The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Cor a 2

Sequence 12659206

Full FASTA alignment

Sequence name:
Query sequence:
MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Cor a 2AAK01235Go!131211.94.0e-57
2Cor a 2Q9AXH4Go!131208.44.4e-56
3Pru p 4.0201CAD37202Go!131194.28.4e-52
4Mal d 4Q9XF41Go!131193.11.9e-51
5Cap a 2CAD10376Go!131188.54.5e-50
6Hev b 8.0102Q9STB6Go!131188.25.3e-50
7Citr l 2.0101Q5XWE1Go!131187.58.5e-50
8Lit c 1AAL07320Go!131185.92.6e-49
9Cuc m 2AAP13533Go!131185.92.6e-49
10Gly m 3O65809Go!131185.04.9e-49
11Gly m 3O65810Go!131184.37.9e-49
12Che a 2AAL92870Go!131184.37.9e-49
13Hev b 8.0201Q9M7N0Go!131184.37.9e-49
14Pho d 2.0101Q8L5D8Go!131183.91.1e-48
15Hev b 8.0204Q9LEI8Go!131183.61.3e-48
16Lyc e 1CAD10377Go!131182.72.4e-48
17Lyc e 1AAL29690Go!131182.03.9e-48
18Phl p 12.0102O24650Go!131181.84.5e-48
19Hev b 8.0101O65812Go!131181.84.5e-48
20Ara h 5Q9SQI9Go!131181.84.5e-48
21Ory s 12.0101Q9FUD1Go!131181.17.3e-48
22Hev b 8.0203Q9M7M8Go!131180.98.6e-48
23Hev b 8.0202Q9M7M9Go!131180.98.6e-48
24Pyr c 4Q9XF38Go!131180.98.6e-48
25Sin a 4.0101ABU95412Go!131180.41.2e-47
26Api g 4Q9XF37Go!134180.41.2e-47
27Phl p 12.0101P35079Go!131180.21.4e-47
28Phl p 12.0101CAA54686Go!131180.21.4e-47
29Zea m 12.0104O22655Go!131179.52.2e-47
30Zea m 12.0103P35083Go!131179.03.1e-47
31Dau c 4AAL76933Go!134179.13.1e-47
32Phl p 12.0103O24282Go!131177.96.8e-47
33Mus a 1.0101AF377948Go!131177.21.1e-46
34Zea m 12.0101P35081Go!131177.01.3e-46
35Mal d 4Q9XF42Go!131176.51.8e-46
36Pru p 4.0101CAD37201Go!131176.51.8e-46
37Pru du 4.0102AY081852Go!131176.32.1e-46
38Pru du 4.0101AY081850Go!131176.32.1e-46
39Mal d 4Q9XF40Go!131176.12.4e-46
40Ole e 2O24169Go!134176.12.5e-46
41Ole e 2O24170Go!134176.12.5e-46
42Zea m 12.0105Q9FR39Go!131175.82.8e-46
43Cyn d 12O04725Go!131175.43.9e-46
44Ana c 1AAK54835Go!131175.14.6e-46
45Pru av 4Q9XF39Go!131174.95.4e-46
46Par j 3Q9XG85Go!132174.95.4e-46
47Mer a 1O49894Go!133174.95.4e-46
48Ole e 2O24171Go!134174.95.5e-46
49Zea m 12.0102P35082Go!131174.76.3e-46
50Bet v 2P25816Go!133173.31.7e-45
51Tri a 12.0104FM164277Go!131173.11.9e-45
52Cro s 1.0101Q5EF31Go!131172.82.3e-45
53Can s 2.0101XP030492464Go!133172.92.3e-45
54Par j 3Q9T0M8Go!131171.94.3e-45
55Tri a 12.0101P49232Go!138172.04.4e-45
56Tri a 12.0102P49233Go!141172.04.5e-45
57Cit s 2.0101P84177Go!131171.26.9e-45
58Tri a 12.0103P49234Go!140171.08.4e-45
59Hor v 12.0101P52184Go!131170.89.4e-45
60Ama r 2.0101ACP43298Go!133170.31.3e-44
61Ara t 8Q42449Go!131168.74.0e-44
62Aca f 2A0A0A0RCW1Go!133168.54.7e-44
63Sal k 4.0101ACS34771Go!133168.35.5e-44
64Sal k 4.0201ADK22841Go!133165.73.2e-43
65Art v 4.0201AJ421031Go!133161.65.5e-42
66Hel a 2O81982Go!133160.21.4e-41
67Art v 4.0101AJ421030Go!133158.64.4e-41
68Act d 9.0101FG438715Go!109154.27.9e-40

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Cor a 2, Sequence: AAK01235
Sequence identity: 100.00 (131/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
Sequence 2 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 2
Sequence 1:
Sequence 2: Allergen Cor a 2, Sequence: Q9AXH4
Sequence identity: 98.47 (129/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-YGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
Sequence 2 MSWQAYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR-KKGPGGVTVKKTSQA
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTSQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 3
Sequence 1:
Sequence 2: Allergen Pru p 4.0201, Sequence: CAD37202
Sequence identity: 87.79 (115/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEIEGN-L-AAAIIGHDGSVWAQS-TFPQLKPEE-TG-
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGHDGSVWAQSATFPQLKPEEVTGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           -NDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR-KKGPGGVTVKK---A
Sequence 2 LNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKSTLA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNMIVERLGDYL--QGL
Sequence 2 LLIGIYDEPMTPGQCNMIVERLGDYLVEQGL



