The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Gly m conglycinin

Sequence 18536

Full FASTA alignment

Sequence name:
Query sequence:
MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
LRAFY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Gly m conglycininCAA35691Go!605562.72.5e-161
2Gly m 5.0101O22120Go!543502.13.9e-143
3Gly m 5.0201Q9FZP9Go!559377.31.4e-105
4Gly m conglycininAAB23463Go!439301.11.0e-82
5Gly m conglycininAAB01374Go!639291.01.6e-79
6Vig r 2.0101Q198W3Go!453273.32.4e-74
7Vig r 2.0201B1NPN8Go!454269.92.6e-73
8Gly m conglycininAAA33947Go!218199.02.6e-52
9Lup an 1.0101ACB05815Go!611191.61.3e-49
10Len c 1.0101CAD87730Go!418173.72.1e-44
11Len c 1.0102CAD87731Go!415170.32.3e-43
12Jug r 2AAF18269Go!593170.62.6e-43
13Car i 2.0101B3STU4Go!792160.92.8e-40
14Jug n 2AAM54366Go!481157.81.5e-39
15Mac i 1.0201Q9SPL4Go!666153.34.7e-38
16Mac i 1.0101Q9SPL3Go!625153.05.5e-38
17Ara h 1P43238Go!626113.73.7e-26
18Ara h 1P43237Go!614113.15.4e-26
19Ses i 3AAK15089Go!585104.52.1e-23
20Jug r 6.0101A0A2I4E5L6Go!50296.93.5e-21
21Pis v 3.0101EF116865Go!51991.81.2e-19
22Pin k 2.0101V9VGU0Go!46378.98.4e-16
23Cor a 11AAL86739Go!44877.61.9e-15
24Ana o 1.0102AAM73729Go!53675.78.9e-15
25Ana o 1.0101AAM73730Go!53875.78.9e-15
26Gly m Bd28KBAB21619Go!47347.42.6e-06
27Coc n 1.0101A0A0S3B0K0Go!49044.32.3e-05
28Gly m 6.0401Q9SB11Go!56342.21.1e-04
29Pru du 6.0101ADN39440Go!55138.21.8e-03
30Tri a gliadinAAA34289Go!32736.53.4e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 100.00 (605/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
Sequence 2 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
Sequence 2 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
Sequence 2 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
Sequence 2 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
Sequence 2 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN

Sequence 1 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
           NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
Sequence 2 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF

Sequence 1 EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
           EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
Sequence 2 EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS

Sequence 1 SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
           SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
Sequence 2 SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL

Sequence 1 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
           LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
Sequence 2 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL

Sequence 1 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
           SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
Sequence 2 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI

Sequence 1 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
           PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
Sequence 2 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI

Sequence 1 LRAFY
           LRAFY
Sequence 2 LRAFY



Alignment 2
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 89.42 (541/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           ------------VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
Sequence 2 ------------VEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
Sequence 2 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           RQFPFPRPPHQKEER--EEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
Sequence 2 RQFPFPRPPHQKEERKQEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
Sequence 2 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
Sequence 2 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN

Sequence 1 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
           NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
Sequence 2 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF

Sequence 1 EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
           EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
Sequence 2 EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS

Sequence 1 SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
           SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
Sequence 2 SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL

Sequence 1 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
           LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
Sequence 2 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL

Sequence 1 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
           SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
Sequence 2 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI

Sequence 1 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
           PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
Sequence 2 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI

Sequence 1 LRAFY
           LRAFY
Sequence 2 LRAFY



Alignment 3
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 77.02 (466/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           -------------E-EECEEG-IPRPRP--QHPERE-QQ-GEKEEDE-EQ
Sequence 2 -----------VEEEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGEQ

Sequence 1 PRPIPFPRP-QPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQD
           PRP-PFPRP-QP-QEEEHEQ-EE-EW-RKEEK-G-KGSEEE-------QD
Sequence 2 PRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEE-------QD

Sequence 1 ERQFPFPRPPHQKEERN-------------------EEEDEDEEQQRESE
           ER--P-P--PHQKEE---------------------E--DEDEEQ--ES-
Sequence 2 EREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQ

Sequence 1 ESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQ
           ESE-SE-----RRHKNKNPF-F-S-RF-TLFKNQYG--RVLQRFN-RS-Q
Sequence 2 ESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQQ

Sequence 1 LQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDS
           LQNLRDYRILEFNSKPNTLLLP-HADADYLIVILNGTAIL-LVNNDDRDS
Sequence 2 LQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDS

Sequence 1 YRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSS
           Y-LQSGDALRVP-GTTYYVVNPDN-ENLR-ITLAIPVNKPGRFESFFLSS
Sequence 2 YNLQSGDALRVPAGTTYYVVNPDNDENLRMITLAIPVNKPGRFESFFLSS

Sequence 1 TEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVI
           T-AQQSYLQGFS-NILEASYDTKFEEINKVLF-REEGQQQGE-RLQESVI
Sequence 2 TQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVI

Sequence 1 VEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEIT
           VEISK-QIR-LSK-AKSSSRKTISSEDKPFNLRSRDPIYSNKLGK-FEIT
Sequence 2 VEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLFEIT

Sequence 1 PEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVG
           PEKNPQLRDLD-FLS-VDMNEGAL-LPHFNSKAIV-LVINEG-ANIELVG
Sequence 2 PEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIELVG

Sequence 1 LKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFA
           -KEQQQ-QQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATS-LNFFA
Sequence 2 IKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLNFFA

Sequence 1 IGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRES
           -GINAENNQRNFLAGS-DNVISQIPSQVQELAFPGSA---E-L-K-Q-ES
Sequence 2 FGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQSES

Sequence 1 YFVDAQPKKKEEGNKGRKGPLSSILRAFY
           YFVDAQP--KEEGNKGRKGPLSSILRAFY
Sequence 2 YFVDAQPQQKEEGNKGRKGPLSSILRAFY



Alignment 4
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB23463
Sequence identity: 53.22 (322/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLF-G
           --------------R-------------------S---R----NPF-F--
Sequence 2 ------------MMRVRFPLLVLLGTVFLASVCVSLKVREDENNPFYFRS

Sequence 1 SNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN
           SN-F-TLF-NQ--RIR-LQRFN-RSPQL-NLRDYRI--F-SKPNT-LLP-
Sequence 2 SNSFQTLFENQNVRIRLLQRFNKRSPQLENLRDYRIVQFQSKPNTILLPH

Sequence 1 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD
           HADAD-L---L-G-AIL-LVNNDDRDSY-L--GDA-R-P-GTTYY-VNP-
Sequence 2 HADADFLLFVLSGRAILTLVNNDDRDSYNLHPGDAQRIPAGTTYYLVNPH

