The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ory s TAI

Sequence 1398913

Full FASTA alignment

Sequence name:
Query sequence:
MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
GVCYWLGYPRTPRTGH

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ory s TAIBAA07710Go!166186.14.2e-49
2Ory s TAIBAA02000Go!166173.72.4e-45
3Ory s TAIBAA01998Go!165171.31.2e-44
4Ory s TAIBAA07711Go!160162.55.3e-42
5Ory s TAIBAA01997Go!162144.81.1e-36
6Ory s TAIBAA07713Go!160139.64.1e-35
7Ory s TAIBAA01996Go!157139.35.0e-35
8Ory s TAIBAA07712Go!157130.52.2e-32
9Ory s TAIBAA07772Go!111121.96.0e-30
10Ory s TAIBAA07773Go!109116.82.0e-28
11Ory s TAIBAA07774Go!113115.55.1e-28
12Ory s TAIAAB99797Go!157104.51.5e-24
13Hor v 15.0101P16968Go!14684.31.7e-18
14Hor v 1P16968Go!14684.31.7e-18
15Ory s TAIBAA01999Go!9575.35.6e-16
16Hor v 1CAA08836Go!15265.48.3e-13
17Tri a 15.0101CBA13560Go!12164.81.0e-12
18Tri a TAIP01083Go!12364.51.3e-12
19Tri a 28.0101CAI84642Go!11951.01.5e-08
20Tri a TAIP01085Go!12451.01.5e-08
21Tri a TAIP01084Go!12448.96.3e-08
22Hor v 1P01086Go!14436.44.3e-04
23Hor v 1CAA46705Go!14836.54.3e-04
24Hor v 1CAA35188Go!14436.34.7e-04
25Hor v 1CAA49556Go!14935.77.2e-04
26Tri a TAICAA34709Go!14335.29.7e-04
27Tri a TAICAA39099Go!14535.29.7e-04
28Tri a 29.0101CAZ76052Go!12034.31.5e-03
29Hor v 1CAA31794Go!14734.51.6e-03
30Tri a 29.0201CBA13559Go!12034.21.7e-03
31Tri a 40.0101Q41540Go!14333.72.7e-03
32Tri a TAICAA42453Go!14333.72.7e-03
33Tri a TAICAA35598Go!14532.95.0e-03
34Hor v 1CAA49555Go!14532.09.4e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07710
Sequence identity: 100.00 (166/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
Sequence 2 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 2
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA02000
Sequence identity: 93.37 (155/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MASNKVVFSALLLIIVSVLAAT--MADHHKDQVVYSLGERCQPGMGYPMY
Sequence 2 MASNKVVFSALLLIIVSVLAATATMADHHKDQVVYSLGERCQPGMGYPMY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           SLPRCRAVVKRQCV----P-----EQLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 SLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 3
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01998
Sequence identity: 93.37 (155/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MASNKVVFSALLLIIVSVLAAT--MADHHKDQVVYSLGERCQPGMGYPMY
Sequence 2 MASNKVVFSALLLIIVSVLAATTRMADHHKDQVVYSLGERCQPGMGYPMY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           SLPRCRAVVKRQCV-T--P-A---EQL-QDCCR-LAAVDDSWCRCSALNH
Sequence 2 SLPRCRAVVKRQCVGTRSPGAV-DEQLAQDCCRELAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 4
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07711
Sequence identity: 87.35 (145/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ----------LLLIIVSVLAAT--MADHHKDQVVYSLGERCQPGMGYPMY
Sequence 2 -------GTRLLLIIVSVLAATRRMADHHKDQVVYSLGERCQPGMGYPMY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           SLPRCRAVVKRQCV----P-----EQLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 SLPRCRAVVKRQCVGHGAPGGAVDEQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLGY-PRTPRTGH
           GVCYWLGY-PRTPRTGH
Sequence 2 GVCYWLGYTPRTPRTGH



Alignment 5
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01997
Sequence identity: 76.51 (127/166)
Sequence 1 MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPM
           MASNKVVFS-LLL---SVLAA----MADHH----VYS-GE-C-PG--YP-
Sequence 2 MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPT

Sequence 1 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN
           YSLP-CR--V-RQCV-----AA---EQ--QDCCRQLAAVDD-WCRC-AL-
Sequence 2 YSLPQCRTLVRRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALD

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT
           HM--GIYRELGAT--GHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNG-
Sequence 2 HMLSGIYRELGATEAGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGP

Sequence 1 GGVCYWLGYPRTPRTGH
           GGVCYWLGYPRTPRTGH
Sequence 2 GGVCYWLGYPRTPRTGH



Alignment 6
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07713
Sequence identity: 74.70 (124/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPM
           MASNKVVFS-LLL--VSVLAAT--MA--HH-DQVVY-----CQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPAPLCQPGMGYPM

Sequence 1 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN
           Y-LPRCRA-VKRQCV-----AA---EQ-R-DCCRQLAAVDDSWCRC-A--
Sequence 2 YPLPRCRALVKRQCVGRGTAAA--AEQVRRDCCRQLAAVDDSWCRCEAIS

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT
           HM-GGIYRELGA-DVGHPM-EVF-GCRRGDLERAAASLPAFCNVDIPNG-
Sequence 2 HMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGG

Sequence 1 GGVCYWLGYPRTPRTGH
           GGVCYWL----------
Sequence 2 GGVCYWLARSGY-----



Alignment 7
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01996
Sequence identity: 75.30 (125/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPM
           MASNKVVFS-LLL--VSVLAAT--MA--HH-DQVVY----RCQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTRA-RCQPGMGYPM

Sequence 1 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN
           YSLPRCRA-VKRQC---A--A----EQ-R-DCCRQLAAVDDSWCRC-A--
Sequence 2 YSLPRCRALVKRQCRGSAAAA----EQVRRDCCRQLAAVDDSWCRCEAIS

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT
           HM-GGIYRELGA-DVGHPM-EVF-GCRRGDLERAAASLPAFCNVDIPNG-
Sequence 2 HMLGGIYRELGAPDVGHPMSEVFRGCRRGDLERAAASLPAFCNVDIPNGG

Sequence 1 GGVCYWLGYPRTPRTGH
           GGVCYWL----------
Sequence 2 GGVCYWLARSGY-----



Alignment 8
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07712
Sequence identity: 70.48 (117/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MASNKVV--ALL---VSVLAAT--MADHH--QVVY--G--CQPG-GYP-Y
Sequence 2 MASNKVVIPALLVVVVSVLAATTTMADHHQEQVVYTPGQLCQPGIGYPTY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -LPRCRA-VKRQCVA---P-----EQ-R--CCRQLA--D-SWCRC-ALNH
Sequence 2 PLPRCRAFVKRQCVA---PGTL-DEQVRRGCCRQLAGIDSSWCRCDALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           M---IYRE--A-D-GHPMAEVF-GCRRGD-ERAAASLPAFCNVDIPNG-G
Sequence 2 MLRIIYREERAADAGHPMAEVFRGCRRGDIERAAASLPAFCNVDIPNGVG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWL-----P-TG-
Sequence 2 GVCYWL-----PGTGY



Alignment 9
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07772
Sequence identity: 62.05 (103/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -----R--VKRQCVAT-HPAA-G-EQLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 -----RHEVKRQCVATTHPAAPGTEQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLER---SLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERRRRSLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 10
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07773
Sequence identity: 59.64 (99/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -------VVKRQCVAT--------EQLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 ------RVVKRQCVATRRTGG-ADEQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERA-A-LPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERARATLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 11
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA07774
Sequence identity: 57.83 (96/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           ----------RQCV-------R---QLRQDCCRQLAAVDDSWCRCSALNH
Sequence 2 ---FGTRFRQRQCVGPRRTRRRWTQQLRQDCCRQLAAVDDSWCRCSALNH

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
Sequence 2 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG

Sequence 1 GVCYWLGYPRTPRTGH
           GVCYWLGYPRTPRTGH
Sequence 2 GVCYWLGYPRTPRTGH



Alignment 12
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: AAB99797
Sequence identity: 59.04 (98/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMAD-HHKDQVVYSLGERCQPGMGYPM
           MASNKVVFS-LLL--VSVLAAT--MA--HH-DQVVY--G--CQPGMGYPM
Sequence 2 MASNKVVFSVLLLAVVSVLAATATMAEYHHQDQVVYTPGPLCQPGMGYPM