Alignment 4
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF41
Sequence identity: 87.02 (114/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEIEGN-L-AAAIIGH-GSVWAQS-TFPQLKPEE-TG-
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGHNGSVWAQSATFPQLKPEEVTGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLGGTKYMVIQGEPG-VIR-KKGPGGVTVKK---A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGPGGVTVKKSTMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNM-VERLGDYLI-QGL
Sequence 2 LLIGIYDEPMTPGQCNMVVERLGDYLIEQGL



Alignment 5
Sequence 1:
Sequence 2: Allergen Cap a 2, Sequence: CAD10376
Sequence identity: 87.02 (114/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMCEIEGNRL--AAIIG-DGSVWAQS-TFPQ-KPEEIT--
Sequence 2 MSWQTYVDDHLMCEIEGNRLTSAAIIGQDGSVWAQSATFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIR-KKGPGG-TVKKT-QA
Sequence 2 MNDFAEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYLI-Q-L
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIEQSL



Alignment 6
Sequence 1:
Sequence 2: Allergen Hev b 8.0102, Sequence: Q9STB6
Sequence identity: 86.26 (113/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEIEGN-L-AAAIIG-DGSVWAQS--FPQ-K-EEITG-
Sequence 2 MSWQAYVDDHLMCEIEGNHLSAAAIIGQDGSVWAQSANFPQFKSEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGLY-GGTKYMVIQGEPGAVIR-KKGPGGVTVKKT-QA
Sequence 2 MSDFHEPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYLIDQG-
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGY



Alignment 7
Sequence 1:
Sequence 2: Allergen Citr l 2.0101, Sequence: Q5XWE1
Sequence identity: 84.73 (111/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEIEGN-L--AAIIG-DGSVWA-S--FPQLKPEEITG-
Sequence 2 MSWQAYVDDHLMCEIEGNHLTSAAIIGQDGSVWAKSENFPQLKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           -NDFNEPG-LAPTGLY-GG-KYMVIQGEPGAVIR-KKGPGGVTVKKT--A
Sequence 2 LNDFNEPGTLAPTGLYIGGSKYMVIQGEPGAVIRGKKGPGGVTVKKTALA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNMIVERLGDYLI-QGL
Sequence 2 LVIGIYDEPMTPGQCNMIVERLGDYLIEQGL



Alignment 8
Sequence 1:
Sequence 2: Allergen Lit c 1, Sequence: AAL07320
Sequence identity: 83.21 (109/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMCE--G--L-AAAIIGHDGSVWAQS--FPQ-KP-EI---
Sequence 2 MSWQTYVDDHLMCETDGQHLTAAAIIGHDGSVWAQSANFPQFKPAEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGEPGAVIR-KKGPGG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGPGGITVKKTTQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNM-VERLGDYL-DQGL
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLVDQGL



Alignment 9
Sequence 1:
Sequence 2: Allergen Cuc m 2, Sequence: AAP13533
Sequence identity: 83.97 (110/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-DEHLMCEIEGN-L--AAIIG-DGSVWAQS--FPQLKPEE--G-
Sequence 2 MSWQVYVDEHLMCEIEGNHLTSAAIIGQDGSVWAQSQNFPQLKPEEVAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGLY-GGTKYMVIQGEPGAVIR-KKGPGGVTVKKT--A
Sequence 2 VGDFADPGTLAPTGLYIGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNMIVERLGDYLIDQGL
Sequence 2 LVIGIYDEPMTPGQCNMIVERLGDYLIDQGL



Alignment 10
Sequence 1:
Sequence 2: Allergen Gly m 3, Sequence: O65809
Sequence identity: 84.73 (111/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HL-C-IEGN-L--AAIIG-DGSVWAQS--FPQ-KPEEIT--
Sequence 2 MSWQAYVDDHLLCDIEGNHLTHAAIIGQDGSVWAQSTDFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR-KKGPGGVTVKKT--A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNM-VER-GDYLIDQG-
Sequence 2 LIIGIYDEPMTPGQCNMVVERPGDYLIDQGY



Alignment 11
Sequence 1:
Sequence 2: Allergen Gly m 3, Sequence: O65810
Sequence identity: 84.73 (111/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HL-C-IEGN-L--AAIIG-DGSVW-QS--FPQ-KPEEIT--
Sequence 2 MSWQAYVDDHLLCGIEGNHLTHAAIIGQDGSVWLQSTDFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIR-KKGPGGVTVKKT--A
Sequence 2 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGPGGVTVKKTGAA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNM-VERLGDYLIDQG-
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLIDQGY



Alignment 12
Sequence 1:
Sequence 2: Allergen Che a 2, Sequence: AAL92870
Sequence identity: 80.15 (105/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC-IEGN-L--AAI-GHDG-VWAQS--FPQLKPEE----
Sequence 2 MSWQTYVDDHLMCDIEGNHLSSAAILGHDGTVWAQSPSFPQLKPEEVSAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DFNEPGSLAPTGL-LGGTKYMVIQGEPG-VIR-KKGPGGVT-KKT-QA
Sequence 2 MKDFNEPGSLAPTGLHLGGTKYMVIQGEPGDVIRGKKGPGGVTIKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIY-EPMTPGQCNM-VER-GDYL--QG-
Sequence 2 LIIGIYGEPMTPGQCNMVVERIGDYLVEQGM



