The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Syr v 3

Sequence P58171

Full FASTA alignment

Sequence name:
Query sequence:
MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
DTDGDGFISFEEFKDFARANSGLIKDVAKIF

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Syr v 3P58171Go!8192.12.1e-21
2Ole e 3O81092Go!8483.96.1e-19
3Che a 3AAL92871Go!8679.01.9e-17
4Bet v 4CAA73147Go!8577.94.1e-17
5Bet v 4Q39419Go!8577.17.2e-17
6Sal k 7.0101ALE34025Go!8676.79.1e-17
7Aln g 4O81701Go!8575.62.0e-16
8Bra n 2BAA09633Go!8273.11.1e-15
9Bra n 2Q39406Go!8373.11.1e-15
10Par j 4.0101CAP05019Go!8472.51.7e-15
11Bra r 5.0101P69197Go!7967.55.0e-14
12Phl p 7O82040Go!7867.35.6e-14
13Cyn d 7P94092Go!8066.21.2e-13
14Cyn d 7CAA62634Go!8266.21.3e-13
15Art v 5.0101AY904434Go!8266.11.4e-13
16Jun o 4O64943Go!16552.43.6e-09
17Cup a 4.0101ABP87672Go!17752.34.2e-09
18Ole e 8AAF31152Go!17149.82.3e-08
19Amb a 10.0101Q2KN25Go!16049.62.5e-08
20Ole e 8Q9M7R0Go!17148.84.5e-08
21Tyr p 24.0101ACL36923Go!15336.22.6e-04
22Tyr p 34.0101D2DGW3Go!15336.22.6e-04
23Der f 39.0101QBF67841Go!15336.02.9e-04
24Der p 39.0101QXY82447Go!15336.02.9e-04
25Bla g 6.0101ABB89296Go!15134.58.1e-04
26Bla g 6.0201ABB89297Go!15134.58.1e-04
27Bet v 3P43187Go!20534.79.6e-04
28Per a 6.0101Q1M0Y3Go!15134.21.0e-03
29Bla g 6.0301ABB89298Go!15433.41.8e-03
30Hom a 6.0101P29291Go!15032.43.5e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Syr v 3, Sequence: P58171
Sequence identity: 100.00 (81/81)
Sequence 1 MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
           MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
Sequence 2 MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI

Sequence 1 DTDGDGFISFEEFKDFARANSGLIKDVAKIF
           DTDGDGFISFEEFKDFARANSGLIKDVAKIF
Sequence 2 DTDGDGFISFEEFKDFARANSGLIKDVAKIF



Alignment 2
Sequence 1:
Sequence 2: Allergen Ole e 3, Sequence: O81092
Sequence identity: 90.12 (73/81)
Sequence 1 ---MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMM
           ------EVAE-ERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMM
Sequence 2 MADDPQEVAEHERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMM

Sequence 1 AEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           AEIDTDGDGFISFEEF--FARAN-GL-KDVAKIF
Sequence 2 AEIDTDGDGFISFEEFTVFARANRGLVKDVAKIF



Alignment 3
Sequence 1:
Sequence 2: Allergen Che a 3, Sequence: AAL92871
Sequence identity: 77.78 (63/81)
Sequence 1 -----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQR
           ----------A--ERIFKRFD-NGDGKISSSELG--LKTLGSVTP-E--R
Sequence 2 MAAEDTPQDIADRERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRR

Sequence 1 MMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           MMAEIDTDGDGFISF-EF-DFARAN-GL-KDV-KIF
Sequence 2 MMAEIDTDGDGFISFDEFTDFARANRGLVKDVSKIF



Alignment 4
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: CAA73147
Sequence identity: 77.78 (63/81)
Sequence 1 ----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRM
           ---------AE-ERIFKRFDANGDGKIS--ELGE-LKTLGS-TP-E---M
Sequence 2 MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHM

Sequence 1 MAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           MAEIDTDGDGFISF-EF-DFARAN-GL-KDVAKIF
Sequence 2 MAEIDTDGDGFISFQEFTDFARANRGLLKDVAKIF



Alignment 5
Sequence 1:
Sequence 2: Allergen Bet v 4, Sequence: Q39419
Sequence identity: 76.54 (62/81)
Sequence 1 ----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRM
           ---------AE-ERIFKRFDANGDGKIS--ELGE-LKTLGS-TP-E---M
Sequence 2 MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHM

Sequence 1 MAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           MAEIDTDGDGFISF-EF-DF-RAN-GL-KDVAKIF
Sequence 2 MAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF



Alignment 6
Sequence 1:
Sequence 2: Allergen Sal k 7.0101, Sequence: ALE34025
Sequence identity: 80.25 (65/81)
Sequence 1 -----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQR
           ----------A--ERIFKRFD-NGDGKISSSELG--LKTLGSVT--EI-R
Sequence 2 MAAEDTPQDLADRERIFKRFDTNGDGKISSSELGDALKTLGSVTSDEIVR

Sequence 1 MMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           MMAEIDTDGDGFISFEEF--FARAN-GLIKDVAKIF
Sequence 2 MMAEIDTDGDGFISFEEFTEFARANRGLIKDVAKIF



Alignment 7
Sequence 1:
Sequence 2: Allergen Aln g 4, Sequence: O81701
Sequence identity: 76.54 (62/81)
Sequence 1 ----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRM
           ---------AE-ERIFK-FDANGDGKIS-SELG--LKTLGSVTP-E---M
Sequence 2 MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHM

Sequence 1 MAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           MAEIDTDGDGFISF-EF--FARAN-GL-KDVAKIF
Sequence 2 MAEIDTDGDGFISFQEFTNFARANRGLVKDVAKIF



Alignment 8
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: BAA09633
Sequence identity: 74.07 (60/81)
Sequence 1 -MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAE
           --A-E-AE--RIFK-FDANGDGKIS-SELG--LK-LGSVT---I-RMMAE
Sequence 2 ADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMAE

Sequence 1 IDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           IDTDGDG-IS--EF-DFA-AN-GL-KDVAKIF
Sequence 2 IDTDGDGYISYQEFSDFASANRGLMKDVAKIF



Alignment 9
Sequence 1:
Sequence 2: Allergen Bra n 2, Sequence: Q39406
Sequence identity: 74.07 (60/81)
Sequence 1 --MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMA
           ---A-E-AE--RIFK-FDANGDGKIS-SELG--LK-LGSVT---I-RMMA
Sequence 2 MADATEKAEHDRIFKKFDANGDGKISASELGDALKNLGSVTHDDIKRMMA

Sequence 1 EIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           EIDTDGDG-IS--EF-DFA-AN-GL-KDVAKIF
Sequence 2 EIDTDGDGYISYQEFSDFASANRGLMKDVAKIF



Alignment 10
Sequence 1:
Sequence 2: Allergen Par j 4.0101, Sequence: CAP05019
Sequence identity: 75.31 (61/81)
Sequence 1 ---MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMM
           --------AE-ERIFKRFD-NGDGKISSSELGE-LK-LGSVT--E--RMM
Sequence 2 MADKQIDRAEQERIFKRFDSNGDGKISSSELGEALKALGSVTADEVHRMM

Sequence 1 AEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           AEIDTDGDG-IS-EEF--FA-AN-GLIKD-AKIF
Sequence 2 AEIDTDGDGAISLEEFSSFADANRGLIKDIAKIF



Alignment 11
Sequence 1:
Sequence 2: Allergen Bra r 5.0101, Sequence: P69197
Sequence identity: 66.67 (54/81)
Sequence 1 MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
           -----AE-ERIFK-FD--GDGKIS--EL-E-LK-LGSVTP----RMMA-I
Sequence 2 --MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVTRMMAKI

Sequence 1 DTDGDGFISFEEFKDFARANSGLIKDVAKIF
           DTDGDG-ISF-EF--FA-AN-GL-KDVAK-F
Sequence 2 DTDGDGNISFQEFTEFASANPGLMKDVAKVF



Alignment 12
Sequence 1:
Sequence 2: Allergen Phl p 7, Sequence: O82040
Sequence identity: 65.43 (53/81)
Sequence 1 MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
           --------ERIFKRFD-NGDGKIS-SEL---L-TLGS----E-QRMMAEI
Sequence 2 ---MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEI

Sequence 1 DTDGDGFISFEEFKDFARANSGLIKDVAKIF
           DTDGDGFI-F-EF--F--AN-GL-KDVAK-F
Sequence 2 DTDGDGFIDFNEFISFCNANPGLMKDVAKVF



Alignment 13
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: P94092
Sequence identity: 62.96 (51/81)
Sequence 1 MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAEI
           --------E-IFKRFD-NGDGKIS--EL---L-TLGS----E-QRMMAEI
Sequence 2 -MADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAEI

Sequence 1 DTDGDGFISFEEFKDFARANSGLIKDVAKIF
           DTDGDGFI-F-EF--F--AN-GL-KDVAK-F
Sequence 2 DTDGDGFIDFDEFISFCNANPGLMKDVAKVF



Alignment 14
Sequence 1:
Sequence 2: Allergen Cyn d 7, Sequence: CAA62634
Sequence identity: 62.96 (51/81)
Sequence 1 -MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAE
           ---------E-IFKRFD-NGDGKIS--EL---L-TLGS----E-QRMMAE
Sequence 2 KTMADTGDMEHIFKRFDTNGDGKISLAELTDALRTLGSTSADEVQRMMAE

Sequence 1 IDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           IDTDGDGFI-F-EF--F--AN-GL-KDVAK-F
Sequence 2 IDTDGDGFIDFDEFISFCNANPGLMKDVAKVF



Alignment 15
Sequence 1:
Sequence 2: Allergen Art v 5.0101, Sequence: AY904434
Sequence identity: 64.20 (52/81)
Sequence 1 -MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGSVTPEEIQRMMAE
           ---E--AE--RIF--FD-NGDGKIS--ELGE-L--LGSV-PEE-Q-MM-E
Sequence 2 MADEDKAECDRIFGAFDKNGDGKISAAELGESLTKLGSVSPEEVQTMMDE

Sequence 1 IDTDGDGFISFEEFKDFARANSGLIKDVAKIF
           -DTDGDG-IS--EF--F--AN-GL-KDV-KIF
Sequence 2 LDTDGDGYISYDEFAEFFNANRGLMKDVGKIF



Alignment 16
Sequence 1:
Sequence 2: Allergen Jun o 4, Sequence: O64943
Sequence identity: 50.62 (41/81)
Sequence 1 -------------------MAEEVAELERIFKRFDANGDGKISSSELGET
           -------------------M---V-ELE--FK-FDANGDGKIS-SEL---
Sequence 2 MDEVPSSDGSKSACSGEVVMEQSVHELEEVFKKFDANGDGKISGSELADI

Sequence 1 LKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKI
           L--LGS-V---E---MM-E-D-DGDG--S--EF-D---------KD----
Sequence 2 LRSLGSDVGEAEVKAMMEEADADGDGYVSLQEFVDLNNKGAS-VKDLKNA

Sequence 1 F-------------------------------------------------
           F-------------------------------------------------
Sequence 2 FKVFDRDCNGSISAAELCHTLESVGEPCTIEESKNIIHNVDKNGDGLISV

Sequence 1 ----------------
           ----------------
Sequence 2 EEFQTMMTSEMTDKSK