Sequence 1 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN
           Y-L-R---V--------A-P--R-------DCCRQ---VD-SWCRC-A--
Sequence 2 YPL-RVAGVGEAPLLGRARPRRRA---VPGDCCRQFPPVDYSWCRCEAIS

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT
           HM-GGIYRELGA-DVGHPM-EVF-GCRRG----A----P----VDIPNG-
Sequence 2 HMLGGIYRELGAPDVGHPMSEVFRGCRRGTWS-ARRRAPGVLQVDIPNGG

Sequence 1 GGVCYWLGYPRTPRTGH
           GGVCYWL----------
Sequence 2 GGVCYWLARSGY-----



Alignment 13
Sequence 1:
Sequence 2: Allergen Hor v 15.0101, Sequence: P16968
Sequence identity: 44.58 (74/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -------------------------A------V--S-GE-C-PGMGYP-Y
Sequence 2 ---------------------PTSVAVDQGSMVSNSPGEWCWPGMGYPVY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           --PRCRA-VK-QC-----------E----DCCRQ-AA--D-WC-C-AL--
Sequence 2 PFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEWCICGALGS

Sequence 1 MVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIP--
           M-G--Y-ELG----D-----AEVFPGCR-----RA-ASLPA-CN--IP--
Sequence 2 MRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNT

Sequence 1 NGTGGVCYWLGYPRTPRTGH--
           NGT-GVCYWL-Y---PR-----
Sequence 2 NGTDGVCYWLSYYQPPRQMSSR



Alignment 14
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: P16968
Sequence identity: 44.58 (74/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -------------------------A------V--S-GE-C-PGMGYP-Y
Sequence 2 ---------------------PTSVAVDQGSMVSNSPGEWCWPGMGYPVY

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           --PRCRA-VK-QC-----------E----DCCRQ-AA--D-WC-C-AL--
Sequence 2 PFPRCRALVKSQCAG-----GQVVESIQKDCCRQIAAIGDEWCICGALGS

Sequence 1 MVGGIYRELGAT--DVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIP--
           M-G--Y-ELG----D-----AEVFPGCR-----RA-ASLPA-CN--IP--
Sequence 2 MRGSMYKELGVALADDKATVAEVFPGCRTEVMDRAVASLPAVCNQYIPNT

Sequence 1 NGTGGVCYWLGYPRTPRTGH--
           NGT-GVCYWL-Y---PR-----
Sequence 2 NGTDGVCYWLSYYQPPRQMSSR



Alignment 15
Sequence 1:
Sequence 2: Allergen Ory s TAI, Sequence: BAA01999
Sequence identity: 39.16 (65/166)
Sequence 1 MASNKVVFSALLLIIVSVLAAT-GPMADHHKDQVVYSLGERCQPGMGYPM
           MASNKVVFS-LLL---SVLAA----MADHH----VYS-GE-C-PG--YP-
Sequence 2 MASNKVVFSVLLLVVLSVLAAAMATMADHHQ---VYSPGEQCRPGISYPT

Sequence 1 YSLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALN
           YSLP-CR--V-RQCV-----AA---EQ--QDCCRQLAAVDD-WCRC-AL-
Sequence 2 YSLPQCRTLVRRQCVGRGASAA--DEQVWQDCCRQLAAVDDGWCRCGALD

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GGVCYWLGYPRTPRTGH
           -----------------
Sequence 2 -----------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA08836
Sequence identity: 36.75 (61/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           --------S-LL------L--T-PM-----D---------C-P-MG----
Sequence 2 -MGAMWMKSMLLVLLLCMLMVT-PMTGARSDNSGPWMW--CDPEMGHKVS

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -L-RCRA-VK--CV----P-----E----DCC---A-----WCRC--L--
Sequence 2 PLTRCRALVKLECVGNRVP-----EDVLRDCCQEVANISNEWCRCGDLGS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPN---
           M----Y--LG---VG----EVFPGC---------A--PA-CNV-IPN---
Sequence 2 MLRSVYAALG---VGGGPEEVFPGCQKDVMKLLVAGVPALCNVPIPNEAA