Alignment 13
Sequence 1:
Sequence 2: Allergen Hev b 8.0201, Sequence: Q9M7N0
Sequence identity: 82.44 (108/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMC-I-G--L-AAAIIGHDGSVWAQSS-FPQ-KPEE----
Sequence 2 MSWQTYVDEHLMCDIDGHHLTAAAIIGHDGSVWAQSSSFPQFKPEEVAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYL--QG-
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 14
Sequence 1:
Sequence 2: Allergen Pho d 2.0101, Sequence: Q8L5D8
Sequence identity: 83.97 (110/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-DEHLMCEI-G--L-AAAI-GHDGSVWAQSS-FPQ-K-EEIT--
Sequence 2 MSWQAYVDEHLMCEIDGHHLTAAAILGHDGSVWAQSSSFPQFKSEEITNI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDFNEPGSLAPTGLYLG-TKYMVIQGEPGAVIR-KKG-GGVTVKKT-QA
Sequence 2 MNDFNEPGSLAPTGLYLGSTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LI-GIY-EPMTPGQCNM-VERLGDYLI-QG-
Sequence 2 LIFGIYEEPMTPGQCNMVVERLGDYLIEQGM



Alignment 15
Sequence 1:
Sequence 2: Allergen Hev b 8.0204, Sequence: Q9LEI8
Sequence identity: 83.21 (109/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC-I-G-RL-AAAIIGHDGSVWAQSS-FPQ-K--E---V
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAV

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYL-DQGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLDQGL



Alignment 16
Sequence 1:
Sequence 2: Allergen Lyc e 1, Sequence: CAD10377
Sequence identity: 83.21 (109/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHL-CE-EGN-L--AAIIG-DG-VWAQS--FPQ-KPEEITG-
Sequence 2 MSWQTYVDEHLLCENEGNHLTSAAIIGQDGTVWAQSANFPQFKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDF--PG-LAPTGLYLGGTKYMVIQGEP-AVIR-KKGPGG-T-KKT-QA
Sequence 2 MNDFAVPGTLAPTGLYLGGTKYMVIQGEPEAVIRGKKGPGGITIKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYLI-Q-L
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLIEQSL



Alignment 17
Sequence 1:
Sequence 2: Allergen Lyc e 1, Sequence: AAL29690
Sequence identity: 83.21 (109/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC-IEGN-L--AAIIG-DGSVWAQS--FPQ-KPEEIT--
Sequence 2 MSWQTYVDDHLMCDIEGNHLTSAAIIGQDGSVWAQSANFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-TVKKT-QA
Sequence 2 MNDFAEPGTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGAGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDY-I-QGL
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYIIEQGL



Alignment 18
Sequence 1:
Sequence 2: Allergen Phl p 12.0102, Sequence: O24650
Sequence identity: 77.86 (102/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--LA-AAI-GHDG-VWAQS--FPQ-KPEEITG-
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTG----G-KYMVIQGEPGAVIR-KKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 19
Sequence 1:
Sequence 2: Allergen Hev b 8.0101, Sequence: O65812
Sequence identity: 83.97 (110/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DE-LMCEIEGN-L-AAAIIG-DGSVWAQSS-FPQ-K-EEIT--
Sequence 2 MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKGPGGVTV-KT-QA
Sequence 2 MSDFDEPGTLAPTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNMIVERLGDYL--QG-
Sequence 2 LIIGIYDEPMTPGQCNMIVERLGDYLLEQGM



Alignment 20
Sequence 1:
Sequence 2: Allergen Ara h 5, Sequence: Q9SQI9
Sequence identity: 82.44 (108/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HL-CEIEG--L--AAI-G-DG-VWAQSS-FPQ-KPEEIT--
Sequence 2 MSWQTYVDNHLLCEIEGDHLSSAAILGQDGGVWAQSSHFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDF-EPGSLAPTGLYLGGTKYMVIQGEPGA-I--KKGPGGVT--KT-QA
Sequence 2 MNDFAEPGSLAPTGLYLGGTKYMVIQGEPGAIIPGKKGPGGVTIEKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYD-PMTPGQCNMIVERLGDYLID-GL
Sequence 2 LIIGIYDKPMTPGQCNMIVERLGDYLIDTGL



Alignment 21
Sequence 1:
Sequence 2: Allergen Ory s 12.0101, Sequence: Q9FUD1
Sequence identity: 79.39 (104/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--L--AAI-GHDG-VWAQS--FPQ-KPEE-T--
Sequence 2 MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGTVWAQSAAFPQFKPEEMTNI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QGL
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGL



Alignment 22
Sequence 1:
Sequence 2: Allergen Hev b 8.0203, Sequence: Q9M7M8
Sequence identity: 81.68 (107/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC-I-G-RL-AAAIIGHDGSVWAQSS-FPQ-K--E---V
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSGFPQFKSDEVAAV

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYL--QG-
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 23
Sequence 1:
Sequence 2: Allergen Hev b 8.0202, Sequence: Q9M7M9
Sequence identity: 80.92 (106/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC-I-G-RL-AAAIIGHDGSVWAQSS-FPQ-K--E----
Sequence 2 MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LG-TKYMVIQGEPGAVIR-KKG-GG-TVKKTSQA
Sequence 2 MKDFDEPGSLAPTGLHLGSTKYMVIQGEPGAVIRGKKGSGGITVKKTSQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYL--QG-
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLLEQGM



Alignment 24
Sequence 1:
Sequence 2: Allergen Pyr c 4, Sequence: Q9XF38
Sequence identity: 82.44 (108/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-G--L-AAAI-GHDGSVWAQSSTFP--KPEEIT--
Sequence 2 MSWQAYVDDHLMCDIDGHHLTAAAILGHDGSVWAQSSTFPKFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GGVTVKKTSQA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTSQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIY-EP-TPGQCNMIVERLGDYLIDQGL
Sequence 2 LVFGIYEEPLTPGQCNMIVERLGDYLIDQGL