Alignment 17
Sequence 1:
Sequence 2: Allergen Cup a 4.0101, Sequence: ABP87672
Sequence identity: 49.38 (40/81)
Sequence 1 -------------------------------MAEEVAELERIFKRFDANG
           -----------------------------------V-ELE--FK-FDANG
Sequence 2 MRGSHHHHHHGSMDEVPSSDGSKSASSGKRVLEQSVHELEEVFKKFDANG

Sequence 1 DGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFAR
           DGKIS-SEL---L---GS-V---E---MM-E-DTDGDG--S--EF-D---
Sequence 2 DGKISGSELADILRSMGSEVDEAEVKAMMEEADTDGDGYVSLQEFVDLN-

Sequence 1 ANSGLIKDVAKIF-------------------------------------
           ------KD----F-------------------------------------
Sequence 2 IKGATVKDLKNAFKVFDRDCNGTISPAELCQTLKSMGEPCTIEESKNIIH

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 NVDKNGDGLISVEEFQTMMTSEMTDKSK



Alignment 18
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: AAF31152
Sequence identity: 50.62 (41/81)
Sequence 1 -------------MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGS
           ----------------E--E----F-RFDANGDGKIS--EL---LK-LGS
Sequence 2 MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELACALKALGS

Sequence 1 VTP-EEIQRMMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF-----
           -T--EEI-RMM-EIDTD-DGFI---EF--F--A-----------------
Sequence 2 NTSKEEIARMMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSF

Sequence 1 ---------------------
           ---------------------
Sequence 2 EEFKKMMTNKSGNNSQAEPPK



Alignment 19
Sequence 1:
Sequence 2: Allergen Amb a 10.0101, Sequence: Q2KN25
Sequence identity: 49.38 (40/81)
Sequence 1 ----------MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGS-VT
           ----------------E---IF-RFD-NGDG-IS--EL---LK-LGS---
Sequence 2 MAPENNKHSIFPTDKEEVTKIFNRFDTNGDGQISEDELFAILKSLGSDTS

Sequence 1 PEEIQRMMAEIDTDGDGFISFEEFKDFAR---ANSGLIKDVAKIF-----
           P-E--R-MAEID-DGDGFIS--EF--F----------I-D----F-----
Sequence 2 PDEVKRVMAEIDADGDGFISLDEFILFCKGIESEGDEINDLKEAFKFYDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NNNGVISANELHQILGRLGENYSVESCADMIKSVDSDGDGFVDFEEFRKM

Sequence 1 ----------
           ----------
Sequence 2 MSRKGGDGAM



Alignment 20
Sequence 1:
Sequence 2: Allergen Ole e 8, Sequence: Q9M7R0
Sequence identity: 49.38 (40/81)
Sequence 1 -------------MAEEVAELERIFKRFDANGDGKISSSELGETLKTLGS
           ----------------E--E----F-RFDANGDGKIS--EL---LK-LGS
Sequence 2 MAANTDRNSKPSVYLQEPNEVQGVFNRFDANGDGKISGDELAGVLKALGS

Sequence 1 VTP-EEIQRMMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF-----
           -T--EEI-R-M-EIDTD-DGFI---EF--F--A-----------------
Sequence 2 NTSKEEIGRIMEEIDTDKDGFINVQEFAAFVKAETDPYPSSGGENELKEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FELYDQDHNGLISSVELHKILTRLGERYAEHDCVEMIKSVDSDGDGYVSF

Sequence 1 ---------------------
           ---------------------
Sequence 2 EEFKKMMTNKSGNNSQAEPPK



Alignment 21
Sequence 1:
Sequence 2: Allergen Tyr p 24.0101, Sequence: ACL36923
Sequence identity: 32.10 (26/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 --------------------------------MAEEVAELERIFKRFDAN
           --------------------------------------EL---F---D--
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 GDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFA
           G-G-I--S-L-E-L--L----T--E---M-AEIDTDG-G---F-EF----
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 RANSGLIKDVAKIF
           --------------
Sequence 2 TGD-----------