Sequence 1 GTGGVCYWLGYPRTPRTGH
           GT-GVCYW-----T-----
Sequence 2 GTRGVCYWSASTDT-----



Alignment 17
Sequence 1:
Sequence 2: Allergen Tri a 15.0101, Sequence: CBA13560
Sequence identity: 33.73 (56/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ----------------------------------------C-P--GY---
Sequence 2 ----------------------------------SGPWSWCDPATGYKVS

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -L--CRA-VK-QCV----P-----E----DCC-QLA-V---WCRC--L--
Sequence 2 ALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADVNNEWCRCEDLSS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           M----Y-ELGA---G----EV-PGCR-------AAS-P----V-IPN--G
Sequence 2 MLRSVYQELGARE-GK---EVLPGCRKEVMKLTAASVPEVRKVPIPNPSG

Sequence 1 ---GVCYWLGYPRTPRTGH
           ---GVCYW--YP-------
Sequence 2 DRAGVCYWAAYPDV-----



Alignment 18
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01083
Sequence identity: 33.13 (55/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ----------------------------------------C-P--GY---
Sequence 2 ----------------------------------SGPWSWCNPATGYKVS

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -L--CRA-VK-QCV----P-----E----DCC-QLA-----WCRC--L--
Sequence 2 ALTGCRAMVKLQCVGSQVP-----EAVLRDCCQQLADINNEWCRCGDLSS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDIPNGTG
           M----Y-ELG----G----EV-PGCR-------AAS-P--C-V-IPN--G
Sequence 2 MLRSVYQELGVRE-GK---EVLPGCRKEVMKLTAASVPEVCKVPIPNPSG

Sequence 1 ---GVCY--WLGYPRTPRTGH
           ---GVCY--W--YP-------
Sequence 2 DRAGVCYGDWAAYPDV-----



Alignment 19
Sequence 1:
Sequence 2: Allergen Tri a 28.0101, Sequence: CAI84642
Sequence identity: 26.51 (44/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ----------------------------------------C-PG------
Sequence 2 ----------------------------------------CYPGQAFQVP

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -LP-CR-----QC-----P-----E----DCC-QLA-----WCRC-AL--
Sequence 2 ALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PN
           M----Y-E-GA---G------FP-CRR------AAS--A-C---I-----
Sequence 2 MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDAS

Sequence 1 GTGG-VCYWLGYPRTPRTGH
           G-G--VC-------------
Sequence 2 GDGAYVCKDVAAYPDA----



Alignment 20
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01085
Sequence identity: 27.11 (45/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -----------------------------------S----C-PG------
Sequence 2 -----------------------------------SGPWMCYPGQAFQVP

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -LP-CR-----QC-----P-----E----DCC-QLA-----WCRC-AL--
Sequence 2 ALPACRPLLRLQCNGSQVP-----EAVLRDCCQQLAHISE-WCRCGALYS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PN
           M----Y-E-GA---G------FP-CRR------AAS--A-C---I-----
Sequence 2 MLDSMYKEHGAQE-GQAGTGAFPRCRREVVKLTAASITAVCRLPIVVDAS

Sequence 1 GTGG-VCYWLGYPRTPRTGH
           G-G--VC-------------
Sequence 2 GDGAYVCKDVAAYPDA----



Alignment 21
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: P01084
Sequence identity: 26.51 (44/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -----------------------------------S----C-PG------
Sequence 2 -----------------------------------SGPWMCYPGQAFQVP

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQLRQDCCRQLAAVDDSWCRCSALNH
           -LP-CR---K-QC-----P-----E----DCC-QLA-----W-RC-AL--
Sequence 2 ALPGCRPLLKLQCNGSQVP-----EAVLRDCCQQLADISE-WPRCGALYS

Sequence 1 MVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASLPAFCNVDI---PN
           M----Y-E-G----G------FP-CRR------AAS--A-C---I-----
Sequence 2 MLDSMYKEHGVSE-GQAGTGAFPSCRREVVKLTAASITAVCRLPIVVDAS

Sequence 1 GTGG-VCYWLGYPRTPRTGH
           G-G--VC-------------
Sequence 2 GDGAYVCKDVAAYPDA----



