The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Par j 2

Sequence O04403

Full FASTA alignment

Sequence name:
Query sequence:
MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
EVPKKCGITTTLPPITADFDCSKIESTIFRGYY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Par j 2O04403Go!133190.11.8e-50
2Par j 2P55958Go!133170.41.5e-44
3Par j 1Q40905Go!138104.88.6e-25
4Par j 1O04404Go!176100.81.7e-23
5Par j 1P43217Go!13980.81.5e-17
6Par j 1.0103CAI94601Go!13980.42.0e-17
7Par j 1.0101CAA54587Go!13376.62.5e-16
8Zea m 14.0101P19656-1Go!12067.41.3e-13
9Zea m 14.0102P19656-2Go!12866.62.5e-13
10Tri tu 14.0101CAH69206Go!11560.71.3e-11
11Pun g 1.0201A0A059SSZ0Go!12059.72.7e-11
12Pun g 1.0101A0A059STC4Go!12058.18.5e-11
13Pla a 3.0101CAL07989Go!11857.21.5e-10
14Hev b 12AAL25839Go!11657.01.7e-10
15Sola l 7.0101NP_001316123Go!11556.82.0e-10
16Pla or 3.0101ABY21307Go!11856.42.7e-10
17Fra a 3.0101Q8VX12Go!11756.23.1e-10
18Api g 2ACV04796Go!11856.23.1e-10
19Hor v 1AAA32970Go!11755.45.5e-10
20Rub i 3.0101Q0Z8V0Go!11755.45.5e-10
21Hel a 3.0101P82007Go!11655.07.2e-10
22Tri a 14.010119846220Go!9054.67.4e-10
23Art ar 3.0102ANC85020Go!11654.31.1e-09
24Art si 3.0102ANC85027Go!11654.31.1e-09
25Art v 3.0202ACE07187Go!11654.31.1e-09
26Hor v 1CAA42832Go!13454.41.2e-09
27Fra a 3.0102Q4PLT9Go!11753.91.5e-09
28Pun g 1.0301A0A059ST23Go!12053.52.0e-09
29Art la 3.0102ANC85025Go!11553.32.3e-09
30Can s 3.0101W0U0V5Go!9152.92.4e-09
31Art v 3.0301EU564847Go!11753.12.6e-09
32Art gm 3.0102ANC85023Go!11753.12.6e-09
33Art ca 3.0101ANC85021Go!11752.93.1e-09
34Art an 3.0101ANC85017Go!11752.93.1e-09
35Fra a 3.0201Q4PLU0Go!11752.73.5e-09
36Mor n 3.0101P85894Go!9152.33.6e-09
37Pru d 3P82534Go!9152.33.6e-09
38Sola l 3.0101P93224Go!11452.54.0e-09
39Lyc e 3AAB42069Go!11452.54.0e-09
40Art si 3.0101ANC85026Go!11652.54.1e-09
41Art gm 3.0101ANC85022Go!11752.54.1e-09
42Fra a 3.0202Q4PLT6Go!11752.54.1e-09
43Pru ar 3P81651Go!9152.14.2e-09
44Len c 3.0101A0AT29Go!11852.34.7e-09
45Art an 3.0102ANC85018Go!11751.96.3e-09
46Pru av 3Q9M5X8Go!11751.48.3e-09
47Art v 3.0201EU564845Go!11451.29.5e-09
48Art ar 3.0101ANC85019Go!11651.29.6e-09
49Art la 3.0101ANC85024Go!11651.29.6e-09
50Ara h 9.0101ABX56711Go!11650.81.3e-08
51Lup an 3.0101XP_019446786Go!11650.61.5e-08
52Amb a 6O04004Go!11850.61.5e-08
53Pru p 3CAB96876Go!9150.21.5e-08
54Cor a 8AAK28533Go!11550.22.0e-08
55Art ca 3.0102QIN55516Go!11750.22.0e-08
56Ara h 9.0201ABX75045Go!9249.62.3e-08
57Pru p 3P81402Go!9149.23.1e-08
58Pru du 3.0101ACN11576Go!12348.85.5e-08
59Pis s 3.0101A0A161AT60Go!12048.28.4e-08
60Mal d 3Q9M5X7Go!11547.31.5e-07
61Pha v 3.0201ADC80503Go!11847.31.5e-07
62Sin a 3.0101ABU95411Go!9246.71.8e-07
63Pyr c 3Q9M5X6Go!11546.72.2e-07
64Pha v 3.0101ADC80502Go!11545.84.0e-07
65Ara h 17.0101A0A510A9S3Go!9343.61.5e-06
66Par o 1.0101AAB46820Go!2433.54.4e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 100.00 (133/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
Sequence 2 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY



Alignment 2
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 90.98 (121/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           MRTVSMAALVVIAAALAWTSSAE-A-APAPGE--CGKVV--IMPCL-FVK
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           GEEKEPSK-CCSGTKKLSEEVKTTEQKREACKCIV-ATKGISGIKNELVA
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           EVPKKC-I-TTLPPITADFDCSKI-STIFRGYY
Sequence 2 EVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY



Alignment 3
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 54.89 (73/133)
Sequence 1 MRTV----SMAALVVIAAALAWTSSAELASAPAPG-EGPCGKVVHHIMPC
           MRTV----S-A--V--AA-L-WTSSA--A-APAPG-E--CG-VV---MPC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIK
           L-FV-G-EKEPSK-CCSG-K-L--E-KT--Q---AC-CI--A-K--S-I-
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 NELVAEVPKKCGITTT-LPPITADFDCSKIESTIFRGYY
           --LV-EVPK-CGI----LPPI----DC---------G--
Sequence 2 GKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVLHYKGN-



Alignment 4
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 54.14 (72/133)
Sequence 1 MRTVS----MAALVVIAAALAWTSSAELAS-APAPG-EGPCGKVVHHIMP
           MRTVS-----A--V--AA-LAWTS-A--A--APAPG-E--CG-VV---MP
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGI
           CL-FV-G-EKEPSK-CCSG-K-L--E-KT--Q---AC-CI--A-K--S-I
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 KNELVAEVPKKCGIT-TTLPPITADFDCSKIESTIFRGYY----------
           ---LV-EVPK-CGI----LPPI----DC----------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVT

Sequence 1 --------------------------
           --------------------------
Sequence 2 GPSDPAHKARLERPQIRVPPPAPEKA



Alignment 5
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 36.84 (49/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG--V---MPCL-FV-
Sequence 2 -------------------------------QETCGTMVRALMPCLPFVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G-EKEPSK-CCSG-K-L--E-KT--Q---AC-CI--A-K--S-I---LV-
Sequence 2 GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS

Sequence 1 EVPKKCGIT-TTLPPITADFDCSKIESTIFRGYY----------------
           EVPK-CGI----LPPI----DC----------------------------
Sequence 2 EVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPA

Sequence 1 --------------------
           --------------------
Sequence 2 HKARLERPQIRVPPPAPEKA



Alignment 6
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 36.84 (49/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG--V---MPCL-FV-
Sequence 2 -------------------------------QETCGTMVRALMPCLPFVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G-EKEPSK-CCSG-K-L--E-KT--Q---AC-CI--A-K--S-I---LV-
Sequence 2 GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS

Sequence 1 EVPKKCGIT-TTLPPITADFDCSKIESTIFRGYY----------------
           EVPK-CGI----LPPI----DC----------------------------
Sequence 2 EVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPA

Sequence 1 --------------------
           --------------------
Sequence 2 HKARLERPQIRVPPPAPEKA



Alignment 7
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 35.34 (47/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------------------------------------V---MPCL-FV-
Sequence 2 -------------------------------------MVRALMPCLPFVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G-EKEPSK-CCSG-K-L--E-KT--Q---AC-CI--A-K--S-I---LV-
Sequence 2 GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVS

Sequence 1 EVPKKCGITTT-LPPITADFDCSKIESTIFRGYY----------------
           EVPK-CGI----LPPI----DC----------------------------
Sequence 2 EVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPA

Sequence 1 --------------------
           --------------------
Sequence 2 HKARLERPQIRVPPPAPEKA



Alignment 8
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 30.83 (41/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------L-V-A-A--------LA-A-------CG-V---I-PC-----
Sequence 2 --MARTQQLAVVATAVV--ALVLLAAATSEAAISCGQVASAIAPCISYAR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CCSG---L-----TT---R-AC-C---A--G-SG------A
Sequence 2 GQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DCS-----------
Sequence 2 SIPSKCGVS--IPYTISTSTDCSRVN--------



