The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ory s TAI

Sequence 2827316

Full FASTA alignment

Sequence name:
Query sequence:
MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG
GIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGGVCY
WLARSGY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ory s TAIAAB99797Go!157215.26.7e-58
2Ory s TAIBAA07713Go!160156.24.0e-40
3Ory s TAIBAA01996Go!157145.66.1e-37
4Ory s TAIBAA02000Go!166125.86.0e-31
5Ory s TAIBAA07710Go!166125.09.9e-31
6Ory s TAIBAA01998Go!165123.23.5e-30
7Ory s TAIBAA07712Go!157118.11.2e-28
8Ory s TAIBAA07711Go!160113.92.2e-27
9Ory s TAIBAA01997Go!162110.62.1e-26
10Ory s TAIBAA07772Go!11185.65.0e-19
11Ory s TAIBAA07774Go!11382.73.8e-18
12Ory s TAIBAA07773Go!10982.44.3e-18
13Ory s TAIBAA01999Go!9562.53.8e-12
14Hor v 15.0101P16968Go!14661.71.0e-11
15Hor v 1P16968Go!14661.71.0e-11
16Tri a 15.0101CBA13560Go!12154.61.1e-09
17Tri a TAIP01083Go!12349.53.9e-08
18Hor v 1CAA08836Go!15249.74.3e-08
19Tri a TAIP01085Go!12440.81.7e-05
20Tri a 28.0101CAI84642Go!11939.15.1e-05
21Tri a TAIP01084Go!12439.05.9e-05

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: AAB99797
Sequence identity: 100.00 (157/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM

Sequence 1 YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG
           YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG
Sequence 2 YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG

Sequence 1 GIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGGVCY
           GIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGGVCY
Sequence 2 GIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGGVCY

Sequence 1 WLARSGY
           WLARSGY
Sequence 2 WLARSGY



Alignment 2
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07713
Sequence identity: 77.71 (122/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTP-PLCQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPRR-RAVPGDCCRQFPPVDYSWCRCEAISHM
           YPL-R----------GR--------V--DCCRQ---VD-SWCRCEAISHM
Sequence 2 YPLPRCRALVKRQCVGRGTAAAAEQVRRDCCRQLAAVDDSWCRCEAISHM

Sequence 1 LGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGG
           LGGIYRELGAPDVGHPMSEVFRGCRRG----A----P----VDIPNGGGG
Sequence 2 LGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGG

Sequence 1 VCYWLARSGY
           VCYWLARSGY
Sequence 2 VCYWLARSGY



Alignment 3
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01996
Sequence identity: 75.16 (118/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYT----CQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRAR-CQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHML
           Y-L-R----------G-A------V--DCCRQ---VD-SWCRCEAISHML
Sequence 2 YSLPRCRALVKRQCRGSAAAAEQ-VRRDCCRQLAAVDDSWCRCEAISHML

Sequence 1 GGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGV
           GGIYRELGAPDVGHPMSEVFRGCRRG----A----P----VDIPNGGGGV
Sequence 2 GGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGGGGV

Sequence 1 CYWLARSGY
           CYWLARSGY
Sequence 2 CYWLARSGY



Alignment 4
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA02000
Sequence identity: 63.06 (99/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFS-LLL--VSVLAATATMA--HH-DQVVY--G--CQPGMGYPM
Sequence 2 MASNKVVFSALLLIIVSVLAATATMAD-HHKDQVVYSLGERCQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPR---RRAVPGDCCRQFPPVDYSWCRCEAIS
           Y-L-R---V------G---P----------DCCRQ---VD-SWCRC-A--
Sequence 2 YSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALN

Sequence 1 HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGG
           HM-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-
Sequence 2 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT

Sequence 1 GGVCYWLARSGY-----
           GGVCYWL----------
Sequence 2 GGVCYWLGYPRTPRTGH



Alignment 5
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07710
Sequence identity: 62.42 (98/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFS-LLL--VSVLAAT--MA--HH-DQVVY--G--CQPGMGYPM
Sequence 2 MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPRRRA---VPGDCCRQFPPVDYSWCRCEAIS
           Y-L-R---V--------A-P--R-------DCCRQ---VD-SWCRC-A--
Sequence 2 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN

Sequence 1 HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGG
           HM-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-
Sequence 2 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT

Sequence 1 GGVCYWLARSGY-----
           GGVCYWL----------
Sequence 2 GGVCYWLGYPRTPRTGH



Alignment 6
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01998
Sequence identity: 61.15 (96/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVVFS-LLL--VSVLAAT--MA--HH-DQVVY--G--CQPGMGYPM
Sequence 2 MASNKVVFSALLLIIVSVLAATTRMAD-HHKDQVVYSLGERCQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPR--RRAVPGDCCRQFPPVDYSWCRCEAISH
           Y-L-R---V------G---P---------DCCR----VD-SWCRC-A--H
Sequence 2 YSLPRCRAVVKRQCVGTRSPGAVDEQLAQDCCRELAAVDDSWCRCSALNH

Sequence 1 MLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG
           M-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-G
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLARSGY-----
           GVCYWL----------
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 7
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07712
Sequence identity: 62.42 (98/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           MASNKVV---LL--VVSVLAAT-TMA--HHQ-QVVYTPG-LCQPG-GYP-
Sequence 2 MASNKVVIPALLVVVVSVLAATTTMAD-HHQEQVVYTPGQLCQPGIGYPT

Sequence 1 YPLRVAGVGEAPLLGRARPRRRAV-PGD--------CCRQFPPVDYSWCR
           YPL--------P---RA---R--V-PG---------CCRQ----D-SWCR
Sequence 2 YPL--------PRC-RAFVKRQCVAPGTLDEQVRRGCCRQLAGIDSSWCR

Sequence 1 CEAISHMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVD
           C-A--HML--IYRE--A-D-GHPM-EVFRGCRRG----A----P----VD
Sequence 2 CDALNHMLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVD

Sequence 1 IPNGGGGVCYWLARSGY
           IPNG-GGVCYWL---GY
Sequence 2 IPNGVGGVCYWLPGTGY



Alignment 8
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07711
Sequence identity: 56.05 (88/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           ----------LLL--VSVLAAT--MA--HH-DQVVY--G--CQPGMGYPM
Sequence 2 -------GTRLLLIIVSVLAATRRMAD-HHKDQVVYSLGERCQPGMGYPM

Sequence 1 YPL-RVAGVGEAPLLGRARPR---RRAVPGDCCRQFPPVDYSWCRCEAIS
           Y-L-R---V------G---P----------DCCRQ---VD-SWCRC-A--
Sequence 2 YSLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALN

Sequence 1 HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGG
           HM-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-
Sequence 2 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT

Sequence 1 GGVCYWLARSGY------
           GGVCYWL-----------
Sequence 2 GGVCYWLGYTPRTPRTGH



Alignment 9
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01997
Sequence identity: 57.96 (91/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYP
           MASNKVVFSVLLL-V-SVLAA--ATMA--HHQ---VY-PG--C-PG--YP
Sequence 2 MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYP

Sequence 1 MYPL-RVAGVGEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAISH
           -Y-L------------GR-A------V--DCCRQ---VD--WCRC-A--H
Sequence 2 TYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALDH

Sequence 1 MLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG
           ML-GIYRELGA---GHPM-EVF-GCRRG----A----P----VDIPNG-G
Sequence 2 MLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGPG

Sequence 1 GVCYWLARSGY-----
           GVCYWL----------
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 10
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07772
Sequence identity: 36.31 (57/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG
           ----------------A-P-------DCCRQ---VD-SWCRC-A--HM-G
Sequence 2 --RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNHMVG

Sequence 1 GIYRELGAPDVGHPMSEVFRGCRRGTWSARRRA-PGVLQVDIPNGGGGVC
           GIYRELGA-DVGHPM-EVF-GCRRG----RRR--P----VDIPNG-GGVC
Sequence 2 GIYRELGATDVGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTGGVC

Sequence 1 YWLARSGY-----
           YWL----------
Sequence 2 YWLGYPRTPRTGH



Alignment 11
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07774
Sequence identity: 36.94 (58/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPLRVAGVGEAPLLGRARPRRR---AVPGDCCRQFPPVDYSWCRCEAISH
           --------------G--R-RRR-------DCCRQ---VD-SWCRC-A--H
Sequence 2 ---FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG
           M-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-G
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLARSGY-----
           GVCYWL----------
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 12
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07773
Sequence identity: 35.03 (55/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPLRVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHMLG
           ---------------R----------DCCRQ---VD-SWCRC-A--HM-G
Sequence 2 ----RVVKRQCVATRRTGGADEQLRQDCCRQLAAVDDSWCRCSALNHMVG