Sequence 1 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK
           ---NL--I-LAIPVNKPGR---FFLSST-AQQSYLQGFS-NILE-S----
Sequence 2 DHQNLKIIKLAIPVNKPGRYDDFFLSSTQAQQSYLQGFSHNILETSFHSE

Sequence 1 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI
           FEEIN-VLF--EE-----EQR-QE-VIVE-SKEQIR-LS-RAKSSSRKTI
Sequence 2 FEEINRVLFGEEE-----EQRQQEGVIVELSKEQIRQLSRRAKSSSRKTI

Sequence 1 SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGA
           SSED-PFNLRSR-PIYSN--GKFFEITPEKNPQLRDLDIFLS-VD-NEGA
Sequence 2 SSEDEPFNLRSRNPIYSNNFGKFFEITPEKNPQLRDLDIFLSSVDINEGA

Sequence 1 LLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAE
           LLLPHFNSKAIVILVINEGDANIELVG-KEQQQ-Q-QEE-PLEV--YRAE
Sequence 2 LLLPHFNSKAIVILVINEGDANIELVGIKEQQQKQKQEEEPLEVQRYRAE

Sequence 1 LSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQ
           LSE-D-FVIPA-YP-VVNATSNLNF-A-GINAENNQRNFLAG--DNV--Q
Sequence 2 LSEDDVFVIPAAYPFVVNATSNLNFLAFGINAENNQRNFLAGEKDNVVRQ

Sequence 1 IPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSS
           I--QVQELAFPGSAQ-VE-LLK-QRESYFVDAQP--KEEG-KGRKGP--S
Sequence 2 IERQVQELAFPGSAQDVERLLKKQRESYFVDAQPQQKEEGSKGRKGPFPS

Sequence 1 ILRAFY
           IL-A-Y
Sequence 2 ILGALY



Alignment 5
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 85.45 (517/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           MMRARFPLLLLG-VFLASVSVSFGIAYWEK-NP-HNKCL-SCNSE-DSYR
Sequence 2 MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYR

Sequence 1 NQACHARCNLLKVEKEE-CEEGEIPRPRPRPQHPEREPQQPGEKEEDEDE
           NQACHARCNLLKVE-EE-CEEG-IPRPRP--QHPERE-QQ-GEKEEDE-E
Sequence 2 NQACHARCNLLKVEEEEECEEGQIPRPRP--QHPERERQQHGEKEEDEGE

Sequence 1 QPRPIPFPRP-QPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQ
           QPRP-PFPRP-QP-QEEEHEQ-EE-EW-RKEEK-G-KGSEEE-------Q
Sequence 2 QPRPFPFPRPRQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEE-------Q

Sequence 1 DERQFPFPRPPHQKEERN-------------------EEEDEDEEQQRES
           DER--P-P--PHQKEE---------------------E--DEDEEQ--ES
Sequence 2 DEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEEDQDEDEEQDKES

Sequence 1 EESEDSEL----RRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSP
           -ESE-SE-----RRHKNKNPF-F-S-RF-TLFKNQYG--RVLQRFN-RS-
Sequence 2 QESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ

Sequence 1 QLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRD
           QLQNLRDYRILEFNSKPNTLLLP-HADADYLIVILNGTAIL-LVNNDDRD
Sequence 2 QLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRD

Sequence 1 SYRLQSGDALRVPSGTTYYVVNPDNNENL-------------------RL
           SY-LQSGDALRVP-GTT-YVVNPDN-ENL-------------------R-
Sequence 2 SYNLQSGDALRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRM

Sequence 1 ITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKV
           ITLAIPVNKPGRFESFFLSST-AQQSYLQGFS-NILEASYDTKFEEINKV
Sequence 2 ITLAIPVNKPGRFESFFLSSTQAQQSYLQGFSKNILEASYDTKFEEINKV

Sequence 1 LFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPF
           LF-REEGQQQGE-RLQESVIVEISK-QIR-LSK-AKSSSRKTISSEDKPF
Sequence 2 LFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSRKTISSEDKPF

Sequence 1 NLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFN
           NL-SRDPIYSNKLGK-FEIT---NPQLRDLD-FLS-VDMNEGAL-LPHFN
Sequence 2 NLGSRDPIYSNKLGKLFEIT-QRNPQLRDLDVFLSVVDMNEGALFLPHFN

Sequence 1 SKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIF
           SKAIV-LVINEG-ANIELVG-KEQQQ-QQQEEQPLEVRKYRAELSEQDIF
Sequence 2 SKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF

Sequence 1 VIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQE
           VIPAGYPV-VNATS-LNFFA-GINAENNQRNFLAGS-DNVISQIPSQVQE
Sequence 2 VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQE

Sequence 1 LAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY
           LAFP-SA---E-L-K-Q-ESYFVDAQP--KEEGNKGRKGPLSSILRAFY
Sequence 2 LAFPRSAKDIENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY



Alignment 6
Sequence 1:
Sequence 2: Allergen Vig r 2.0101, Sequence: Q198W3
Sequence identity: 47.11 (285/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           --------------------------RE--ES------R--N-NPF-F-S
Sequence 2 MVRARVQLLLGILFLASLSVSFGIVHREHQESQEESDSRGQN-NPFYFNS

Sequence 1 NR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN
           -R-F-TLFKNQYG--RV--RF-QRS-Q-QNL--YR--EF-SKPNTLLLP-
Sequence 2 DRRFHTLFKNQYGHLRVIHRFDQRSKQIQNLENYRVVEFKSKPNTLLLPH

Sequence 1 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD
           HADAD-L-V-LNG-AIL-LVN-D-RDSY-L--G-A---P-GTT---VNP-
Sequence 2 HADADFLLVVLNGRAILTLVNPDGRDSYILEQGHAQKIPAGTTFFLVNPN

Sequence 1 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK
           -N-NLR-I-LAIPVN-P-RF--FFLSSTEAQQSYL-GFS-NILEAS-D--
Sequence 2 DNDNLRIIKLAIPVNNPHRFQNFFLSSTEAQQSYLRGFSKNILEASFDSD

Sequence 1 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI
           F-EI--VLF--E--QQ-GE----E-VIVE---EQIR-L-K-AKSSSRK--
Sequence 2 FKEIDRVLFGEERQQQHGEESQEEGVIVELKREQIRELIKHAKSSSRKEL

Sequence 1 SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGA
           SS-D-PFNLR---PIYSNK-G---EITPEKNPQL-DLD-F-S-VDM-EG-
Sequence 2 SSQDEPFNLRNSNPIYSNKFGRWYEITPEKNPQLKDLDVFISSVDMKEGG