Alignment 9
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 30.83 (41/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------L-V-A-A--------LA-A-------CG-V---I-PC-----
Sequence 2 --MARTQQLAVVATAVV--ALVLLAAATSEAAISCGQVASAIAPCISYAR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CCSG---L-----TT---R-AC-C---A--G-SG------A
Sequence 2 GQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DCS-----------
Sequence 2 SIPSKCGVS--IPYTISTSTDCSRYSRRMHASAD



Alignment 10
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 30.08 (40/133)
Sequence 1 --MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKF
           -----V----LV---AA----------S--------CG-V-----PC---
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVS--------CGQVSSALSPCISY

Sequence 1 VKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNEL
           --G----PS--CCSG---L------T--K--ACKCI--A--G----K---
Sequence 2 ARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNAGK---

Sequence 1 VAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           -A--P-KCG-------I----DCSKI---------
Sequence 2 AAGIPTKCGVSVPYA-ISSSVDCSKIR--------



Alignment 11
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------A-------A---------CG-V-----PC-----
Sequence 2 ----MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CCSG---L----KTT-----AC-C-------I-GI----V-
Sequence 2 GVVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVG

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DCS-----------
Sequence 2 ALPGKCGVS--IPYKISPSTDCSRVK--------



Alignment 12
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 27.07 (36/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEG--PCGKVVHHIMPCLKF
           -----------------------L--AP---E----CG-V-----PC---
Sequence 2 ------MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPY

Sequence 1 VKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNEL
           -----------CCSG-K-L-----TT------CKC---A---ISGI---L
Sequence 2 ARSAGGAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGL

Sequence 1 VAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           VA--P-KCG-----P--I----DC------------
Sequence 2 VASLPAKCGVN--IPYKISPSTDCARVK--------



Alignment 13
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 32.33 (43/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV
           -------A----A-----------A-AP-A-----CG-VV----PCL-F-
Sequence 2 ------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFL

Sequence 1 K-GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNEL
           --G----P---CC-G-K-L----KTT-----AC-C---A---ISGI----
Sequence 2 RSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGN

Sequence 1 VAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           -A----KCG----LP--I----DCSK----------
Sequence 2 AASLAGKCGVN--LPYKISPTIDCSKVK--------



Alignment 14
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEG-PCGKVVHHIMPCLKFV
           -----------------------L--AP-------CG-V-----PCL---
Sequence 2 ---------MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           K-----P---CC-G--------KTT---R-AC-C---A-----G-----V
Sequence 2 KTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTV

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P-KCG-----P--I-----C------------
Sequence 2 AGLPGKCGVN--IPYKISLSTNCATVK--------



Alignment 15
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 29.32 (39/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           M-------LVV-A----------LA---A-G---CG-V-----PC--F--
Sequence 2 MKAIAILVLVVLAVF-------QLAMV-ARGAITCGQVDANLAPCVPFLT

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           ----EP---CCSG---L----------R-AC-C--AA-------K-----
Sequence 2 -QGGEPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQ

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCGI--T-P-I-----C--I---------
Sequence 2 SLPSKCGISLTVP-ISRTVNCDTIS--------



Alignment 16
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 31.58 (42/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV
           -------A----A-----------A-AP-A-----CG-VV----PCL---
Sequence 2 ------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYL

Sequence 1 K-GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNEL
           --G----P---CC-G-K-L----KTT-----AC-C---A---ISGI----
Sequence 2 RSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGN

Sequence 1 VAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           -A----KCG----LP--I----DCSK----------
Sequence 2 AASLAGKCGVN--LPYKISPTIDCSKVK--------



Alignment 17
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 30.08 (40/133)
Sequence 1 -----MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPC
           ---------S--AL--I--AL-----------P------CG-V---I-PC
Sequence 2 MASSTAMKLSLVALLCIVVAL-----------PIAQAITCGQVASNISPC

Sequence 1 LKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIK
           L--VK-----P---CCSG---L----KTT-----AC-C---A--GI-G--
Sequence 2 LTYVKSGGAVPA-ACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLN

Sequence 1 NELVAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --L-A--P-KCG-------I-----C------------
Sequence 2 PNLAAGLPGKCGVSVPYK-ISTTTNCAAVK--------



