---A-V---TCGQV---L--C--Y---
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAV---TCGQVASSLAPCIPYARS

Sequence 1 -GGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAAS
           -GG--P-PACC-G-K-L---A-T--DR---C-CLK----S--GINYG---
Sequence 2 AGGAVP-PACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVA

Sequence 1 ALPGKCGIRIPYPISPSTDCSRVN
           -LP-KCG--IPY-ISPSTDC-RV-
Sequence 2 SLPAKCGVNIPYKISPSTDCARVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 44.07 (52/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M--S-------V-L---V---P------TCGQV------C--Y-K-GG--
Sequence 2 MAISTAMKLSLVALLCIVVALP-IAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           --ACC-G---LNS-AKT-ADR---C-CLK---G--KG-N---A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-IS-ST-C--V-
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 46.61 (55/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLK-GGGY
           -----V--A-AV----VV---P------TCGQVT--L--CL-YL--GG--
Sequence 2 -MAGIVKLACAVLICMVVVSAP-LTKAITCGQVTANLAQCLNYLRSGGAV

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           P-P-CC-G-K----LAKT--DR--AC-CLK--A----G-N---A--LPGK
Sequence 2 PAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-IS-ST-C----
Sequence 2 CGVNIPYKISTSTNCASIK



Alignment 22
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 44.07 (52/118)
Sequence 1 MGVSKVAIAVA-VMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           ---S--A-----V-L---V---P------TCGQV------C--Y-K-GG-
Sequence 2 -MASSTAMKLSLVALLCIVVALP-IAQAITCGQVASSISPCVNYVKSGGA

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           ---ACC-G---LNS-AKT-ADR---C-CLK---G--KG-N---A--LPGK
Sequence 2 VPAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG---PY-IS-ST-C--V-
Sequence 2 CGVSVPYKISTSTNCAAVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 45.76 (54/118)
Sequence 1 ----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG
           ---------VA-AV------------A------CGQV------C--Y--G
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAI---SCGQVASAIAPCISYARG

Sequence 1 -GGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASA
           -G--PS--CC-GV--LN--A-T-ADR--AC-CLK--A--V-G-N-G-A--
Sequence 2 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAAS

Sequence 1 LPGKCGIRIPYPISPSTDCSRVN
           -P-KCG--IPY-IS-STDCSRVN
Sequence 2 IPSKCGVSIPYTISTSTDCSRVN



Alignment 24
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--C--Y--GGG--
Sequence 2 ---------------------------ITCGQVSSALAPCIPYVRGGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-G----N-LA-T--DR--AC-CLK-L--SV-G-N---A-ALPGKC
Sequence 2 PPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS-ST-C--V-
Sequence 2 GVHIPYKISASTNCATVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--C--Y--GGG--
Sequence 2 ---------------------------ITCGQVSSSLAPCIPYVRGGGAV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -PACC-G----N-LA-T--DR--AC-CLK-L--SV-G-N---A-ALPGKC
Sequence 2 PPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS-ST-C--V-
Sequence 2 GVSIPYKISASTNCATVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 45.76 (54/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------V-----------P------TCGQV---L--CL-YLK--G--
Sequence 2 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT

Sequence 1 SPA-CCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           -PA-CC-GV---N--AKT-ADR--AC-CLK--AGSVKG-N------LPGK
Sequence 2 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-IS-ST-C--V-
Sequence 2 CGVNIPYKISLSTNCATVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 44.07 (52/118)
Sequence 1 MGVSKVAIAVA-VMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGG-
           ---S--A-----V-L---V---P------TCGQV------C--Y-K-GG-
Sequence 2 -MASSTAMKLSLVALLCIVVALP-IAQAITCGQVASNISPCVTYVKSGGA

Sequence 1 YPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG
           -P-P-CC-G---LN--AKT-ADR---C-CLK--AG--KG-N---A--LPG
Sequence 2 VPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPG

Sequence 1 KCGIRIPYPISPSTDCSRVN
           KCG---PY-IS--T-C--V-
Sequence 2 KCGVSVPYKISTTTNCAAVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 45.76 (54/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           MG--K---AV----MV-----P-----LTC-Q--G-L--C--YLK-GG--
Sequence 2 MGSLKLVCAVLLCMMVAA---PVARASLTCPQIKGNLTPCVLYLKNGGVL