Alignment 22
Sequence 1:
Sequence 2: Allergen Tyr p 34.0101, Sequence: D2DGW3
Sequence identity: 32.10 (26/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSVEELSKEQVQMLRKAFDMFDRDKKGYIHTNMVSTILRTLGQTFEENDL

Sequence 1 --------------------------------MAEEVAELERIFKRFDAN
           --------------------------------------EL---F---D--
Sequence 2 QQLIIEIDADGSGELEFDEFLTLTARFLVEEDTEAMQEELREAFRMYDKE

Sequence 1 GDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFA
           G-G-I--S-L-E-L--L----T--E---M-AEIDTDG-G---F-EF----
Sequence 2 GNGYIPTSALREILRALDDKLTEDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 RANSGLIKDVAKIF
           --------------
Sequence 2 TGD-----------



Alignment 23
Sequence 1:
Sequence 2: Allergen Der f 39.0101, Sequence: QBF67841
Sequence identity: 32.10 (26/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 --------------------------------MAEEVAELERIFKRFDAN
           --------------------------------------EL---F---D--
Sequence 2 QQLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 GDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFA
           G-G-I--S-L-E-L--L----T--E---M-AEIDTDG-G---F-EF----
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 RANSGLIKDVAKIF
           --------------
Sequence 2 TGD-----------



Alignment 24
Sequence 1:
Sequence 2: Allergen Der p 39.0101, Sequence: QXY82447
Sequence identity: 32.10 (26/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MSVEELTKEQVQMLRKAFDMFDREKKGHIHTNMVSTILRTLGQTFEEKDL

Sequence 1 --------------------------------MAEEVAELERIFKRFDAN
           --------------------------------------EL---F---D--
Sequence 2 QTLITEIDADGSGELEFDEFLTLTARFLVEEDAEAMQEELREAFRMYDKE

Sequence 1 GDGKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFA
           G-G-I--S-L-E-L--L----T--E---M-AEIDTDG-G---F-EF----
Sequence 2 GNGYIPTSALREILRALDDKLTNDELDEMIAEIDTDGSGTVDFDEFMEMM

Sequence 1 RANSGLIKDVAKIF
           --------------
Sequence 2 TGD-----------



Alignment 25
Sequence 1:
Sequence 2: Allergen Bla g 6.0101, Sequence: ABB89296
Sequence identity: 29.63 (24/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDELPPEQIQLLKKAFDAFDREKKGCISTEMVGTILEMLGHRLDDDMLQE

Sequence 1 ------------------------------MAEEVAELERIFKRFDANGD
           ------------------------------------EL---F---D--G-
Sequence 2 IIAEVDADGSGELEFEEFVSLASRFLVEEDAEAMQQELREAFRLYDKEGN

Sequence 1 GKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFARA
           G-I----L-E-LK-L----T-E----M--EID-DG-G---F-EF------
Sequence 2 GYITTNVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 NSGLIKDVAKIF
           ------------
Sequence 2 E-----------



Alignment 26
Sequence 1:
Sequence 2: Allergen Bla g 6.0201, Sequence: ABB89297
Sequence identity: 29.63 (24/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDEIPAEQVVLLKKAFDAFDREKKGCISTEMVGTILEMLGTRLDQDMLDE

Sequence 1 ------------------------------MAEEVAELERIFKRFDANGD
           ------------------------------------EL---F---D--G-
Sequence 2 IIAEVDADGSGELEFEEFCTLASRFLVEEDAEAMQHELREAFRLYDKEGN

Sequence 1 GKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFARA
           G-I----L-E-LK-L----T-E----M--EID-DG-G---F-EF------
Sequence 2 GYITTAVLREILKELDDKITAEDLDMMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 NSGLIKDVAKIF
           ------------
Sequence 2 E-----------