Sequence 1 LLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAE
           LLLPH-NSKAIVILVINEG-A-IELVG-------QQQ----LEV--YRAE
Sequence 2 LLLPHYNSKAIVILVINEGEAKIELVG----PSDQQQQDESLEVQRYRAE

Sequence 1 LSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQ
           LSE-D-FVIPA-YPV--NATSNLNFFA-GINAENNQRNFLAG--DNV-S-
Sequence 2 LSEDDVFVIPAAYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVMSE

Sequence 1 IPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KKKEEGNKGRKGPL
           IP--V----FP-S---VEKL-K-Q-ES-FVDAQP-----EEG-KGRKG-L
Sequence 2 IPTEVLDVSFPASGNKVEKLIKKQSESHFVDAQPEQQQREEGHKGRKGSL

Sequence 1 SSILRAFY
           SSIL---Y
Sequence 2 SSILGSLY



Alignment 7
Sequence 1:
Sequence 2: Allergen Vig r 2.0201, Sequence: B1NPN8
Sequence identity: 46.28 (280/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 ------------------------------------------------MV

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           R-------------------------RE----------R-KN-NPF-F-S
Sequence 2 RARIPLLLLLGILFLASLSVSFGIVHRENIDGAEVSVSRGKN-NPFYFNS

Sequence 1 NR-FETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN
           -R-F-TLF-NQ-G--RVLQRF-QRS-Q-QNL--YR--E--SKPNTLLLP-
Sequence 2 DRWFHTLFRNQFGHLRVLQRFDQRSKQMQNLENYRVVELMSKPNTLLLPH

Sequence 1 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD
           HADAD-L-V-LNG-A-L-LVN-D-RDS--L--G-A---P-GTT---VNPD
Sequence 2 HADADFLLVVLNGRAVLTLVNPDGRDSNILEQGHAQKIPAGTTFFLVNPD

Sequence 1 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK
           -NENLR-I-LA-PVN-P-RF--FFLSSTEAQQSYLQGFS-NILEAS-D--
Sequence 2 DNENLRIIKLAVPVNNPHRFQDFFLSSTEAQQSYLQGFSKNILEASFDSD

Sequence 1 FEEINKVLFSRE-EGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT
           --EI--VLF--E---QQQG----QE-VIVE---EQIR-L-K-AKSSS-K-
Sequence 2 IKEISRVLFGEEGQQQQQGQESQQEGVIVELKREQIRELTKHAKSSSKKS

Sequence 1 ISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG
           -SSED-PFNLR---PIYSNKLG--FEITPEKNPQLRDLD-F---VDM-EG
Sequence 2 LSSEDQPFNLRNQKPIYSNKLGRWFEITPEKNPQLRDLDMFIRSVDMKEG

Sequence 1 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRA
           -LLLPH-NSKAIVILVINEG-ANIELVG--EQQ--Q---E---EV--YRA
Sequence 2 SLLLPHYNSKAIVILVINEGKANIELVGQREQQKQQEEQEESWEVQRYRA

Sequence 1 ELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVIS
           ELSE-D-F-IPA-YPV--NATSNLNFFA-GINAENNQRNFLAG--DNVIS
Sequence 2 ELSEDDVFIIPATYPVAINATSNLNFFAFGINAENNQRNFLAGEKDNVIS

Sequence 1 QIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK--KEEGNKGRKGP
           -IP--V----FP-S---V-KL-K-Q-ES-FVDAQP-----EE--KG-KGP
Sequence 2 EIPTEVLDVTFPASGEKVKKLIKKQSESQFVDAQPEQQEREEARKGGKGP

Sequence 1 LSSILRAFY
           ---------
Sequence 2 FVY------



Alignment 8
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAA33947
Sequence identity: 35.37 (214/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS
           -------------------------------------SKRAKSSSRKTIS
Sequence 2 -------------------------------------SKRAKSSSRKTIS

Sequence 1 SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
           SEDKPFNL-SRDPIYS-KLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL
Sequence 2 SEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGAL

Sequence 1 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
           LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL
Sequence 2 LLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAEL

Sequence 1 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
           SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI
Sequence 2 SEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQI

Sequence 1 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSI
           PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP--KEEGNKGRKGPLSSI
Sequence 2 PSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSI

Sequence 1 LRAFY
           LRAFY
Sequence 2 LRAFY



Alignment 9
Sequence 1:
Sequence 2: Allergen Lup an 1.0101, Sequence: ACB05815
Sequence identity: 48.10 (291/605)
Sequence 1 --MMRARFPL--LLLGLVFL--ASVSVSFGIAYWEKENPKHNKCLQSCNS
           ---MR-R-P---LLLG-VFL--AS-----G-----K--PK----------
Sequence 2 MAKMRVRLPMLILLLGVVFLLAASIGIAYGEKDFTKNPPKEREEEEHEPR

Sequence 1 ERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKE
           -----R-Q----R--------EE---GE--R-R--------E--------
Sequence 2 QQPRPRQQEEQEREH----RREEKHDGEPSRGRSQSEESQEEEHERRREH

Sequence 1 EDEDEQPRPIPFPRPQPRQEEEHEQREEQEW-PRKEEKRGEKGSEEEDED
           --E-EQ------PRPQ-RQEEE-E---E-EW-PR--------------E-
Sequence 2 HREREQEQQ---PRPQRRQEEEEE---EEEWQPRRQRPQSRR-----EER

Sequence 1 EDEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNK
           E--EQ--------------E-R---E-------RE-E----S--RR--N-
Sequence 2 EEREQEQGSSSGSQRGGGDERRQHRERRVHREEREQEQDSRSDSRRQRN-

Sequence 1 NPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPN
           -P--F-SNRF-T---N--G-IRVL-RFNQR---L-NL--YRI-EF-SKPN
Sequence 2 -PYHFSSNRFQTYYRNRNGQIRVLERFNQRTNRLENLQNYRIIEFQSKPN

Sequence 1 TLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTY
           TL-LP-H-DAD---V-LNG-A----VN-D-R--Y-L--GDALR-P-GTT-
Sequence 2 TLILPKHSDADFILVVLNGRATITIVNPDKRQVYNLEQGDALRLPAGTTS

Sequence 1 YVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILE
           Y--NPD-N-NLR---LAIP-N-PG----F--S-T--QQSY--GFS-N-LE
Sequence 2 YILNPDDNQNLRVAKLAIPINNPGKLYDFYPSTTKDQQSYFSGFSKNTLE

Sequence 1 ASYDTKFEEINKVLFSREEGQQQGEQR-------LQESVIVEISKEQIRA
           A---T--EEI--VL----E-Q----QR---------E-VIV--SK-QI--
Sequence 2 ATFNTRYEEIERVLLGDDELQENEKQRRGQEQSHQDEGVIVRVSKKQIQE