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           -P-CC-GV---N----T--DR--AC-CLK--A----G-N---A--LPGKC
Sequence 2 PPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-ISPST-C--V-
Sequence 2 GVNIPYKISPSTNCNNVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----------------------------TCGQV---L--C--YL--GG--
Sequence 2 ---------------------------ITCGQVSSSLAPCINYLRAGGVV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GV--LN--AKT-ADR--AC-CLK----S-KG-N---A--LPGKC
Sequence 2 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-ISPSTDC--V-
Sequence 2 GVSVPYKISPSTDCKSVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------------------L-CGQV---L--C---L--GG-P
Sequence 2 ---------------------------LSCGQVNSALAPCITFLTKGGVP

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           S--CC-GV-GL---AKT-ADR--AC-CLK--AGS--G-N-G-A-ALPG-C
Sequence 2 SGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRC

Sequence 1 GIRIPYPISPSTDCSRVN-
           G--IPY-IS-ST-C-----
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 31
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 46.61 (55/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M-----A--VAV---VV----P-------CGQVT--L--C---L--GG-P
Sequence 2 MATLNSACVVAVLCLVV-LTAPTAHAAISCGQVTSSLASCIPFLTKGG-P

Sequence 1 SPA-CCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           -PA-CC-GV--LN--AKT--DR---C-CLK--AG---G-N---A--LPGK
Sequence 2 VPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGK

Sequence 1 CGIRIPYPISPSTDCSRVN-
           CG--IPY-IS-ST-C-----
Sequence 2 CGVSIPYKISTSTNCATIKF



Alignment 32
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 44.07 (52/118)
Sequence 1 ----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG
           ---------VA-AV------------A------CGQV------C--Y--G
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAI---SCGQVASAIAPCISYARG

Sequence 1 -GGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASA
           -G--PS--CC-GV--LN--A-T-ADR--AC-CLK--A--V-G-N-G-A--
Sequence 2 QGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAAS

Sequence 1 LPGKCGIRIPYPISPSTDCSRVN--------
           -P-KCG--IPY-IS-STDCSR----------
Sequence 2 IPSKCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 33
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 46.61 (55/118)
Sequence 1 -----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLK
           -----MGV---A--V---LMV----HP-V----TC--VTG-L--CL-YL-
Sequence 2 MKGTSMGVAILAMIVMAQLMV----HPSVA--ITCNDVTGNLTPCLPYLR

Sequence 1 GGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASA
           -GG-P-PACC-G-K-L-----T-ADR--AC-C-KT-A---K------AS-
Sequence 2 SGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASS

Sequence 1 LPGKCGIRIPYPISPSTDCSRVN
           LPGKCGI----PI-P---C----
Sequence 2 LPGKCGISTSIPINPNVNCNTIP



Alignment 34
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 44.07 (52/118)
Sequence 1 ----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG
           --------K----VAVM----V---P-------CGQV---L--C--Y---
Sequence 2 MASSGQLLKLVCLVAVMCCMAV-GGPKAMAAVSCGQVVNNLTPCINYVAN

Sequence 1 GGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVK--GINYGAAS
           GG---P-CC-GV--L-SLA-T-ADR---C-CLK-----------N-G-A-
Sequence 2 GGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAA

Sequence 1 ALPGKCGIRIPYPISPSTDCSRVN
           -LPGKCG--IPY-ISPSTDC----
Sequence 2 GLPGKCGVNIPYKISPSTDCKTIK



Alignment 35
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEG-LTCGQVTGKLGGCLGYLKGGGY
           ------A-A--V---VV-----AV-E----CGQV---L--C--Y--G-G-
Sequence 2 --MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGA

Sequence 1 -PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPG
           -PS-ACC-GV--L-S-A---AD---AC-C-K--A----G-N-G-A---P-
Sequence 2 SPSAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPT

Sequence 1 KCGIRIPYPISPSTDCSRVN
           KCG---PY-IS-S-DCS---
Sequence 2 KCGVSVPYAISSSVDCSKIR



Alignment 36
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 38.98 (46/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           ---------A-A--LM-------AV---L-CGQV--K---CL-Y--GG--
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVA--LNCGQVDSKMKPCLTYVQGGPG

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PS--CC-GV--L---A----DR---C-CLK--A------N---A---P-K
Sequence 2 PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSK

Sequence 1 CGIRIPYPISPSTDCSRVN
           C----PY-ISP--DCSR--
Sequence 2 CNVNVPYTISPDIDCSRIY



Alignment 37
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 44.07 (52/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKG--G
           -----K-A----V--MVV----P-----L-CG-V------C--YL-----
Sequence 2 MARSMKLACVALVICMVVIA--PMAEAALSCGTVSADMAPCVTYLQAPNN

Sequence 1 GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALP
           --P-P-CC-GVK-L---A-T--DR--AC-CLK--AGS----N---A-ALP
Sequence 2 ASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALP

Sequence 1 GKCGIRIPYPISPSTDCSRVN-
           GKCG--IPY-IS-ST-C--V--
Sequence 2 GKCGVSIPYKISTSTNCNTVRF



Alignment 38
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 38.98 (46/118)
Sequence 1 -MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           ---------A-A--LM-------AV---L-CGQV--K---CL-Y--GG--
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVA--LNCGQVDSKMKPCLTYVQGGPG

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PS--CC-GV--L---A----DR---C-CLK--A------N---A---P-K
Sequence 2 PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSK

Sequence 1 CGIRIPYPISPSTDCSRVN-----------------
           C----PY-ISP--DCSR-------------------
Sequence 2 CNVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 39
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-LTC--V--K---CL-YLK-GG--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-LTC--V--K---CL-YLK-GG--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-LTC--V--K---CL-YLK-GG--
Sequence 2 --MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 43.22 (51/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---CL--LK-GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-L-C--V--K---CL-YLK-GG--
Sequence 2 ----MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-L-C--V--K---CL-YLK-GG--
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------V---------E-L-C--V--K---CL-YLK-GG--
Sequence 2 --MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V-------E-LTC--V--K---CL-YLK-GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVSS-SYAEALTCSDVSNKISPCLNYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLK------K------A--LP-KC
Sequence 2 PANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY--S--TDC--V-
Sequence 2 GVTIPYKLSMETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 43.22 (51/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---C---LK-GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           S--CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 43.22 (51/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---C---LK-GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           S--CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 42.37 (50/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---C---LK-GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 43.22 (51/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---CL--LK-GG--
Sequence 2 -MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 41.53 (49/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--VT-K---C---L--GG--
Sequence 2 -MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--AKT--DR--AC-CLKT---S--------A--LP-KC
Sequence 2 PVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G--IPY-IS--TDC--V-
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 52
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 40.68 (48/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K------VM----V---------LTC--V--K---CL-YLK-GG--
Sequence 2 ---MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN---KT--DR--AC-CLK----S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY--S--TDC--V-
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 53
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 39.83 (47/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ----K-------M----V---------LTC--V--K---CL-YLK-GG--
Sequence 2 -MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN---KT--DR--AC-CLK----S-K------A--LP-KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY--S--TDC--V-
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 54
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 37.29 (44/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEG-LTCGQVTGKLGGCLGYLKGGGY
           ------AIA--V-----V-----V--G--TCGQV---L--C---L--GG-
Sequence 2 ----MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGE

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           P--ACC-GV--LN-------DR--AC-C-K--A---------AA--LP-K
Sequence 2 PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CGI----PIS----C----
Sequence 2 CGISLTVPISRTVNCDTIS



Alignment 55
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 36.44 (43/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           -----------------------------C--VT-----C-GYLK-GG--
Sequence 2 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSV-KGINYGAASALPGK
           S--CC-G----N--AKT--DR---C-CLK--A-S----IN---A--LPGK
Sequence 2 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-IS-S--CS---
Sequence 2 CGVSIPYKISTSINCSSIK



Alignment 56
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 33.90 (40/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           -----------------------------CG-V------CL-Y--GG--P
Sequence 2 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           S--CC-GVK-L---A----DR--AC-CLK--A------N---A---P-KC
Sequence 2 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC

Sequence 1 GIRIPYPISPSTDCSRVN
           G---PY-IS---DCSRV-
Sequence 2 GVNLPYTISLNIDCSRV-



Alignment 57
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 37.29 (44/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------------------L-CG-V---L--C-GYL-----P
Sequence 2 --------------------------ALSCGTVNSNLAACIGYLTQNA-P

Sequence 1 SP-ACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           -P--CC-GV--LN--A-T--DR-QAC-CL---A-S----N---A-ALP--
Sequence 2 LPKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKA

Sequence 1 CGIRIPYPISPSTDCSRVN
           CG--IPY-IS-ST-C--V-
Sequence 2 CGVNIPYKISKSTNCNSVR



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 33.05 (39/118)
Sequence 1 ------MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYL
           ------------A-A-A----------PA--EG--CG-V------CL---
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEG-PCGKVVHHIMPCLKFV

Sequence 1 KGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAA
           KG----PS--CC-G-K-L----KT------AC-C---------GI-----
Sequence 2 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV

Sequence 1 SALPGKCGIR--IPYPISPSTDCSRVN--------
           ---P-KCGI----P-PI----DCS-----------
Sequence 2 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 34.75 (41/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           M--------VAV-L--V-----------TC--V---L--C-G-L-G---P
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFLTGQ-EP