Sequence 1 GIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGGGVC
           GIYRELGA-DVGHPM-EVF-GCRRG----AR---P----VDIPNG-GGVC
Sequence 2 GIYRELGATDVGHPMAEVFPGCRRGDLERARATLPAFCNVDIPNGTGGVC

Sequence 1 YWLARSGY-----
           YWL----------
Sequence 2 YWLGYPRTPRTGH



Alignment 13
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01999
Sequence identity: 33.76 (53/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAAT-ATMAEYHHQDQVVYTPGPLCQPGMGYP
           MASNKVVFSVLLL-V-SVLAA--ATMA--HHQ---VY-PG--C-PG--YP
Sequence 2 MASNKVVFSVLLLVVLSVLAAAMATMAD-HHQ---VYSPGEQCRPGISYP

Sequence 1 MYPL-RVAGVGEAPLLGR-ARPRRRAVPGDCCRQFPPVDYSWCRCEAISH
           -Y-L------------GR-A------V--DCCRQ---VD--WCRC-A---
Sequence 2 TYSLPQCRTLVRRQCVGRGASAADEQVWQDCCRQLAAVDDGWCRCGALD-

Sequence 1 MLGGIYRELGAPDVGHPMSEVFRGCRRGTWSARRRAPGVLQVDIPNGGGG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VCYWLARSGY
           ----------
Sequence 2 ----------



Alignment 14
Sequence 1:
Sequence 2: Allergen Hor v 15.0101, Sequence: P16968
Sequence identity: 31.85 (50/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           -----------------------T---------V---PG--C-PGMGYP-
Sequence 2 ----------------------PTSVAVDQGSMVSNSPGEWCWPGMGYPV

Sequence 1 YPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHML
           YP--R----------G-----------DCCRQ-------WC-C-A---M-
Sequence 2 YPFPRCRALVKSQCAGGQVVE--SIQKDCCRQIAAIGDEWCICGALGSMR

Sequence 1 GGIYRELGAP--DVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG
           G--Y-ELG----D------EVF-GCR------A----P-V----IPN--G
Sequence 2 GSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG

Sequence 1 --GVCYWLARSGY-------
           --GVCYWL------------
Sequence 2 TDGVCYWLSYYQPPRQMSSR



Alignment 15
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: P16968
Sequence identity: 31.85 (50/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           -----------------------T---------V---PG--C-PGMGYP-
Sequence 2 ----------------------PTSVAVDQGSMVSNSPGEWCWPGMGYPV

Sequence 1 YPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHML
           YP--R----------G-----------DCCRQ-------WC-C-A---M-
Sequence 2 YPFPRCRALVKSQCAGGQVVE--SIQKDCCRQIAAIGDEWCICGALGSMR

Sequence 1 GGIYRELGAP--DVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG
           G--Y-ELG----D------EVF-GCR------A----P-V----IPN--G
Sequence 2 GSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNTNG

Sequence 1 --GVCYWLARSGY-------
           --GVCYWL------------
Sequence 2 TDGVCYWLSYYQPPRQMSSR



Alignment 16
Sequence 1:
Sequence 2: Allergen Tri a 15.0101, Sequence: CBA13560
Sequence identity: 29.94 (47/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           -------------------------------------P---C-P--GY--
Sequence 2 -----------------------------------SGPWSWCDPATGYKV

Sequence 1 YPLR-VAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHML
           --L------------G---P---AV--DCC-Q---V---WCRCE--S-ML
Sequence 2 SALTGCRAMVKLQCVGSQVPE--AVLRDCCQQLADVNNEWCRCEDLSSML

Sequence 1 GGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG--
           ---Y-ELGA---G----EV--GCR-----------P-V--V-IPN--G--
Sequence 2 RSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSGDR

Sequence 1 -GVCYWLARSGY
           -GVCYW-A----
Sequence 2 AGVCYWAAYPDV



Alignment 17
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01083
Sequence identity: 28.03 (44/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM
           -------------------------------------P---C-P--GY--
Sequence 2 -----------------------------------SGPWSWCNPATGYKV