Sequence 1 LSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDL
           L-K-A-SSS-----SE--PFNLRS--PIYSNK-G-F-EITP--NPQ--DL
Sequence 2 LRKHAQSSSGEGKPSESGPFNLRSNKPIYSNKFGNFYEITPDINPQFQDL

Sequence 1 DIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQ
           -I-L-----NEGALLLPH-NSKAI-I-V--EG--N-ELVG---QQ--Q--
Sequence 2 NISLTFTEINEGALLLPHYNSKAIFIVVVDEGEGNYELVGIRDQQRQQDE

Sequence 1 EEQPLE-----VRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINA
           -E---E-----VR-Y---LS--D-F-IPAG-P---NA-SNL-----GINA
Sequence 2 QEEEYEQGEEEVRRYSDKLSKGDVFIIPAGHPLSINASSNLRLLGFGINA

Sequence 1 ENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDA
           --NQRNFLAGS-DNVI-Q----V-EL-FPGS---VE-L-KNQ--SYF--A
Sequence 2 NENQRNFLAGSEDNVIKQLDREVKELTFPGSIEDVERLIKNQQQSYFANA

Sequence 1 QPKKKE----EGNKGRKGPLSSILRAFY
           QP--------EG--GR-GP-SSIL-A-Y
Sequence 2 QPQQQQQREKEGRRGRRGPISSILNALY



Alignment 10
Sequence 1:
Sequence 2: Allergen Len c 1.0101, Sequence: CAD87730
Sequence identity: 38.02 (230/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           --------------------------------------R----NPF-F-S
Sequence 2 -------------------------------------SRSDQENPFIFKS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           NRF-T---N--G-IR-LQRF--RS----NL--YR-LE--SKP-T--LP--
Sequence 2 NRFQTIYENENGHIRLLQRFDKRSKIFENLQNYRLLEYKSKPHTIFLPQF

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           -DAD---V-L-G-AIL---N--DR-S--L--GD----P-GT--Y--N-D-
Sequence 2 TDADFILVVLSGKAILTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
           NE-LR---LAIPVN-PG---SF-LS-T--Q-S-L-GFS-NILEA---T--
Sequence 2 NEDLRVLDLAIPVNRPGQLQSFLLSGTQNQPSFLSGFSKNILEAAFNTEY

Sequence 1 EEINKVLFSREEGQQQGEQRLQ--------ESVIVEISKEQIRALSKRAK
           EEI-KVL----E---Q----L---------E-VIV--S-EQI--LSK-AK
Sequence 2 EEIEKVLLEEQEQKSQHRRSLRDKRQEITNEDVIVKVSREQIEELSKNAK

Sequence 1 SSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSI
           SSS-K--SSE--PFNLRSR-PIYSNK-GKFFEITPEKNPQL-DLDIF---
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 VDMNEGALLLPHFNSKAIVILVINEGDANIELVGLK-EQQQEQ-------
           V---EG-LLLP--NS-AIVI---NEG----ELVG---E-QQEQ-------
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGDFELVGQRNENQQEQREENDEE

Sequence 1 --QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAE
           --Q-EE----V--YRA-LS--D--VIPAG-PV--NA-S-LN----GINA-
Sequence 2 EGQEEETTKQVQRYRARLSPGDVLVIPAGHPVAINASSDLNLIGFGINAK

Sequence 1 NNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ
           NNQRNFLAG--DNVISQI---V-ELAFPGS---V--LL-NQ--S-F--AQ
Sequence 2 NNQRNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQ

Sequence 1 PKKKEEGNKGRKGPLSSILRAFY
           P---E------------------
Sequence 2 PLQIE------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Len c 1.0102, Sequence: CAD87731
Sequence identity: 37.19 (225/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           --------------------------------------R----NPF-F-S
Sequence 2 -------------------------------------SRSDQENPFIFKS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           NRF-T---N--G-IR-LQ-F--RS----NL--YR-LE--SKP-TL-LP--
Sequence 2 NRFQTIYENENGHIRLLQKFDKRSKIFENLQNYRLLEYKSKPHTLFLPQY

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           -DAD---V-L-G-A-L---N--DR-S--L--GD----P-GT--Y--N-D-
Sequence 2 TDADFILVVLSGKAVLTVLNSNDRNSFNLERGDTIKLPAGTIAYLANRDD

Sequence 1 NENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKF
           NE-LR---LAIPVN-PG--ESF-LS-T--Q-S-L-GF---ILEA---T--
Sequence 2 NEDLRVLDLAIPVNNPGQLESFLLSGTQNQPSFLSGFNKSILEAAFNTDY

Sequence 1 EEINKVLFSREEGQQQGEQRL--------QESVIVEISKEQIRALSKRAK
           EEI-KVL----E---Q----L---------E-VIV--S-EQI--LSK-AK
Sequence 2 EEIEKVLLEDQEQEPQHRRSLRDRRQEINKENVIVKVSREQIKELSKNAK

Sequence 1 SSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSI
           SSS-K--SSE--PFNLRSR-PIYSNK-GKFFEITPEKNPQL-DLDIF---
Sequence 2 SSSKKSVSSESEPFNLRSRNPIYSNKFGKFFEITPEKNPQLQDLDIFVNS

Sequence 1 VDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ-------EQQ
           V---EG-LLLP--NS-AIVI---NEG----ELVG-----Q-------E-Q
Sequence 2 VEIKEGSLLLPNYNSRAIVIVTVNEGKGYFELVGQRNENQREENDDEEEQ

Sequence 1 QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQ
           -EE----V--YRA-LS--D-FV-PAG-PV--NA-S-LN----GINA-NNQ
Sequence 2 EEETSTQVQRYRAKLSPGDVFVVPAGHPVAINASSDLNLIGFGINAKNNQ

Sequence 1 RNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKK
           RNFLAG--DNVISQI---V-ELAFPGS---V--LL-NQ--S-F--AQP--
Sequence 2 RNFLAGEEDNVISQIQRPVKELAFPGSSREVDRLLTNQKQSHFANAQPLQ

Sequence 1 KEEGNKGRKGPLSSILRAFY
           -E------------------
Sequence 2 IE------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 33.55 (203/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPK-----HNKCLQSCNSE
           -----------------------G------ENP---------C---C---
Sequence 2 ----------------------RGRDDDDEENPRDPREQYRQCQEYCRRQ

Sequence 1 RDSYRNQA-CHARCNL-LKVEKEECEEGEIPRPRPRPQHPEREPQQPGEK
           ----R-Q--C--RC---L-------EE-E--R-R-------R-P-Q--E-
Sequence 2 GQGQRQQQQCQIRCEERLEEDQRSQEERERRRGRDVDDQNPRDPEQRYEQ