Alignment 22
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: P01086
Sequence identity: 25.30 (42/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ------------------L----------------S-G--C-PG---P--
Sequence 2 ------------MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHN

Sequence 1 SLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWCRCSAL
           -L--CR--VV---C----H---R---------CC--L-A-----CRC-AL
Sequence 2 PLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYCRCEAL

Sequence 1 NHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIP
           -----G-----GA---G-------P-C-R------AA-L--P--CN----
Sequence 2 RIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTI

Sequence 1 NGTGGVCYWL--GYPRTPRTGH
           -G----C--L--GY--------
Sequence 2 HGSA-YCPELQPGY--------



Alignment 23
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA46705
Sequence identity: 25.30 (42/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ------------------L----------------S-G--C-PG---P--
Sequence 2 ------------MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHN

Sequence 1 SLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWCRCSAL
           -L--CR--VV---C----H---R---------CC--L-A-----CRC-AL
Sequence 2 PLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYCRCEAL

Sequence 1 NHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIP
           -----G-----GA---G-------P-C-R------AA-L--P--CN----
Sequence 2 RIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTI

Sequence 1 NGTGGVCYWL--GYPRTPRTGH
           -G----C--L--GY--------
Sequence 2 HGSA-YCPELQPGYGVVL----



Alignment 24
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA35188
Sequence identity: 22.89 (38/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           ------------------L----------------S-G--C-PG---P--
Sequence 2 ------------MAFKYQLLLSAAVMLAILVATATSFGDSCAPGDALPHN

Sequence 1 SLPRCRA-VVKRQCVATAHPAARG-NEQLRQDCCRQLAAVDDSWCRCSAL
           -L--CR--VV---C----H---R---------CC--L-A-----CRC-AL
Sequence 2 PLRACRTYVVSQIC----HQGPRLLTSDMKRRCCDELSAIP-AYCRCEAL

Sequence 1 NHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVDIP
           -----G-----GA---G-------P-C-R------AA-L--P--CN----
Sequence 2 RIIMQGVVTWQGAFE-GAYFKDS-PNCPRERQTSYAANLVTPQECNLGTI

Sequence 1 NGTGGVCYWLGYPRTPRTGH
           -G------------------
Sequence 2 HGSAYCPELQPAY-------



Alignment 25
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA49556
Sequence identity: 27.71 (46/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MAS-------L----VS--AA-----------------E-C-P----P--
Sequence 2 MASKSSCDLLLAAVLVSIFAAVAAVGS-----------EDCTPWTATPIT

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALN
           -LP-CR--V--Q------P---G---L--Q-CC--LA------CRC-AL-
Sequence 2 PLPSCRDYVEQQACRIETP---GPPYLAKQQCCGELANIPQQ-CRCQALR

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRR---GDLERAAASLPAFCNVDIP
           ---G---R-------G----E--PGC-R----D--R-----P-FCN----
Sequence 2 FFMG---RKSRPDQSG--LMEL-PGCPREVQMDFVRILVT-PGFCNLTTV

Sequence 1 NGTGGVCYWLGYPRTPRTGH-
           --T------------------
Sequence 2 HNTPYCLAMDEWQWNRQFCSS



Alignment 26
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: CAA34709
Sequence identity: 27.11 (45/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MAS-------L----VS--AA-----------------E-C-P-M-----
Sequence 2 MASKSNCVLLLAAVLVSIFAAVAAIGN-----------EDCTPWMSTLIT

Sequence 1 SLPRCRAVVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCSALN
           -LP-CR--V--Q------P---G---L--Q-CC--LA------CRC-AL-
Sequence 2 PLPSCRDYVEQQACRIETP---GSPYLAKQQCCGELANIPQQ-CRCQALR

Sequence 1 HMVGGIYRELGATDVGHPMAEVFPGCRR---GDLERAAASLPAFCNVDIP
           ---G---R-----D----M----PGC-R----D--R-----P--CN----
Sequence 2 YFMGPKSRP----DQSGLME--LPGCPREVQMDFVRILVT-PGYCNLTTV

Sequence 1 NGTGGVCYWLGYPRTPRTGH
           --T-----------------
Sequence 2 HNTPYCLAMEESQWS-----