Alignment 18
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 29.32 (39/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEG-PCGKVVHHIMPCLKFV
           ------------A-A-A----------PA--EG--CG-V------CL---
Sequence 2 ------MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           KG----PS--CC-G-K-L----KT------AC-C---------GI-----
Sequence 2 KGG-GYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           ---P-KCGI----P-PI----DCS-----------
Sequence 2 SALPGKCGIR--IPYPISPSTDCSRVN--------



Alignment 19
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 27.07 (36/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ------A-----AAAL-----A----A-A-----CG-V-----PCL--V-
Sequence 2 ---MARAQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CC-G---L-------------C-C------GI--------A
Sequence 2 GGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KC--------I--D-DCS-I---------
Sequence 2 SIPSKCNVNVPYT-ISPDIDCSRIY--------



Alignment 20
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 26.32 (35/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -----MA---V---AL--------A--P------CG-V-----PC---VK
Sequence 2 -----MACSAVMKLALVALLCIVVA-VPVAQAITCGQVTQNVAPCFNYVK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G---L----KTT------C-C---A---I-G----L-A
Sequence 2 NGGAVPA-ACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I-----C------------
Sequence 2 GLPGKCGVSVPYK-ISTSTNCATVK--------



Alignment 21
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 27.82 (37/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -----M-------A-LA----A-L---P------C--V-----PCL----
Sequence 2 -----MKGTSMGVAILAMIVMAQLMVHPSVAI-TCNDVTGNLTPCLPYLR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           ---K-P---CC-G-KKL-----T----R-ACKC---A-------------
Sequence 2 SGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMAS

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCGI-T--P-I-----C--I---------
Sequence 2 SLPGKCGISTSIP-INPNVNCNTIP--------



Alignment 22
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 22.56 (30/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PCL--V-
Sequence 2 --------------------------------IDCGHVDSLVRPCLSYVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CC-G-K-L------------AC-C------GI---------
Sequence 2 GGPG-PSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNAR

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG----LP--I----DCS-----------
Sequence 2 SIPPKCGVN--LPYTISLNIDCSRV---------



Alignment 23
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I-PCL---K
Sequence 2 -------MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 24
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I-PCL---K
Sequence 2 -------MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 25
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I-PCL---K
Sequence 2 -------MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 26
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 26.32 (35/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ------A-----AAAL-----A----A-A-----CG-V-----PCL--V-
Sequence 2 ---MARAQVLLMAAALVLMLTAAPRAAVALN---CGQVDSKMKPCLTYVQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----PS--CC-G---L-------------C-C------GI--------A
Sequence 2 GGPG-PSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY---------
           --P-KC--------I--D-DCS--------------------
Sequence 2 SIPSKCNVNVPYT-ISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 27
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 28.57 (38/133)
Sequence 1 -----MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPC
           ---------S--AL--I--AL-----------P------CG-V---I-PC
Sequence 2 MASSTAMKLSLVALLCIVVAL-----------PIAQAITCGQVASNISPC

Sequence 1 LKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIK
           ---VK-----P---CCSG---L----KTT------C-C---A--GI-G--
Sequence 2 VTYVKSGGAVPAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLN

Sequence 1 NELVAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --L-A--P-KCG-------I-----C------------
Sequence 2 PNLAAGLPGKCGVSVPYK-ISTTTNCAAVK--------



Alignment 28
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 27.07 (36/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -----MA-------A---------AS--A-----CG-V------C-----
Sequence 2 -----MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYAR

Sequence 1 GEEKEP-SKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           G----P----CC-G---L----KTT-----AC-C-------ISGI---LV
Sequence 2 GNGAGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLV

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P-KCG-----P--I-----C------------
Sequence 2 AGAPGKCGVS--IPYKIAPSTNCDNVK--------



Alignment 29
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 24.81 (33/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--A-----C--V---I-PCL---K
Sequence 2 --------MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C--A--K-----K-----
Sequence 2 KGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG----LP-------DC-K----------
Sequence 2 PLPSKCGLN--LPYKLSLETDCNKVK--------



Alignment 30
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PCL---K
Sequence 2 --------------------------------ITCGQVASSLAPCLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC---K-LS---KT------ACKC---A---I-G----L--
Sequence 2 VGGAVPD-GCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLAS

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DCS-----------
Sequence 2 GLPGKCGVS--IPYKISPSTDCSSVK--------



Alignment 31
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 24.81 (33/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A--------------------A-----C--V---I-PCL---K
Sequence 2 ------MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C--A--K-----K-----
Sequence 2 KGGEVPA-DCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG----LP-------DC-K----------
Sequence 2 PLPSKCGLN--LPYKLSLETDCNKVK--------



Alignment 32
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PCL-F-K
Sequence 2 ------MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K-----
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 VLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 33
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PC--F-K
Sequence 2 ------MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           ----E-S--CC-G-K-L----KTT-----AC-C-----K-----K-----
Sequence 2 -QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 VLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 34
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PC--F-K
Sequence 2 ------MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           ----E-S--CC-G-K-L----KTT-----AC-C-----K-----K-----
Sequence 2 -QGGEVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 VLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 35
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 27.07 (36/133)
Sequence 1 -----MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPC
           ---------S--AL--I--AL-----------P------CG-V---I-PC
Sequence 2 MASSTAMKLSLVALLCIVVAL-----------PIAQAITCGQVASSISPC

Sequence 1 LKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIK
           ---VK-----P---CC-G---L----KTT------C-C---A---I-G--
Sequence 2 VNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLN

Sequence 1 NELVAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --L-A--P-KCG-------I-----C------------
Sequence 2 PSLAAGLPGKCGVSVPYK-ISTSTNCAAVK--------



Alignment 36
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 21.05 (28/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PC-----
Sequence 2 --------------------------------ITCGQVSSSLAPCINYLR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G---L----KTT-----AC-C---A---I-G----L-A
Sequence 2 AGGVVPA-NCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I----DC------------
Sequence 2 GLPGKCGVSVPYK-ISPSTDCKSVK--------



Alignment 37
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 21.05 (28/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PC---VK
Sequence 2 --------------------------------ITCGQVSSNLAPCINYVK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G---------TT---R-AC-C-------I-G------A
Sequence 2 GGGAVPP-ACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I-A---C------------
Sequence 2 ALPGKCGVNVPYK-ISASTNCATVK--------



Alignment 38
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------------------------AP------CG-V-----PCL----
Sequence 2 --------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLE

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G-K-L----KT-E----AC-C---A---I-GI-----A
Sequence 2 G--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P--CG-----P--I----DCS-----------
Sequence 2 GLPGVCGVN--IPYKISPSTDCSTVQ--------



Alignment 39
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------------------------AP------CG-V-----PCL----
Sequence 2 --------MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLE

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G-K-L----KT-E----AC-C---A---I-GI-----A
Sequence 2 G--RGPLGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P--CG-----P--I----DCS-----------
Sequence 2 GLPGVCGVN--IPYKISPSTDCSTVQ--------



Alignment 40
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 23.31 (31/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I-PCL---K
Sequence 2 -------MAMKMMKVFCVMVVCMVVSSSYAEALTCSDVSNKISPCLNYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K-----
Sequence 2 QGGEVPA-NCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-T---P-------DC-K----------
Sequence 2 PLPSKCGVT--IPYKLSMETDCNKVK--------



Alignment 41
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PC--F-K
Sequence 2 ------MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 VLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 42
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 27.07 (36/133)
Sequence 1 -----MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPC
           ---------S--AL--I--AL-----------P------CG-V---I-PC
Sequence 2 MAISTAMKLSLVALLCIVVAL-----------PIAQAITCGQVASSISPC

Sequence 1 LKFVKGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIK
           ---VK-----P---CC-G---L----KTT------C-C---A---I-G--
Sequence 2 VNYVKSGGAVPA-ACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLN

Sequence 1 NELVAEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --L-A--P-KCG-------I-----C------------
Sequence 2 PNLAAGLPGKCGVNVPYK-ISTSTNCAAVK--------



Alignment 43
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 21.80 (29/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PC---V-
Sequence 2 --------------------------------ITCGQVSSSLAPCIGYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G---------TT---R-AC-C-------ISG------A
Sequence 2 GGGAVPP-ACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I-A---C------------
Sequence 2 ALPGKCGVN--IPYKISASTNCATVK--------