Sequence 1 EEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED
           -----E--R---------R--E---Q-EE-E--R----------------
Sequence 2 CQQQCERQRRGQEQTLCRRRCEQRRQQEERERQRGRDRQDPQQQYHRCQR

Sequence 1 E---DEEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRH
           -----E---ERQ----R---Q--ER---E----E---E------S--R--
Sequence 2 RCQIQEQSPERQ----RQCQQRCERQYKEQQGRERGPEASPRRESRGREE

Sequence 1 KNK--NPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEF
           -----NP--F-S-----------G----L-RF--R---L-----YR----
Sequence 2 EQQRHNPYYFHSQSIRSRHESEEGEVKYLERFTERTELLRGIENYRVVIL

Sequence 1 NSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVP
           ---PNT--LP-H-DA----V---G-A-L-LV----R-S--L--GD--RVP
Sequence 2 DANPNTSMLPHHKDAESVAVVTRGRATLTLVSQETRESFNLECGDVIRVP

Sequence 1 SGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEA-QQSYLQGF
           -G-T-YV-N-D-NE-L----L--PVN-PG-F------------QSYL--F
Sequence 2 AGATVYVINQDSNERLEMVKLLQPVNNPGQFREYYAAGAKSPDQSYLRVF

Sequence 1 SRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRAL
           S--IL-A---T-----------------Q-EQR--E-VI---S-E--RAL
Sequence 2 SNDILVAALNTPRDRLERFF-------DQQEQR--EGVIIRASQEKLRAL

Sequence 1 SKRAKSSSRKTIS--SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRD
           S--A-S---------S---P--L-S--P-YSN--G-FFE--PE---QL--
Sequence 2 SQHAMSAGQRPWGRRSSGGPISLKSESPSYSNQFGQFFEACPEEHRQLQE

Sequence 1 LDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQ---
           -D----------GA---PH-NSKA-V-----EG----E--------Q---
Sequence 2 MDVLVNYAEIKRGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSYE

Sequence 1 -----EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAI
           -----EQ--EE------K--A-L---DIFVIPAG-P----A--N-N----
Sequence 2 GQGRREQEEEESTGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLL

Sequence 1 G--INAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRE
           G--IN-ENNQR-FLAG-Q-N-I-Q------EL-F-------E-----Q-E
Sequence 2 GFDINGENNQRDFLAG-QNNIINQLEREAKELSFNMPREEIEEIFESQME

Sequence 1 SYFVDAQPKKKEEGNKGRKGPLSSILR-AFY
           SYFV---------G--GR--PL-SIL--AF-
Sequence 2 SYFVPTE-RQSRRG-QGRDHPLASILDFAFF



Alignment 13
Sequence 1:
Sequence 2: Allergen Car i 2.0101, Sequence: B3STU4
Sequence identity: 33.39 (202/605)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MVTKAKIPLFLFLSALFLALVCSSLALETEDLSNELNPHHDPESHRWEFQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCQERCQHEERGQRQAQQCQRRCEEQLREREREREREEIVDPREPRKQYE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QCRETCEKQDPRQQPQCERRCERQFQEQQERERRERRRGRDDDDKENPRD

Sequence 1 ------------------------MMRARFPLLLLGLVFLASVSVSFGIA
           -----------------------------------------------G--
Sequence 2 PREQYRQCEEHCRRQGQGQRQQQQCQSRCEERFEEEQRRQEERERRRGRD

Sequence 1 YWEKENPK-----HNKCLQSCNSERDSYRNQA-CHARCNL-LKVEKEECE
           ----ENP---------C---C-------R-Q--C--RC---L--E----E
Sequence 2 NDDEENPRDPREQYRQCQEHCRRQGQGQRQQQQCQSRCEERLEEEQRKQE

Sequence 1 EGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPR---PIPFPR---PQPRQ
           E-E--R-R-------R-P-Q--E------E--R--------R----Q-RQ
Sequence 2 ERERRRGRDEDDQNPRDPEQRYEQCQQQCERQRRGQEQQLCRRRCEQQRQ

Sequence 1 EEEHEQ---REEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQFPFPRPPH
           -EE-E----R--Q--P-----R-------------------Q----R---
Sequence 2 QEERERQRGRDRQD-PQQQYHRCQRRCQTQEQSPERQRQCQQ----RCER

Sequence 1 Q-KEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGSNRFETLFKN
           Q-KE----E---D----R--------E--RH---NP--F-S---------
Sequence 2 QYKEQQGREWGPDQASPRRESRGREEEQQRH---NPYYFHSQGLRSRHES

Sequence 1 QYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVI
           --G----L-RF--R---L-----YR-------PNT--LP-H-DA---IV-
Sequence 2 GEGEVKYLERFTERTELLRGIENYRVVILEANPNTFVLPYHKDAESVIVV

Sequence 1 LNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDNNENLRLITL
           --G-A-L--V----R-S--L--GD--RVP-G-T-YV-N-D-NE-L----L
Sequence 2 TRGRATLTFVSQERRESFNLEYGDVIRVPAGATEYVINQDSNERLEMVKL

Sequence 1 AIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFS
           --PVN-PG-F------------SYL--FS--IL-A---T-----------
Sequence 2 LQPVNNPGQFREYYAAGAQSTESYLRVFSNDILVAALNTPRDRLERFF--

Sequence 1 REEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTIS--SEDKPFN
           ------Q-EQR--E-VI---S-E--RALS--A-S---------S---P--
Sequence 2 -----DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRPWGRRSSGGPIS

Sequence 1 LRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNS
           L-S----YSN--G-FFE--PE---QL---D----------GA---PH-NS
Sequence 2 LKSQRSSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPHYNS

Sequence 1 KAIVILVINEGDANIELV---GLKEQ------QQEQQQEEQPL-EVRKYR
           KA-V-----EG----E---------Q--------EQ--EE-------K--
Sequence 2 KATVVVYVVEGTGRFEMACPHDVSSQSYEYKGRREQEEEESSTGQFQKVT

Sequence 1 AELSEQDIFVIPAGYPVVVNATSNLNFFAI--GINAENNQRNFLAGSQDN
           A-L---DIFVIPAG-P----A--N-N------GIN--NNQRNFLAG-Q-N
Sequence 2 ARLARGDIFVIPAGHPIAITASQNENLRLVGFGINGKNNQRNFLAG-QNN

Sequence 1 VISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKG
           -I-Q------EL-F-------E-----Q-ESYFV---------G--GR--
Sequence 2 IINQLEREAKELSFNMPREEIEEIFERQVESYFVPME-RQSRRG-QGRDH