Alignment 27
Sequence 1:
Sequence 2: Allergen Bet v 3, Sequence: P43187
Sequence identity: 35.80 (29/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MPCSTEAMEKAGHGHASTPRKRSLSNSSFRLRSESLNTLRLRRIFDLFDK

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 NSDGIITVDELSRALNLLGLETDLSELESTVKSFTREGNIGLQFEDFISL

Sequence 1 ---------------------------MAEEVAELERIFKRFDANGDGKI
           ------------------------------E-A-----FK-FD--GDG-I
Sequence 2 HQSLNDSYFAYGGEDEDDNEEDMRKSILSQEEADSFGGFKVFDEDGDGYI

Sequence 1 SSSELGETLKTLGSVTPEEIQR---MMAEIDTDGDGFISFEEFKDFARAN
           S--EL---L--LG-----EI-R---M----D---DG---F-EFKD--R--
Sequence 2 SARELQMVLGKLGFSEGSEIDRVEKMIVSVDSNRDGRVDFFEFKDMMRSV

Sequence 1 SGLIKDVAKIF
           -----------
Sequence 2 LVRSS------



Alignment 28
Sequence 1:
Sequence 2: Allergen Per a 6.0101, Sequence: Q1M0Y3
Sequence identity: 29.63 (24/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MDELPDEQIQLLKKAFDAFDREKNGFISTDMVGTILEMLGHPLDDDMLEE

Sequence 1 ------------------------------MAEEVAELERIFKRFDANGD
           ------------------------------------EL---F---D--G-
Sequence 2 IIAEVDADGSGELEFQEFVTLAARFLVEEDAEAMQQELKEAFRLYDKEGN

Sequence 1 GKISSSELGETLKTLGS-VTPEEIQRMMAEIDTDGDGFISFEEFKDFARA
           G-I----L-E-LK-L----T-E----M--EID-DG-G---F-EF------
Sequence 2 GYITTTVLREILKELDDKLTNEDLDAMIEEIDSDGSGTVDFDEFMEVMTG

Sequence 1 NSGLIKDVAKIF
           ------------
Sequence 2 E-----------



Alignment 29
Sequence 1:
Sequence 2: Allergen Bla g 6.0301, Sequence: ABB89298
Sequence identity: 29.63 (24/81)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MADEQLQLPPEQISVLRKAFDAFDREKSGSISTNMVEEILRLMGQPFNRR

Sequence 1 ----------------------------------MAEEVAELERIFKRFD
           ----------------------------------------EL---F---D
Sequence 2 TLEELIDEVDADKSGRLEFDEFVTLAAKFIIEEDSEAMEKELREAFRLYD

Sequence 1 ANGDGKISSSELGETLKTLG-SVTPEEIQRMMAEIDTDGDGFISFEEFKD
           --G-G-I--S-L-E-L--L----T--E---M--EID-DG-G---F-EF--
Sequence 2 KEGNGYIPTSCLREILRELDEQLTSDELDMMIEEIDADGSGTVDFDEFME

Sequence 1 FARANSGLIKDVAKIF
           ----------------
Sequence 2 MMTG------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Hom a 6.0101, Sequence: P29291
Sequence identity: 28.40 (23/81)
Sequence 1 ----MAEEVAELERIFKRFDANGDGKISSSELGETLKTLG-SVTPEEIQR
           -----AE----L---F--FD----G-I-----G--L---G--------Q-
Sequence 2 MDSLDAEQLSALQKAFDSFDTDSKGFITPETVGVILRMMGVKISEKNLQE

Sequence 1 MMAEIDTDGDGFISFEEFKDFARANSGLIKDVAKIF--------------
           ---E-D-DG-G---FEEF---A----------A-----------------
Sequence 2 VISETDEDGSGELEFEEFVELAAKFLIEEDEEALKAELREAFRVYDRGGN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GYITTDVLKEILRELDNRLTEEDLDSIIEEVDEDGSGTLDFNEFMQMMNG


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.