Alignment 27
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: CAA39099
Sequence identity: 28.31 (47/166)
Sequence 1 MASNKVVFSALLL-IIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPM
           MAS-------LL----VSV-AA----------------G--C-PGMG-P-
Sequence 2 MASKSSITHLLLAAVLVSVFAAAA------------ATGPYCYPGMGLPS

Sequence 1 YSLPRCRAVVKRQ-C----VATAHPAARGNEQLRQDCCRQLAAVDDSWCR
           --L--CR--V--Q-C----V--------GN---R--CC--L-------CR
Sequence 2 NPLEGCREYVAQQTCGVGIVGSPVSTEPGNTP-RDRCCKELYDASQH-CR

Sequence 1 CSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCN
           C-A-----G---------D---------PGC-R------A--L--P--CN
Sequence 2 CEAVRYFIGR------TSDPNSGVLKDLPGCPREPQRDFAKVLVTPGHCN

Sequence 1 VDIPNGTGGVCYWLGYPRTPRTGH
           V-----T-----------------
Sequence 2 VMTVHNTPYCLGLDI---------



Alignment 28
Sequence 1:
Sequence 2: Allergen Tri a 29.0101, Sequence: CAZ76052
Sequence identity: 21.08 (35/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -------------------------------------G--C--GMG-P--
Sequence 2 ------------------------------------TGPYCYAGMGLPIN

Sequence 1 SLPRCRAVVKRQ-CVATAHPAARGNE---QLRQDCCRQLAAVDDSWCRCS
           -L--CR--V--Q-C-------A---E-----R--CC--L-------CRC-
Sequence 2 PLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQH-CRCE

Sequence 1 ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVD
           A-----G---R-----D---------PGC-R------A--L--P--CNV-
Sequence 2 AVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTPGHCNVM

Sequence 1 IPNGTGGVCYWLGYPRTPRTGH
           ----------------------
Sequence 2 TVHNAPYCLGLDI---------



Alignment 29
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA31794
Sequence identity: 28.92 (48/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           MAS----F--------SVLA---------KD---------CQ-G---P--
Sequence 2 MASDHRRFVLSGAVLLSVLAVAAATLESVKDE--------CQLGVDFPHN

Sequence 1 SLPRCRA-VVKRQCVATAHPAARGNEQ---LRQDCCRQLAAVDDSWCRCS
           -L--C---V-KR-C--------RG----------CCR-LAAV-D--CRC-
Sequence 2 PLATCHTYVIKRVC-------GRGPSRPMLVKERCCRELAAVPDH-CRCE

Sequence 1 ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVD
           AL-----G-----G----G---------C-R------AA-L---A-CN--
Sequence 2 ALRILMDGVRTPEGRVVEGR-LGDRRD-CPREEQRAFAATLVTAAECNLS

Sequence 1 IPNGTGGVCYWLGYPRTPRTGH
           -----G-----L----------
Sequence 2 SVQAPGVRLVLLADG-------



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a 29.0201, Sequence: CBA13559
Sequence identity: 21.69 (36/166)
Sequence 1 MASNKVVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPMY
           -------------------------------------G--C-PGMG-P--
Sequence 2 ------------------------------------TGPYCYPGMGLPSN

Sequence 1 SLPRCRAVVKRQ-C----VATAHPAARGNEQLRQDCCRQLAAVDDSWCRC
           -L--CR--V--Q-C----V--------GN---R--CC--L-------C-C
Sequence 2 PLEGCREYVAQQTCGVGIVGSPVSTEPGNTP-RDRCCKELYDASQH-CWC

Sequence 1 SALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNV
           -A-----G---------D---------PGC-R------A--L--P--CNV
Sequence 2 EAVRYFIGR------TSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNV

Sequence 1 DIPNGTGGVCYWLGYPRTPRTGH
           -----T-----------------
Sequence 2 MTVHNTPYCLGLDI---------



Alignment 31
Sequence 1:
Sequence 2: Allergen Tri a 40.0101, Sequence: Q41540
Sequence identity: 28.31 (47/166)
Sequence 1 MASNK---VVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGY
           MAS-------F-ALL--I----AA-G---------------E-C-P----
Sequence 2 MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTST

Sequence 1 PMYSLPRCRAVVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCS
           ----LP-CR--V--Q------P---G---L--Q-CC-QLA------CRC-
Sequence 2 LITPLPSCRNYVEEQACRIEMP---GPPYLAKQECCEQLANIPQQ-CRCQ

Sequence 1 ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVD
           AL----G---R-----D----M----PGC-R---------L--P--CN--
Sequence 2 ALRYFMGPKSRP----DQSGLME--LPGCPREVQMNFVPILVTPGYCNLT

Sequence 1 IPNGTGGVCYWLGYPRTPRTGH
           ----T-----------------
Sequence 2 TVHNTPYCLGMEESQWS-----



Alignment 32
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: CAA42453
Sequence identity: 28.31 (47/166)
Sequence 1 MASNK---VVFSALLLIIVSVLAATGPMADHHKDQVVYSLGERCQPGMGY
           MAS-------F-ALL--I----AA-G---------------E-C-P----
Sequence 2 MASKSNYNLLFTALLVFIFAAVAAVG--------------NEDCTPWTST

Sequence 1 PMYSLPRCRAVVKRQCVATAHPAARGNEQL-RQDCCRQLAAVDDSWCRCS
           ----LP-CR--V--Q------P---G---L--Q-CC-QLA------CRC-
Sequence 2 LITPLPSCRNYVEEQACRIEMP---GPPYLAKQECCEQLANIPQQ-CRCQ

Sequence 1 ALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCNVD
           AL----G---R-----D----M----PGC-R---------L--P--CN--
Sequence 2 ALRYFMGPKSRP----DQSGLME--LPGCPREVQMNFVPILVTPGYCNLT

Sequence 1 IPNGTGGVCYWLGYPRTPRTGH
           ----T-----------------
Sequence 2 TVHNTPYCLGMEESQWS-----



Alignment 33
Sequence 1:
Sequence 2: Allergen Tri a TAI, Sequence: CAA35598
Sequence identity: 27.71 (46/166)
Sequence 1 MASNKVVFSALLL--IIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYP
           MAS-----S-LLL----VSV-AA----------------G--C--GMG-P
Sequence 2 MASKSSI-SPLLLATVLVSVFAAAT------------ATGPYCYAGMGLP

Sequence 1 MYSLPRCRAVVKRQ-CVATAHPAARGNEQ---LRQDCCRQLAAVDDSWCR
           ---L--CR--V--Q-C-------A---E-----R--CC--L-------CR
Sequence 2 INPLEGCREYVAQQTCGISISGSAVSTEPGNTPRDRCCKELYDASQH-CR

Sequence 1 CSALNHMVGGIYRELGATDVGHPMAEVFPGCRRGDLERAAASL--PAFCN
           C-A-----G---R-----D---------PGC-R------A--L-----CN
Sequence 2 CEAVRYFIG---RR---SDPNSSVLKDLPGCPREPQRDFAKVLVTSGHCN

Sequence 1 VDIPNGTGGVCYWLGYPRTPRTGH
           V-----------------------
Sequence 2 VMTVHNAPYCLGLDI---------



Alignment 34
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA49555
Sequence identity: 25.90 (43/166)
Sequence 1 MASNKVVFSALLL-IIVSVLAATGPMADHHKDQVVYSLGERCQPGMGYPM
           MAS-------LL-----SV-AA----------------G--C--GMG-P-
Sequence 2 MASKSSITPLLLAAVLASVFAAAT------------ATGQYCYAGMGLPS

Sequence 1 YSLPRCRAVVKRQ-C---VATAHPAARGNEQLRQDCCRQLAAVDDSWCRC
           --L--CR--V--Q-C----A---------------CC--L-------CRC
Sequence 2 NPLEGCREYVAQQTCGVTIAGSPVSSEPGDTPKDRCCQELDEAPQH-CRC

Sequence 1 SALNHMVGGIYRELGATDVGHPMAEVF---PGCRRGDLERAAASL--PAF
           -A-----G---R--------HP---V----PGC--------A--L--P--
Sequence 2 EAVRYFIG---RR------SHPDWSVLKDLPGCPKEPQRDFAKVLVTPGQ

Sequence 1 CNVDIPNGTGGVCYWLGYPRTPRTGH
           CNV-----------------------
Sequence 2 CNVLTVHNAPYCLGLDI---------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.