Sequence 1 PLSSILRAFY--
           PL-SIL------
Sequence 2 PLASILDFAGFF



Alignment 14
Sequence 1:
Sequence 2: Allergen Jug n 2, Sequence: AAM54366
Sequence identity: 29.26 (177/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           -------------------R--Q--P-----R------------------
Sequence 2 ------------------GRDRQD-PQQQYHRCQRRCQIQEQSPERQRQC

Sequence 1 RQFPFPRPPHQ-KEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFG
           -Q----R---Q-KE----E--------RES---E--E--RH---NP--F-
Sequence 2 QQ----RCERQYKEQQGRERGPEASPRRESKGREE-EQQRH---NPYYFH

Sequence 1 SNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN
           S-----------G----L-RF--R---L-----YR-------PNT--LP-
Sequence 2 SQSIRSRHESEEGEVKYLERFAERTELLRGIENYRVVILDANPNTFMLPH

Sequence 1 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD
           H-DA---IV---G-A-L-LV----R-S--L--GD--RVP-G-T-YV-N-D
Sequence 2 HKDAESVIVVTRGRATLTLVSQETRESFNLECGDVIRVPAGATEYVINQD

Sequence 1 NNENLRLITLAIPVNKPGRFESFFLSSTEA-QQSYLQGFSRNILEASYDT
           -NE-L----L--PVN-PG--------------QSYL--FS--IL-A---T
Sequence 2 SNERLEMVKLLQPVNNPGQVREYYAAGAKSPDQSYLRVFSNDILVAALNT

Sequence 1 KFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT
           -----------------Q-EQR--E-VI---S-E--RALS--A-S-----
Sequence 2 PRDRLERFF-------DQQEQR--EGVIIRASQEKLRALSQHAMSAGQRP

Sequence 1 IS--SEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMN
           ----S---P--L-S--P-YSN--G-FFE--PE---QL---D---------
Sequence 2 WGRRSSGGPISLKSERPSYSNQFGQFFEACPEEHRQLQEMDVLVNYAEIK

Sequence 1 EGALLLPHFNSKAIVILVINEGDANIELV-------GLKEQ-QQEQQQEE
           -GA---PH-NSKA-V-----EG----E-------------Q---EQ--EE
Sequence 2 RGAMMVPHYNSKATVVVYVVEGTGRYEMACPHVSSQSFEDQGRREQEEEE

Sequence 1 QPLEVRKYRAELSEQDIFVIPAGYPVVVNATS--NLNFFAIGINAENNQR
           ------K--A-L---DIFVIPAG-P----A----NL-----GIN-ENNQR
Sequence 2 STGRFQKVTARLARGDIFVIPAGHPIAITASQNENLRLLGFGINGENNQR

Sequence 1 NFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKK
           NFLAG-Q---I-Q------EL-F-------E-----Q-ESYFV-------
Sequence 2 NFLAG-QNSIINQLEREAKELSFNMPREEIEEIFESQMESYFVPTE-RQS

Sequence 1 EEGNKGRKGPLSSILR-AFY
           --G--GR--PL-SIL--AF-
Sequence 2 RRG-QGRDHPLASILGFAFF



Alignment 15
Sequence 1:
Sequence 2: Allergen Mac i 1.0201, Sequence: Q9SPL4
Sequence identity: 31.90 (193/605)
Sequence 1 ---------------------------------------------MMRAR
           --------------------------------------------------
Sequence 2 MAINTSNLCSLLFLLSLFLLSTTVSLAESEFDRQEYEECKRQCMQLETSG

Sequence 1 FPLLLLGLVFLASVSVSFGIAYWEKENPKHN--KCLQSCNSERDSYRNQA
           ---------------------Y-----P------C---C-------R-Q-
Sequence 2 QMRRCVSQCDKRFEEDIDWSKYDNQDDPQTDCQQCQRRCRQQESGPRQQQ

Sequence 1 -CHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQPR
           -C--RC------KE-CEE-E------R---P-----Q--E--------PR
Sequence 2 YCQRRC------KEICEEEE---EYNRQRDPQQQYEQCQERCQRHETEPR

Sequence 1 PIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDERQ
           -------------E-E-R--Q----------E---EE----ED---D--Q
Sequence 2 HMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDNKRDPQQ

Sequence 1 FPFP---RPPHQKEERNEEEDEDE--EQQRESEESED------------S
           -------R---Q-E-R----------EQQR------D-------------
Sequence 2 REYEDCRRRCEQQEPRQQYQCQRRCREQQRQHGRGGDLINPQRGGSGRYE

Sequence 1 ELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRI
           E-------NP--F------T-F----G-I-VL--F--RS--L--L--YR-
Sequence 2 EGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKLLRALKNYRL

Sequence 1 LEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDAL
           ------PN---LP-H-DAD-------G---L-----D-R-SY-L--GD--
Sequence 2 VLLEANPNAFVLPTHLDADAILLVTGGRGALKMIHRDNRESYNLECGDVI

Sequence 1 RVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQ
           R-P-GTT-Y--N-DNNE-L-----------PG----FF---------YL-
Sequence 2 RIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAGGQNPEPYLS

Sequence 1 GFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR
           -FS--ILEA---T--E----VL---------G-QR--E-VI---S-EQIR
Sequence 2 TFSKEILEAALNTQAERLRGVL---------GQQR--EGVIISASQEQIR

Sequence 1 ALSKRAKSSSRKTI----SSEDKPFNLRSRDPIYSNKLGKFFEITPEKNP
           -L------S-R--I-----S---P-NL----P-YSNK-G---E--PE---
Sequence 2 ELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQAYEVKPEDYR

Sequence 1 QLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV-----G
           QL-D-D----I-----G----P-FN-------V---G-A--E-------G
Sequence 2 QLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADVEMACPHLSG

Sequence 1 LK--EQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF
           ------------EE---------A-LS-----V-P-G-PVV-----N-N-
Sequence 2 RHGGRRGGKRHEEEEDVHYEQVKARLSKREAIVVPVGHPVVFVSSGNENL

Sequence 1 --FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKN
           --FA-GINA-NN--NFLAG---NV--QI--Q--ELAF------VE-L---
Sequence 2 LLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAAPRKEVEELFNS

Sequence 1 QRESYFVDAQPKKKEEGNKGRKG--PLSSILRAFY-
           Q-ES-F---------------K---PL-SIL-----
Sequence 2 QDESIFFPGPRQHQQQSSRSTKQQQPLVSILDFVGF



Alignment 16
Sequence 1:
Sequence 2: Allergen Mac i 1.0101, Sequence: Q9SPL3
Sequence identity: 32.23 (195/605)
Sequence 1 ----MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKH--NKCLQSC-N
           ------------------------------Y---E-P------C---C--
Sequence 2 QCMQLETSGQMRRCVSQCDKRFEEDIDWSKYDNQEDPQTECQQCQRRCRQ