Alignment 25
Sequence 1:
Sequence 2: Allergen Sin a 4.0101, Sequence: ABU95412
Sequence identity: 79.39 (104/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMC--EGNRL-AAAI-G-DGSVWAQS--FPQLKPEEI-G-
Sequence 2 MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           -NDF-EPG-LAPTGL--GGTKYMVIQGEP-AVIR-KKG-GGVT-KKT-QA
Sequence 2 NNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           ---GIY-EPMTPGQCNM-VERLGDYLI-QGL
Sequence 2 FVFGIYEEPMTPGQCNMVVERLGDYLIEQGL



Alignment 26
Sequence 1:
Sequence 2: Allergen Api g 4, Sequence: Q9XF37
Sequence identity: 82.44 (108/131)
Sequence 1 MSWQTYGDEHLMCEIEGN---RLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQ-Y-D-HLMCE-EGN----L-AAAIIGHDGSVWAQSSTFPQ-KPEEI
Sequence 2 MSWQAYVDDHLMCEVEGNPGQTLTAAAIIGHDGSVWAQSSTFPQIKPEEI

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           -G-M-DF-EPG-LAPTGLYLGG-KYMVIQGEP-AVIR-KKG-GGVT-KKT
Sequence 2 AGIMKDFDEPGHLAPTGLYLGGAKYMVIQGEPNAVIRGKKGSGGVTIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--G-YDEP-TPGQCN-IVERLGDYLIDQGL
Sequence 2 GQALVFGVYDEPVTPGQCNVIVERLGDYLIDQGL



Alignment 27
Sequence 1:
Sequence 2: Allergen Phl p 12.0101, Sequence: P35079
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--LA-AAI-GHDG-VWAQS--FPQ-KPEEITG-
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTG----G-KYMVIQGEPG-VIR-KKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 28
Sequence 1:
Sequence 2: Allergen Phl p 12.0101, Sequence: CAA54686
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--LA-AAI-GHDG-VWAQS--FPQ-KPEEITG-
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTG----G-KYMVIQGEPG-VIR-KKG-GG-T-KKT-QA
Sequence 2 MKDFDEPGHLAPTGMFVAGAKYMVIQGEPGRVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 29
Sequence 1:
Sequence 2: Allergen Zea m 12.0104, Sequence: O22655
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-DEHLMCEIEG--L-AAAI-GHDGSVWAQS--FP-LKPEE--G-
Sequence 2 MSWQAYVDEHLMCEIEGQHLSAAAIVGHDGSVWAQSESFPELKPEEVAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL--GGTKYMVIQGEPG-VIR-KKG-GG-T-KKT---
Sequence 2 IKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMS

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIG-YDEPMTPGQCNM-VERLGDYLI-QG-
Sequence 2 LIIGVYDEPMTPGQCNMVVERLGDYLIEQGF



Alignment 30
Sequence 1:
Sequence 2: Allergen Zea m 12.0103, Sequence: P35083
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--L--AAI-GHDG-VWAQS--FPQ-KPEE-T--
Sequence 2 MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAP-GL-LG-TKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 IKDFDEPGFLAPIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNM-VERLGDYL--QGL
Sequence 2 LVIGIYDEPMTPGQCNMVVERLGDYLVEQGL



Alignment 31
Sequence 1:
Sequence 2: Allergen Dau c 4, Sequence: AAL76933
Sequence identity: 81.68 (107/131)
Sequence 1 MSWQTYGDEHLMCEIEGN---RLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQTY-D-HLMCE--GN----L-AAAIIGHDGSVWAQSSTFP--KPEEI
Sequence 2 MSWQTYVDDHLMCEVDGNPGQQLSAAAIIGHDGSVWAQSSTFPKFKPEEI

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           TG-M--F-EPG-LAPTGLYLGGTKYMVIQGEP-AVIR-KKG-GGVT-KKT
Sequence 2 TGIMKNFDEPGHLAPTGLYLGGTKYMVIQGEPIAVIRGKKGSGGVTIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--G-YDEP-TPGQCN-IVERLGDYLI-QGL
Sequence 2 GQALVFGVYDEPVTPGQCNLIVERLGDYLIEQGL



Alignment 32
Sequence 1:
Sequence 2: Allergen Phl p 12.0103, Sequence: O24282
Sequence identity: 76.34 (100/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--LA-AAI-GHDG-VWAQS--FPQ-KPEEITG-
Sequence 2 MSWQTYVDEHLMCEIEGHHLASAAIFGHDGTVWAQSADFPQFKPEEITGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-D--EPG-LAPTG------KYMVIQGEPGAVIR-KKG-GG-T-KKT-QA
Sequence 2 MKDLDEPGHLAPTGMFVAAAKYMVIQGEPGAVIRGKKGAGGITIKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLVEQGM



Alignment 33
Sequence 1:
Sequence 2: Allergen Mus a 1.0101, Sequence: AF377948
Sequence identity: 79.39 (104/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HL-C-I-G--L-AAAI-GHDGSVWAQS--FPQ-KPEEI---
Sequence 2 MSWQAYVDDHLLCDIDGQCLTAAAIVGHDGSVWAQSDAFPQCKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGLYLGGTKYMVIQGEPGAVIR-KKG-GGVT-KKT--A
Sequence 2 MKDFDEPGSLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGVTIKKTNLA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIY-EPMTPGQCNM-VERLGDYL-DQG-
Sequence 2 LIIGIYNEPMTPGQCNMVVERLGDYLFDQGF