Alignment 44
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 26.32 (35/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV
           --------------A-----------AP-A-G---CG-V-----PCL---
Sequence 2 -------MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           -G----PS--CC-G-KKL-----TT-----AC-C---A---I--------
Sequence 2 TGGPG-PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P-KCG-----P--I-----C------------
Sequence 2 AALPGKCGVN--IPYKISTTTNCNTVKF-------



Alignment 45
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PC--F--
Sequence 2 ------MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLE

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K-E--A
Sequence 2 KGGEVPV-DCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 VLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 46
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 21.05 (28/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S-P------CG-V-----PC---V-
Sequence 2 ------MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G--------KTT-----AC-C---------G------A
Sequence 2 GGGAVPP-ACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I-----C------------
Sequence 2 ALPGKCGVNVPYK-ISPSTNCATVK--------



Alignment 47
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 23.31 (31/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I--CL---K
Sequence 2 ---------MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 48
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 23.31 (31/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I--CL---K
Sequence 2 -------MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 49
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 23.31 (31/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------------------------S--------C--V---I--CL---K
Sequence 2 -------MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KTT-----AC-C-----K-----K----A
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC-K----------
Sequence 2 SLPSKCGVN--IPYKISLETDCNKVK--------



Alignment 50
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 24.81 (33/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFV-
           --------------A-----------AP------CG-V-----PC--F--
Sequence 2 --------MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLT

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           KG----P---CCSG---L-----TT-----AC-C--AA-----G------
Sequence 2 KG--GAPPPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P--CG-----P--I-----C--I---------
Sequence 2 AALPGRCGVS--IPYKISTSTNCATIKF-------



Alignment 51
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 27.07 (36/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -----MA--V--A-A----------SAP------CG-V------CL----
Sequence 2 -----MAGIVKLACAV--LICMVVVSAPLTKAITCGQVTANLAQCLNYLR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K------KTT---R-AC-C--AA-----G-------
Sequence 2 SGGAVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAG

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I-----C--I---------
Sequence 2 SLPGKCGVN--IPYKISTSTNCASIK--------



Alignment 52
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 25.56 (34/133)
Sequence 1 -MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFV
           -----------V------W------A--P------C--V-----PC--F-
Sequence 2 MDCIRILWSVAVGLLLVSWRPTM-FAASPT-----CDTVQNILAPCAGFL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           -G-E--PSK-CC-G---L----KT-------C-CI---TK-I--------
Sequence 2 TGQE--PSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIAYDPKRM-

Sequence 1 AEVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           -----KCG-----P------DCSK----------
Sequence 2 PLLSTKCGVKPDFPAVDKNLDCSKLPV-------



Alignment 53
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 19.55 (26/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PC---V-
Sequence 2 --------------------------------ITCGQVSSSLAPCIPYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G---------TT-----AC-C---------G------A
Sequence 2 GGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I-A---C------------
Sequence 2 ALPGKCGVS--IPYKISASTNCATVK--------



Alignment 54
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 25.56 (34/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV
           -----M--L----A-L----------AP-A-----C--------PC----
Sequence 2 -----MGSLKLVCAVLL----CMMVAAPVARASLTCPQIKGNLTPCVLYL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           K-----P--SCC-G---------TT-----AC-C-----KGI-G----L-
Sequence 2 KNGGVLPP-SCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P-KCG-----P--I-----C------------
Sequence 2 AGLPGKCGVN--IPYKISPSTNCNNVK--------



Alignment 55
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -------A-----------------S--A-----C--V---I-PCL-F-K
Sequence 2 ------MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K-L----KT------AC-C-----K-----K-----
Sequence 2 QGGEVPA-DCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAV

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I----DC------------
Sequence 2 VLPSKCGVN--IPYKISLETDCNTVK--------



Alignment 56
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFV-
           ----------------------------------CG-V-----PC--F--
Sequence 2 --------------------------------LSCGQVNSALAPCITFLT

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           KG----PS--CCSG---L----KTT-----AC-C--AA-----G------
Sequence 2 KG--GVPSGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           A--P--CG-----P--I-----C--I---------
Sequence 2 AALPGRCGVS--IPYKISTSTNCATIKF-------



Alignment 57
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 19.55 (26/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V-----PC---V-
Sequence 2 --------------------------------ITCGQVSSALAPCIPYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           G----P---CC-G---------TT-----AC-C---------G------A
Sequence 2 GGGAVPP-ACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I-A---C------------
Sequence 2 ALPGKCGVH--IPYKISASTNCATVK--------