Sequence 1 SERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEK
           -E-D----Q-C--RC------KE-CEE-E------R---P-----Q----
Sequence 2 QESDPRQQQYCQRRC------KEICEEEE---EYNRQRDPQQQYEQCQKR

Sequence 1 EEDEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED
           -------PR-------------E-E-R--Q----------E---EE----
Sequence 2 CQRRETEPRHMQICQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKE

Sequence 1 EDEEQDERQFPFP---RPPHQKEERNEEEDED--EEQQRESEESED----
           -D---D--Q-------R---Q-E-R----------EQQR------D----
Sequence 2 GDNKRDPQQREYEDCRRHCEQQEPRLQYQCQRRCQEQQRQHGRGGDLMNP

Sequence 1 --------SELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQ
           ---------E-------NP--F------T-F----G-I-VL--F--RS--
Sequence 2 QRGGSGRYEEGEEKQSDNPYYFDERSLSTRFRTEEGHISVLENFYGRSKL

Sequence 1 LQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDS
           L--L--YR-------PN---LP-H-DAD-------G---L-----D-R-S
Sequence 2 LRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALKMIHRDNRES

Sequence 1 YRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSS
           Y-L--GD--R-P-GTT-Y--N-DNNE-L-----------PG----FF---
Sequence 2 YNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQYKEFFPAG

Sequence 1 TEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVI
           ------YL--FS--ILEA---T--E----VL---------G-QR--E-VI
Sequence 2 GQNPEPYLSTFSKEILEAALNTQTERLRGVL---------GQQR--EGVI

Sequence 1 VEISKEQIRALSKRAKSSSRKTI----SSEDKPFNLRSRDPIYSNKLGKF
           ---S-EQIR-L------S-R--I-----S---P-NL----P-YSNK-G--
Sequence 2 IRASQEQIRELTRDDSESRRWHIRRGGESSRGPYNLFNKRPLYSNKYGQA

Sequence 1 FEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANI
           -E--PE---QL-D-D----I-----G----P-FN-------V---G-A--
Sequence 2 YEVKPEDYRQLQDMDVSVFIANITQGSMMGPFFNTRSTKVVVVASGEADV

Sequence 1 ELV--GLKEQQQ-----EQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVV
           E-----L--------------EE--------RA-LS-----V--AG-PVV
Sequence 2 EMACPHLSGRHGGRGGGKRHEEEEEVHYEQVRARLSKREAIVVLAGHPVV

Sequence 1 VNATSNLNF--FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSA
           -----N-N---FA-GINA-NN--NFLAG---NV--QI--Q--ELAF--S-
Sequence 2 FVSSGNENLLLFAFGINAQNNHENFLAGRERNVLQQIEPQAMELAFAASR

Sequence 1 QAVEKLLKNQRESYFVDAQPKKKEEGNKGRKG--PLSSILRAFY-
           --VE-L---Q-ES-F---------------K---PL-SIL-----
Sequence 2 KEVEELFNSQDESIFFPGPRQHQQQSPRSTKQQQPLVSILDFVGF



Alignment 17
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43238
Sequence identity: 47.93 (290/605)
Sequence 1 MMRARF-PL-LLLGLVFLASVSVSFGIA--YWEK-ENPKHNKCLQSCNSE
           -MR-R--PL-LLLG---LASVS--------Y--K-ENP----CLQSC--E
Sequence 2 -MRGRVSPLMLLLGILVLASVSATHAKSSPYQKKTENPCAQRCLQSCQQE

Sequence 1 RDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEE
           -D-----AC--RC--L------C-----PR---------R-P--PGE---
Sequence 2 PDDLKQKACESRCTKLEYDPR-CVYD--PRGHTGTTN-QRSP--PGERTR

Sequence 1 DEDEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDED
           ----QP------R-QPR-EE---------W-------G--G--E----ED
Sequence 2 GR--QPGDYDDDRRQPRREEGGR------W-------GPAGPREREREED

Sequence 1 EEQDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNP
           --Q--------RP-HQ-------E----EQ------S---E-----N-NP
Sequence 2 WRQPREDWR--RPSHQQPRKIRPEGREGEQEWGTPGSHVRE-ETSRN-NP

Sequence 1 FLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTL
           F-F-S-RF-T---NQ-GRIRVLQRF-QRS-Q-QNL---RI-----KPNTL
Sequence 2 FYFPSRRFSTRYGNQNGRIRVLQRFDQRSRQFQNLQNHRIVQIEAKPNTL

Sequence 1 LLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYV
           -LP-HADAD---VI--G-A-----N---R-S--L--G-ALR-PSG---Y-
Sequence 2 VLPKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYI

Sequence 1 VNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEAS
           -N---N-NLR------PVN-PG-FE-FF--S---Q-SYLQGFSRN-LEA-
Sequence 2 LNRHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAA

Sequence 1 YDTKFEEINKVLFSREEGQQQ---GEQRL-------QESVIVEISKEQIR
           ----F-EI--VL-----G--Q---G--R---------E-VIV--SKE---
Sequence 2 FNAEFNEIRRVLLEENAGGEQEERGQRRWSTRSSENNEGVIVKVSKEHVE

Sequence 1 ALSKRAKSSSRKTISSE---DKPFNLRSRDPIYSNKLGKFFEITPEK-NP
           -L-K-AKS-S-K----E-----P-NLR---P--SN--GK-FE--P-K-NP
Sequence 2 ELTKHAKSVSKKGSEEEGDITNPINLREGEPDLSNNFGKLFEVKPDKKNP

Sequence 1 QLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGL-KEQ
           QL-DLD--L--V---EGAL-LPHFNSKA-VI-V-N-G--N-ELV---KEQ
Sequence 2 QLQDLDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQ

Sequence 1 QQEQQQEEQP----------LEVRKYRAELSEQDIFVIPAGYPVVVNATS
           QQ----EE-------------EVR-Y-A-L-E-D-F--PA--PV--NA-S
Sequence 2 QQRGRREEEEDEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASS

Sequence 1 NLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLL
           -L-----GINAENN-R-FLAG--DNVI-QI--Q---LAFPGS---VEKL-
Sequence 2 ELHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLI

Sequence 1 KNQRESYFVDAQPKKK-----------------EEGNKGRKGPLSSILRA
           KNQ-ES-FV-A-P--------------------EE-N-G-KGPL-SIL-A
Sequence 2 KNQKESHFVSARPQSQSQSPSSPEKESPEKEDQEEENQGGKGPLLSILKA