Alignment 34
Sequence 1:
Sequence 2: Allergen Zea m 12.0101, Sequence: P35081
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMCEIEG--L--AAI-GHDG--WAQS--FP--KPEE----
Sequence 2 MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG-TVKKT-Q-
Sequence 2 MKDFDEPGHLAPTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQS

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCN--VERLGDYL--QG-
Sequence 2 LIIGIYDEPMTPGQCNLVVERLGDYLLEQGM



Alignment 35
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF42
Sequence identity: 76.34 (100/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS--FP--KPEEI---
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSASFPAFKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG-T-KKTSQA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTSQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEP-TPGQCN--VERLGDYLI-QGL
Sequence 2 LLIGIYDEPVTPGQCNIVVERLGDYLIEQGL



Alignment 36
Sequence 1:
Sequence 2: Allergen Pru p 4.0101, Sequence: CAD37201
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS-TFP--KPEEI---
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-TVKKT-QA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYLI-QGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 37
Sequence 1:
Sequence 2: Allergen Pru du 4.0102, Sequence: AY081852
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS-TFP--KPEEI---
Sequence 2 MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-TVKKT-QA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYLI-QGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 38
Sequence 1:
Sequence 2: Allergen Pru du 4.0101, Sequence: AY081850
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS-TFP--KPEEI---
Sequence 2 MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-TVKKT-QA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYLI-QGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 39
Sequence 1:
Sequence 2: Allergen Mal d 4, Sequence: Q9XF40
Sequence identity: 80.15 (105/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D--LMC-I-G--L-AAAI-GHDGSVWA-SSTFP--KPEEIT--
Sequence 2 MSWQAYVDDRLMCDIDGHHLTAAAILGHDGSVWAHSSTFPKFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPGSLAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GGVTVKKT-QA
Sequence 2 MKDFDEPGSLAPTGLHLGGTKYMVIQGEGGAVIRGKKGSGGVTVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIY-EP-TPGQCNMIVERLGDYLIDQGL
Sequence 2 LVFGIYEEPLTPGQCNMIVERLGDYLIDQGL



Alignment 40
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24169
Sequence identity: 77.86 (102/131)
Sequence 1 MSWQTYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQ-Y-D-HLMC-IEG----RL-AAAI-GHDGSVWAQS-TFPQ-KPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEDHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           -G-M-DFNEPG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--GIY-EP-TPGQCNM-VERLGDYL--QG-
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLVEQGM



Alignment 41
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24170
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQ-Y-D-HLMC-IEG----RL-AAAI-GHDGSVWAQS-TFPQ-KPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           -G-M-DFNEPG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--GIY-EP-TPGQCNM-VERLGDYL--QGL
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL



Alignment 42
Sequence 1:
Sequence 2: Allergen Zea m 12.0105, Sequence: Q9FR39
Sequence identity: 75.57 (99/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HL-C-IEG--L-AAAI-GHDGSVWAQS--FP-LKPEE--G-
Sequence 2 MSWQAYVDDHLLCDIEGQHLSAAAIVGHDGSVWAQSENFPELKPEEVAGM

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL--GGTKYMVIQGEPG-VIR-KKG-GG-T-KKT---
Sequence 2 IKDFDEPGTLAPTGLFVGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMS

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEPMTPGQCNM-VERLGDYLI-QG-
Sequence 2 LIIGIYDEPMTPGQCNMVVERLGDYLIEQGF



Alignment 43
Sequence 1:
Sequence 2: Allergen Cyn d 12, Sequence: O04725
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEIEG--L--AAIIGHDG-VWAQS--FP--KPEE----
Sequence 2 MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGEPGAVIR-KKG-GGVTVKKT-QA
Sequence 2 MKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L-IGIYDEPMTPGQCNM--E-LGDYLI-QG-
Sequence 2 LVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM



Alignment 44
Sequence 1:
Sequence 2: Allergen Ana c 1, Sequence: AAK54835
Sequence identity: 76.34 (100/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMCEI-G--L--AAI-GHD--VWAQS--FPQ-KPEEI---
Sequence 2 MSWQAYVDDHLMCEIDGQHLSSAAILGHDSTVWAQSPNFPQFKPEEISAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           -NDF--PGSLAPTGLYLGGTKYMVIQGEPG-VIR-KKG-GG-TVKKT--A
Sequence 2 LNDFENPGSLAPTGLYLGGTKYMVIQGEPGVVIRGKKGTGGITVKKTNLA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIG-YDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LIIGVYDEPMTPGQCNMVVERLGDYLLEQGF



Alignment 45
Sequence 1:
Sequence 2: Allergen Pru av 4, Sequence: Q9XF39
Sequence identity: 77.86 (102/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS-TFP--KPEEI---
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --D---PG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-TVKKT-QA
Sequence 2 LKDLDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYLI-QGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 46
Sequence 1:
Sequence 2: Allergen Par j 3, Sequence: Q9XG85
Sequence identity: 78.63 (103/131)
Sequence 1 MSWQTYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITG
           MSWQ-Y-D-HLMC----GN--A-AAIIGHDGSVWAQS--FPQLKPEE-TG
Sequence 2 MSWQAYVDDHLMCDVGDGNTPASAAIIGHDGSVWAQSANFPQLKPEEVTG

Sequence 1 VMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQ
           -MNDFNE-G-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-T-KKT-Q
Sequence 2 IMNDFNEAGFLAPTGLFLGGTKYMVIQGESGAVIRGKKGSGGATLKKTGQ