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           S-ACC-GV--LN---KT-ADR---C-C-K-L--S-----------L--KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPLLSTKC

Sequence 1 GIRIPYP-ISPSTDCSRVN-
           G-----P------DCS----
Sequence 2 GVKPDFPAVDKNLDCSKLPV



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 35.59 (42/118)
Sequence 1 -------MGVSKVAIAVAVMLMVVVIN-HPAVVEGL--TCGQVTGKLGGC
           ---------V--V-I--AV----------PA---G---TCG-V-G-L--C
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LGYLKGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGIN
           L----G----PS--CC-G-K-L----KT---R--AC-C--T-------I-
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 YGAASALPGKCGI---RIPYPISPSTDCSRVN-------
           ----S--P--CGI-----P-PI----DC-----------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 32.20 (38/118)
Sequence 1 ----MGVSKVAIAVAVMLMVVVINHPAVVEGL-TCGQVTGKLGGCLGYLK
           ---------V-IA-A----------PA---G---CG-V------CL---K
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAAS
           G----PS--CC-G-K-L----KT------AC-C---------GI------
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 ALPGKCGIR--IPYPISPSTDCSRVN--------
           --P-KC-I----P-PI----DCS-----------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 31.36 (37/118)
Sequence 1 ---------MGVSKVAIAVAVMLMVVVINHPAVVEGL--TCGQVTGKLGG
           -----------------A------------PA---G---TCG-V---L--
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLGYLKGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGI
           CL----G----PS--CC-G-K-L----KT---R--AC-C--T-------I
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NYGAASALPGKCGI---RIPYPISPSTDCSRVN-----------------
           -----S--P--CGI-----P-PI----DC---------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 27.97 (33/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-GY
           ----------------------------TCG-----L--CL----G----
Sequence 2 --------------------------QETCGTMVRALMPCLPFVQGKEKE

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PS--CC-G-K-L----KT---R--AC-C--T-------I-----S--P--
Sequence 2 PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKH

Sequence 1 CGI---RIPYPISPSTDCSRVN----------------------------
           CGI-----P-PI----DC--V-----------------------------
Sequence 2 CGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKAR

Sequence 1 ----------------
           ----------------
Sequence 2 LERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 27.12 (32/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-GY
           ----------------------------TCG-----L--CL----G----
Sequence 2 --------------------------QETCGTMVRALMPCLPFVQGKEKE

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PS--CC-G-K-L----KT---R--AC-C--T-------I-----S--P--
Sequence 2 PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKH

Sequence 1 CGI---RIPYPISPSTDCSRVN----------------------------
           CGI-----P-PI----DC--------------------------------
Sequence 2 CGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKAR

Sequence 1 ----------------
           ----------------
Sequence 2 LERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 25.42 (30/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGG-GY
           ------------------------------------L--CL----G----
Sequence 2 --------------------------------MVRALMPCLPFVQGKEKE

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGK
           PS--CC-G-K-L----KT---R--AC-C--T-------I-----S--P--
Sequence 2 PSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKH

Sequence 1 CGI---RIPYPISPSTDCSRVN----------------------------
           CGI-----P-PI----DC--V-----------------------------
Sequence 2 CGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKAR

Sequence 1 ----------------
           ----------------
Sequence 2 LERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 16.95 (20/118)
Sequence 1 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP
           ---------------------------LTC--V--K---CL-YLK-GG--
Sequence 2 --------------------------ALTCSDVSNKISPCLSYLKQGGEV

Sequence 1 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC
           ---CC-GVKGLN--------------------------------------
Sequence 2 PADCCAGVKGLND-------------------------------------

Sequence 1 GIRIPYPISPSTDCSRVN
           ------------------
Sequence 2 ------------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Sola l 6.0101, Sequence: A0A3Q7F7X3
Sequence identity: 27.97 (33/118)
Sequence 1 MGVSKVAIAVAVML-MVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGY
           ----KV---VAVML-M--V-------E--TC------L--CLG---GG--
Sequence 2 --MTKVCSFVAVMLVMILVCDQFGANEAATCS--ASQLSPCLGAIQGGTA

Sequence 1 PSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKG-INYGAASALPG
           PS--CC---K-------------Q-C-C------------N---A----G
Sequence 2 PSQDCCARLKN-----------QQPCICGFMKDPNLRQYVNSPNARKVAG

Sequence 1 KCGIRIPYPISPSTDCSRVN
           -CG--IP-------------
Sequence 2 QCGVSIPSC-----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.