Sequence 1 YPLR-VAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAISHML
           --L------------G---P---AV--DCC-Q-------WCRC---S-ML
Sequence 2 SALTGCRAMVKLQCVGSQVPE--AVLRDCCQQLADINNEWCRCGDLSSML

Sequence 1 GGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGGG--
           ---Y-ELG----G----EV--GCR-----------P-V--V-IPN--G--
Sequence 2 RSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSGDR

Sequence 1 -GVCY--WLARSGY
           -GVCY--W-A----
Sequence 2 AGVCYGDWAAYPDV



Alignment 18
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA08836
Sequence identity: 31.85 (50/157)
Sequence 1 --MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGP--LCQPGM
           ------K----VLLL----V---T----------------GP---C-P-M
Sequence 2 MGAMWMKSMLLVLLLCMLMVTPMTGARSD---------NSGPWMWCDPEM

Sequence 1 GYPMYPL-RVAGVGEAPLLGRARPRRRAVPGDCCRQFPPVDYSWCRCEAI
           G----PL-R----------G---P----V--DCC---------WCRC---
Sequence 2 GHKVSPLTRCRALVKLECVGNRVPED--VLRDCCQEVANISNEWCRCGDL

Sequence 1 SHMLGGIYRELGAPDVGHPMSEVFRGCRRGTWSARRRA-PGVLQVDIPN-
           --ML---Y--LG---VG----EVF-GC------------P----V-IPN-
Sequence 2 GSMLRSVYAALG---VGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNE

Sequence 1 --GGGGVCYWLARSGY
           --G--GVCYW-A----
Sequence 2 AAGTRGVCYWSASTDT



Alignment 19
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01085
Sequence identity: 28.03 (44/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGP-LCQPGMGY-
           --------------------------------------GP--C-PG----
Sequence 2 -------------------------------------SGPWMCYPGQAFQ

Sequence 1 -PMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWCRC
           -P--P---------PLL-----G---P---AV--DCC-Q-------WCRC
Sequence 2 VPALP------ACRPLLRLQCNGSQVPE--AVLRDCCQQLAHIS-EWCRC

Sequence 1 EAISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPG
           -A---ML---Y-E-GA---G------F--CRR-----------A--R-P-
Sequence 2 GALYSMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPI

Sequence 1 VLQVDIPNGGGGVCYWLARSGY-
           V--VD----G--VC---A-----
Sequence 2 V--VDASGDGAYVCKDVAAYPDA



Alignment 20
Sequence 1:
Sequence 2: Allergen Tri a 28.0101, Sequence: CAI84642
Sequence identity: 26.75 (42/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGY--
           -----------------------------------------C-PG-----
Sequence 2 -----------------------------------------CYPGQAFQV

Sequence 1 PMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWCRCE
           P--P---------PLL-----G---P---AV--DCC-Q-------WCRC-
Sequence 2 PALP------ACRPLLRLQCNGSQVPE--AVLRDCCQQLAHIS-EWCRCG

Sequence 1 AISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPGV
           A---ML---Y-E-GA---G------F--CRR-----------A--R-P-V
Sequence 2 ALYSMLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIV

Sequence 1 LQVDIPNGGGGVCYWLARSGY-
           --VD----G--VC---A-----
Sequence 2 --VDASGDGAYVCKDVAAYPDA



Alignment 21
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01084
Sequence identity: 27.39 (43/157)
Sequence 1 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGP-LCQPGMGY-
           --------------------------------------GP--C-PG----
Sequence 2 -------------------------------------SGPWMCYPGQAFQ

Sequence 1 -PMYPLRVAGVGEAPLL-----GRARPRRRAVPGDCCRQFPPVDYSWCRC
           -P--P------G--PLL-----G---P---AV--DCC-Q-------W-RC
Sequence 2 VPALP------GCRPLLKLQCNGSQVPE--AVLRDCCQQLADIS-EWPRC

Sequence 1 EAISHMLGGIYRELGAPDVGHPMSEVFRGCRR-------GTWSARRRAPG
           -A---ML---Y-E-G----G------F--CRR-----------A--R-P-
Sequence 2 GALYSMLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPI

Sequence 1 VLQVDIPNGGGGVCYWLARSGY-
           V--VD----G--VC---A-----
Sequence 2 V--VDASGDGAYVCKDVAAYPDA


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.