Sequence 1 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           A--IGIYDEPMTPGQCN--VERLGDYL--QGL
Sequence 2 AIVIGIYDEPMTPGQCNLVVERLGDYLLEQGL



Alignment 47
Sequence 1:
Sequence 2: Allergen Mer a 1, Sequence: O49894
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQTY-D-HLMC-I-G----LAAA-I-GHDGS-WAQS--FPQLKPEEIT
Sequence 2 MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEIT

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           G-M-DF-EPG-LAPTGLY--GTKYMVIQGE-GAVIR-KKG-GG-T-KKT-
Sequence 2 GIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QAL--GIY-EP-TPGQCNM-VERLGDYLI-QG-
Sequence 2 QALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM



Alignment 48
Sequence 1:
Sequence 2: Allergen Ole e 2, Sequence: O24171
Sequence identity: 77.86 (102/131)
Sequence 1 MSWQTYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQ-Y-D-HLMC-IEG----RL-AAAI-GHDGSVWAQS-TFPQ-KPEE-
Sequence 2 MSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEM

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           -G-M-DFNEPG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG-T-KKT
Sequence 2 NGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--GIY-EP-TPGQCNM--ERLGDYL--QGL
Sequence 2 GQALVFGIYEEPVTPGQCNMVAERLGDYLLEQGL



Alignment 49
Sequence 1:
Sequence 2: Allergen Zea m 12.0102, Sequence: P35082
Sequence identity: 75.57 (99/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-DEHLMCEIEG--LAAAAI-GHDG--WAQS--FP--K-E-----
Sequence 2 MSWQAYVDEHLMCEIEGHHLAAAAIVGHDGAAWAQSTAFPEFKTEDMANI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           M-DF-EPG-LAPTGL-LG-TKYMVIQGEPGAVIR-KKG-GG-TVKKT-QA
Sequence 2 MKDFDEPGHLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--GIYDEPMTPGQCNM-VERLGDYL--QG-
Sequence 2 LVVGIYDEPMTPGQCNMVVERLGDYLLEQGM



Alignment 50
Sequence 1:
Sequence 2: Allergen Bet v 2, Sequence: P25816
Sequence identity: 79.39 (104/131)
Sequence 1 MSWQTYGDEHLMCEIEG---NRLAAAAIIGHDGSVWAQSSTFPQLKPEEI
           MSWQTY-DEHLMC-I-G---N-LA-A-I-GHDGSVWAQSS-FPQ-KP-EI
Sequence 2 MSWQTYVDEHLMCDIDGQASNSLASA-IVGHDGSVWAQSSSFPQFKPQEI

Sequence 1 TGVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKT
           TG-M-DF-EPG-LAPTGL-LGG-KYMVIQGE-GAVIR-KKG-GG-T-KKT
Sequence 2 TGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKT

Sequence 1 SQALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           -QAL--GIY-EP-TPGQCNM-VERLGDYLIDQGL
Sequence 2 GQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL



Alignment 51
Sequence 1:
Sequence 2: Allergen Tri a 12.0104, Sequence: FM164277
Sequence identity: 75.57 (99/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSW--Y-D-HL-CEI-G--L--AAI-GHDGSVWAQS--FPQ-KPEEI-G-
Sequence 2 MSWKAYVDDHLCCEIDGQHLTSAAILGHDGSVWAQSPNFPQFKPEEIAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGEPG-VIR-KKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LI-GIYDEPMTPGQCN--VERLGDYLIDQG-
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGY



Alignment 52
Sequence 1:
Sequence 2: Allergen Cro s 1.0101, Sequence: Q5EF31
Sequence identity: 74.81 (98/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-DEHLMC---G--L--AAI-GHDGSVWAQS--FP-LKP-EIT--
Sequence 2 MSWQTYVDEHLMCDMDGHVLTSAAILGHDGSVWAQSAGFPELKPAEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           -NDFNEPGSLAPTG-Y--G-KYMVIQGEPG-VIR-KKG-GGVT-KK---A
Sequence 2 LNDFNEPGSLAPTGMYINGAKYMVIQGEPGVVIRGKKGSGGVTIKKSNMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LI-G-YDEPMTPGQCN--VERLGDYLI-QG-
Sequence 2 LIFGLYDEPMTPGQCNLVVERLGDYLIEQGY



Alignment 53
Sequence 1:
Sequence 2: Allergen Can s 2.0101, Sequence: XP030492464
Sequence identity: 79.39 (104/131)
Sequence 1 MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQTY-DEHLMC-I-G----L-AAAIIGHDGS-WAQSS-FPQLK--EIT
Sequence 2 MSWQTYVDEHLMCDIDGQGQHLTAAAIIGHDGSIWAQSSSFPQLKAQEIT

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           ----DF-EPG-LAPTGL-L-GTKYMVIQGEPGAVIR-KKG-GGVT-KKT-
Sequence 2 DITKDFEEPGHLAPTGLHLSGTKYMVIQGEPGAVIRGKKGSGGVTIKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QALI-GIY-EP-TPGQCNM-VERLGDYL-DQGL
Sequence 2 QALIFGIYEEPVTPGQCNMVVERLGDYLVDQGL



Alignment 54
Sequence 1:
Sequence 2: Allergen Par j 3, Sequence: Q9T0M8
Sequence identity: 77.86 (102/131)
Sequence 1 MSWQTYGDEHLMCEI-EGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITG
           MSWQ-Y-D-HLMC----GN-LA-AAIIGHDGSVWAQS--FPQLKPEE-TG
Sequence 2 MSWQAYVDDHLMCDVGDGNTLASAAIIGHDGSVWAQSANFPQLKPEEVTG