Alignment 58
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 27.07 (36/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFV-
           ----S---L-------A-----------A-----CG-VV----PC---V-
Sequence 2 --MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVA

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI--SGIKNE
           -G----PS--CC-G---L-----TT------C-C---A--GI--------
Sequence 2 NGGALNPS--CCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAG

Sequence 1 LVAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           L-A--P-KCG-----P--I----DC--I---------
Sequence 2 LAAGLPGKCGVN--IPYKISPSTDCKTIK--------



Alignment 59
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 26.32 (35/133)
Sequence 1 -MRTVSMA--ALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLK
           --R----A--ALV------A----A-L----------CG-V-----PC--
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALS---------CGTVSADMAPCVT

Sequence 1 FVKGEEKE-PSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKN
           ---------P---CC-G-KKL-----TT-----AC-C---A---I-----
Sequence 2 YLQAPNNASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNT

Sequence 1 ELVAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           ---A--P-KCG-----P--I-----C------------
Sequence 2 NNAAALPGKCGVS--IPYKISTSTNCNTVRF-------



Alignment 60
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 20.30 (27/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ------------A--------A------------CG-V-----PC---V-
Sequence 2 --------MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G---------TT-----AC-C-------ISG------A
Sequence 2 SGGAVPP-ACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAA

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I-----C------------
Sequence 2 GLPGKCGVNVPYK-ISTSTNCATVK--------



Alignment 61
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV
           -------------A------------AP-A-----CG-V------C--F-
Sequence 2 -------MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFL

Sequence 1 KGEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELV
           ------P--SCCSG---L----KTT------C-C---A---I-G------
Sequence 2 TKGGPVPA-SCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNA

Sequence 1 AEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           ---P-KCG-----P--I-----C--I---------
Sequence 2 GILPGKCGVS--IPYKISTSTNCATIKF-------



Alignment 62
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 18.80 (25/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------CG-V------C-----
Sequence 2 -------------------------------ALSCGTVNSNLAACIGYLT

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P-K-CC-G---L-----TT-----AC-C-V-A------------A
Sequence 2 QNAPLP-KGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAA

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --PK-CG-----P--I-----C------------
Sequence 2 ALPKACGVN--IPYKISKSTNCNSVR--------



Alignment 63
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 24.06 (32/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           -----MA---VI--AL----------A-A-----C--V-----PC---V-
Sequence 2 -----MASSAVIKLALVVALCMAVSVAHAI---TCSQVSANLAPCINYVR

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G-K------KTT-----AC-C--------SG-------
Sequence 2 SGGAVPP-ACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAE

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           --P-KCG-------I-----C------------
Sequence 2 SLPGKCGVNVPYK-ISTSTNCATVK--------



Alignment 64
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 22.56 (30/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           M--V--A--VV----------A------------CG-V-----PC--F--
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMT--------CGQVQSNLVPCVTFLQ

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           -----P---CC-G----------T---R--C-C---A-----G-------
Sequence 2 NGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQ

Sequence 1 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --P-KCG-----P--I-----C--I---------
Sequence 2 ALPGKCGVN--IPYKISTSTNCASIN--------



Alignment 65
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 22.56 (30/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           ----------------------------------C--V---I-PC----K
Sequence 2 -------------------------------AIQCSFVTKSIAPCFGYLK

Sequence 1 --GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGI-SGIKNE
           --G----P---CCSG--------KTT------C-C---A-----S-I---
Sequence 2 SGGTVSGP---CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPN

Sequence 1 LVAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY
           --A--P-KCG-----P--I-----CS-I---------
Sequence 2 NAASLPGKCGVS--IPYKISTSINCSSIK--------



Alignment 66
Sequence 1:
Sequence 2: Allergen Par o 1.0101, Sequence: AAB46820
Sequence identity: 15.04 (20/133)
Sequence 1 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK
           --------------------------------GP-GKVVH-IMP-LKFVK
Sequence 2 --------------------------------GPXGKVVHIIMPPLKFVK

Sequence 1 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA
           GEE-EP--------------------------------------------
Sequence 2 GEESEP--------------------------------------------

Sequence 1 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY
           ---------------------------------
Sequence 2 ---------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.