Sequence 1 VMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQ
           -MNDFNE-G-LAPTGL-LGGTKYMVIQGE-GAVI--KKG-GG-T-KKT-Q
Sequence 2 IMNDFNEGGFLAPTGLFLGGTKYMVIQGESGAVIG-KKGSGGATLKKTGQ

Sequence 1 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           A--IGIYDEPMTPGQCN--VERLGDYL--QG-
Sequence 2 AIVIGIYDEPMTPGQCNLVVERLGDYLLEQGM



Alignment 55
Sequence 1:
Sequence 2: Allergen Tri a 12.0101, Sequence: P49232
Sequence identity: 74.81 (98/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HL-CEI-G--L--AAI-GHDGSVW--S--FP--KPEEI-G-
Sequence 2 MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGEPG-VIR-KKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL-------
           LI-GIYDEPMTPGQCN--VERLGDYLIDQG--------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYWVPSSNS



Alignment 56
Sequence 1:
Sequence 2: Allergen Tri a 12.0102, Sequence: P49233
Sequence identity: 74.81 (98/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HL-CEI-G--L--AAI-GHDGSVWA-S--FP--KPEEI-G-
Sequence 2 MSWQAYVDDHLCCEIDGQHLTSAAILGHDGSVWAESPNFPKFKPEEIAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGEPG-VIR-KKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL----------
           LI-GIYDEPMTPGQCN--VERLGDYLIDQG-----------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYYVGSHHHHHH



Alignment 57
Sequence 1:
Sequence 2: Allergen Cit s 2.0101, Sequence: P84177
Sequence identity: 76.34 (100/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC-I-GNRL-AAAI-G-DGSVW-QS-TFP----EEI---
Sequence 2 MSWQAYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFRLEEIAAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF--PG-LAPTGL-LGGTKYMVIQGE-GAVIR-KKG-GG--VKKT-QA
Sequence 2 LKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGIIVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP-TPGQCNMIVERLGDYLI-QGL
Sequence 2 LIIGIYDEPLTPGQCNMIVERLGDYLIEQGL



Alignment 58
Sequence 1:
Sequence 2: Allergen Tri a 12.0103, Sequence: P49234
Sequence identity: 74.81 (98/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSW--Y-D-HL-CEI-G--L--AAI-GHDGSVWAQS--FPQ-KPEE--G-
Sequence 2 MSWKAYVDDHLCCEIDGQNLTSAAILGHDGSVWAQSPNFPQFKPEENAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGEPG-VIR-KKG-GG-T-KKT--A
Sequence 2 VKDFEEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL---------
           LI-GIYDEPMTPGQCN--VERLGDYLIDQG----------
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLIDQGYCGSHHHHHH



Alignment 59
Sequence 1:
Sequence 2: Allergen Hor v 12.0101, Sequence: P52184
Sequence identity: 73.28 (96/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HL-CEI-G--L--AAI-GHDG-VW-QS--FPQ-KPEEI-G-
Sequence 2 MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGGTKYMVIQGEPG-VIR-KKG-GG-T-KKT---
Sequence 2 IKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMP

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LI-GIYDEPMTPGQCN--VERLGDYL--QG-
Sequence 2 LILGIYDEPMTPGQCNLVVERLGDYLVEQGF



Alignment 60
Sequence 1:
Sequence 2: Allergen Ama r 2.0101, Sequence: ACP43298
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQ-Y-D-HLMCEIEG--N-L--AAI-G-DGSVWAQS--FPQ-KP-EI-
Sequence 2 MSWQAYVDDHLMCEIEGTTNHLTGAAILGLDGSVWAQSADFPQFKPDEIA

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           ----DF-EPG-LAPTGL-LGGTKYMVIQGEPGAVIR-KKG-GG--VKKT-
Sequence 2 AIVEDFDEPGTLAPTGLHLGGTKYMVIQGEPGAVIRGKKGAGGICVKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QAL--GIYDEP-TPGQCNMIVERLGDYLI-QG-
Sequence 2 QALVMGIYDEPVTPGQCNMIVERLGDYLIEQGY



Alignment 61
Sequence 1:
Sequence 2: Allergen Ara t 8, Sequence: Q42449
Sequence identity: 74.81 (98/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQ-Y-D-HLMC--EGN-L-AAAI-G-DGSVWAQS--FPQLKP-EI-G-
Sequence 2 MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           --DF-EPG-LAPTGL-LGG-KYMVIQGE-GAVIR-KKGPGGVT-KKT-QA
Sequence 2 KKDFEEPGFLAPTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           L--G-YDEPMT-GQCN--VERLGDYLI---L
Sequence 2 LVFGFYDEPMTGGQCNLVVERLGDYLIESEL



Alignment 62
Sequence 1:
Sequence 2: Allergen Aca f 2, Sequence: A0A0A0RCW1
Sequence identity: 75.57 (99/131)
Sequence 1 MSWQTYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           M-WQTY-D-HLMCEIEG--N-L--AAI-G-DGSVWAQS--FPQ-KP-EI-
Sequence 2 MCWQTYVDDHLMCEIEGTNNHLSGAAILGVDGSVWAQSASFPQFKPDEIA

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           -V--DF--PG-LAPTGL-LGGTKYMVIQGEPG--IR-KKGPGG--VKKT-
Sequence 2 AVVKDFDGPGTLAPTGLHLGGTKYMVIQGEPGRFIRGKKGPGGICVKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QAL--GIYDEP-TPGQCNMIVERLGDYL--QG-
Sequence 2 QALVFGIYDEPVTPGQCNMIVERLGDYLVEQGM



Alignment 63
Sequence 1:
Sequence 2: Allergen Sal k 4.0101, Sequence: ACS34771
Sequence identity: 77.10 (101/131)
Sequence 1 MSWQTYGDEHLMCEIEG--NRLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQTY-D-HLMCEIEG--N-L-AAAI-G-DGSVWAQS--FPQ-KP-EI-
Sequence 2 MSWQTYVDDHLMCEIEGTNNHLTAAAILGVDGSVWAQSANFPQFKPDEIS

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           -V---F-E-G-LAPTGL-LGGTKYMVIQGE-G-VIR-KKGPGG--VKKT-
Sequence 2 AVVKEFDEAGTLAPTGLHLGGTKYMVIQGEAGQVIRGKKGPGGICVKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QALI-GIYDEP-TPGQCNMIVERLGDYL--QG-
Sequence 2 QALIFGIYDEPVTPGQCNMIVERLGDYLVEQGM



Alignment 64
Sequence 1:
Sequence 2: Allergen Sal k 4.0201, Sequence: ADK22841
Sequence identity: 74.05 (97/131)
Sequence 1 MSWQTYGDEHLMCEIE--GNRLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQ-Y-DEHLMC-IE--GN-L---AI-G-DGS-WAQSS-FPQ-KP-EI-
Sequence 2 MSWQAYVDEHLMCNIEDTGNHLTSSAIVGVDGSIWAQSSNFPQVKPQEIE

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           -----F--P--LAPTGL-LGG-KYMVIQGEPGAVIR-KKGPGGV--KKT-
Sequence 2 AINKEFDGPNTLAPTGLFLGGEKYMVIQGEPGAVIRGKKGPGGVCIKKTT

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QALI-GIYDEP--PGQCNM-VERLGDYLI-QGL
Sequence 2 QALIFGIYDEPVAPGQCNMVVERLGDYLIEQGL



Alignment 65
Sequence 1:
Sequence 2: Allergen Art v 4.0201, Sequence: AJ421031
Sequence identity: 70.23 (92/131)
Sequence 1 MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQTY-D-HLMC-IEG----L-AAAI-G-DG-VWA-S--FP--KPEE--
Sequence 2 MSWQTYVDDHLMCDIEGTGQHLTAAAILGLDGTVWAKSDKFPEFKPEEMK

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           G--N-FNE-G-LAPTGL-LGG-KYMV-QGE-GAVIR-KKG-GG---KKT-
Sequence 2 GIINEFNEVGTLAPTGLFLGGAKYMVLQGEAGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QA---GIYDEP--PGQCNMIVERLGDYL-DQ--
Sequence 2 QAMVMGIYDEPVAPGQCNMIVERLGDYLVDQNM



Alignment 66
Sequence 1:
Sequence 2: Allergen Hel a 2, Sequence: O81982
Sequence identity: 67.94 (89/131)
Sequence 1 MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQ-Y-DEHLMC-IEG----L--AAI-G-DG-VWAQS--FPQ-KPEE--
Sequence 2 MSWQAYVDEHLMCDIEGTGQHLTSAAILGLDGTVWAQSAKFPQFKPEEMK

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           G----F-E-G-LAPTG----G-KYMV-QGEPGAVIR-KKG-GG---KKT-
Sequence 2 GIIKEFDEAGTLAPTGMFIAGAKYMVLQGEPGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QA-I-GIYDEP--PGQCNM-VERLGDYL--QG-
Sequence 2 QAMIMGIYDEPVAPGQCNMVVERLGDYLLEQGM



Alignment 67
Sequence 1:
Sequence 2: Allergen Art v 4.0101, Sequence: AJ421030
Sequence identity: 68.70 (90/131)
Sequence 1 MSWQTYGDEHLMCEIEGN--RLAAAAIIGHDGSVWAQSSTFPQLKPEEIT
           MSWQTY-D-HLMC-IEG----L--AAI-G-DG-VWA-S--FP--KP-EI-
Sequence 2 MSWQTYVDDHLMCDIEGTGQHLTSAAIFGTDGTVWAKSASFPEFKPNEID

Sequence 1 GVMNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTS
           -----FNE-G-LAPTGL-LGG-KYMVIQGE-GAVIR-KKG-GG---KKT-
Sequence 2 AIIKEFNEAGQLAPTGLFLGGAKYMVIQGEAGAVIRGKKGAGGICIKKTG

Sequence 1 QALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           QA---GIYDEP--PGQCNM-VERLGDYL-DQG-
Sequence 2 QAMVFGIYDEPVAPGQCNMVVERLGDYLLDQGM



Alignment 68
Sequence 1:
Sequence 2: Allergen Act d 9.0101, Sequence: FG438715
Sequence identity: 70.23 (92/131)
Sequence 1 MSWQTYGDEHLMCEIEGNRLAAAAIIGHDGSVWAQSSTFPQLKPEEITGV
           MSWQTY-D-HLMCEIEGN-L--AAIIG-DGS-WAQS--FPQ-KPEEIT--
Sequence 2 MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAI

Sequence 1 MNDFNEPGSLAPTGLYLGGTKYMVIQGEPGAVIRRKKGPGGVTVKKTSQA
           MNDF-EPG-LAPTGLYLGGTKYMVIQGE-GAVIR-KKGPGGVTVKKT-QA
Sequence 2 MNDFSEPGTLAPTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQA

Sequence 1 LIIGIYDEPMTPGQCNMIVERLGDYLIDQGL
           LIIGIYDEP----------------------
Sequence 2 LIIGIYDEP----------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.