Sequence 1 FY
           F-
Sequence 2 FN



Alignment 18
Sequence 1:
Sequence 2: Allergen Ara h 1, Sequence: P43237
Sequence identity: 47.93 (290/605)
Sequence 1 MMRARF-PL-LLLGLVFLASVSVSFGIA-YWEKENPKHNKCLQSCNSERD
           -MR-R--PL-LLLG---LASVS-------Y---ENP----CLQSC--E-D
Sequence 2 -MRGRVSPLMLLLGILVLASVSATQAKSPYRKTENPCAQRCLQSCQQEPD

Sequence 1 SYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDE
           -----AC--RC--L------C-----------P--------QPG----D-
Sequence 2 DLKQKACESRCTKLEYDPR-CVYDTGATNQRHPPGERTRGRQPGDYDDD-

Sequence 1 DEQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEE
           ----------R-QPR-EE----------PR--E--------EED-----E
Sequence 2 ----------RRQPRREEGGRWGPAE--PRERER-------EEDWRQPRE

Sequence 1 QDERQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFL
           -D-R-----RP-HQ-------E----EQ------SE--E-----N-NPF-
Sequence 2 -DWR-----RPSHQQPRKIRPEGREGEQEWGTPGSEVRE-ETSRN-NPFY

Sequence 1 FGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLL
           F-S-RF-T---NQ-GRIRVLQRF-QRS-Q-QNL---RI------PNTL-L
Sequence 2 FPSRRFSTRYGNQNGRIRVLQRFDQRSKQFQNLQNHRIVQIEARPNTLVL

Sequence 1 PNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVN
           P-HADAD---VI--G-A-----N---R-S--L--G-ALR-PSG---Y--N
Sequence 2 PKHADADNILVIQQGQATVTVANGNNRKSFNLDEGHALRIPSGFISYILN

Sequence 1 PDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYD
           ---N-NLR------PVN-PG-FE-FF--S---Q-SYLQGFSRN-LEA---
Sequence 2 RHDNQNLRVAKISMPVNTPGQFEDFFPASSRDQSSYLQGFSRNTLEAAFN

Sequence 1 TKFEEINKVLFSREEGQQQ---GEQRL------QESVIVEISKEQIRALS
           --F-EI--VL-----G--Q---G--R--------E-VIV--SKE----L-
Sequence 2 AEFNEIRRVLLEENAGGEQEERGQRRRSTRSSDNEGVIVKVSKEHVQELT

Sequence 1 KRAKSSSRKTISSED--KPFNLRSRDPIYSNKLGKFFEITPEK-NPQLRD
           K-AKS-S-K----ED---P-NLR---P--SN--G--FE--P-K-NPQL-D
Sequence 2 KHAKSVSKKGSEEEDITNPINLRDGEPDLSNNFGRLFEVKPDKKNPQLQD

Sequence 1 LDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGL-KEQQQ--
           LD--L--V---EGAL-LPHFNSKA-VI-V-N-G--N-ELV---KEQQQ--
Sequence 2 LDMMLTCVEIKEGALMLPHFNSKAMVIVVVNKGTGNLELVAVRKEQQQRG

Sequence 1 --EQQQEEQPL---------EVRKYRAELSEQDIFVIPAGYPVVVNATSN
           --EQ--EE------------EVR-Y-A-L-E-D-F--PA--PV--NA-S-
Sequence 2 RREQEWEEEEEDEEEEGSNREVRRYTARLKEGDVFIMPAAHPVAINASSE

Sequence 1 LNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLK
           L-----GINAENN-R-FLAG--DNVI-QI--Q---LAFPGS---VEKL-K
Sequence 2 LHLLGFGINAENNHRIFLAGDKDNVIDQIEKQAKDLAFPGSGEQVEKLIK

Sequence 1 NQRESYFVDAQPKKK----------EEGNKGRKGPLSSILRAFY
           NQRES-FV-A-P-------------EE-N-G-KGPL-SIL-AF-
Sequence 2 NQRESHFVSARPQSQSPSSPEKEDQEEENQGGKGPLLSILKAFN



Alignment 19
Sequence 1:
Sequence 2: Allergen Ses i 3, Sequence: AAK15089
Sequence identity: 31.24 (189/605)
Sequence 1 -MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSY
           -----R--L-L--L-----V--S------E---P----C-----------
Sequence 2 MSCGGRLCLVLFALLLASAVVAS------ESKDPELKQC-----------

Sequence 1 RNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDED-
           --Q-C-A-----K--KE-C----------R--H--------G---E-E--
Sequence 2 KHQ-CKAQQQISKEQKEACIQAC--KEYIRQKHQGEHGRGGGDILEEEVW

Sequence 1 EQPRPIPFPRPQPRQ-EEEH-EQREEQEWPRKEEKRGEKGSEEEDEDEDE
           ----PI---R---R--E--H-EQREE------EE---EKG----D---D-
Sequence 2 NRKSPIERLRECSRGCEQQHGEQREECLRRCQEEYQREKGRQDDDNPTDP

Sequence 1 E--------QDERQFPFPRPPHQKEERNEEEDEDEEQQRES--------E
           E--------Q--RQ-----------ER--EE---E-Q-RE----------
Sequence 2 EKQYQQCRLQCRRQGEGGGFSREHCERRREEKYREQQGREGGRGEMYEGR

Sequence 1 ESEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNL
           E-E-----------P--F----F-T-F--Q-GR-RVLQ-F--RS--L---
Sequence 2 EREEEQEEQGRGRIPYVFEDQHFITGFRTQHGRMRVLQKFTDRSELLRGI

Sequence 1 RDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQ
           --YR-------P-T---PNH-DA--------G----SLV--D-R-S----
Sequence 2 ENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTISLVRQDRRESLNIK

Sequence 1 SGDALRVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQ
           -GD-L----GTT-Y--N-DNNE-L-L--L--PV--PG-FE-FF----E--
Sequence 2 QGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPGEFELFFGAGGENP

Sequence 1 QSYLQGFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEIS
           -S----FS--ILEA---T------------------G-QR----VIV--S
Sequence 2 ESFFKSFSDEILEAAFNTRRDRLQRIF---------GQQR--QGVIVKAS

Sequence 1 KEQIRALSKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKN
           -EQ-RA-S------------------N-----P--SN--G---E------
Sequence 2 EEQVRAMSRHEEGGIWPFGGESKGTINIYQQRPTHSNQYGQLHEVDASQY

Sequence 1 PQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELV--GLK
           -QLRDLD---S------GA---PH-NSKA--I-----G----E-------
Sequence 2 RQLRDLDLTVSLANITQGAMTAPHYNSKATKIALVVDGEGYFEMACPHMS

Sequence 1 EQQQEQQQEEQ--PLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--
           ------Q-E----P---------L-------IPAG-P-V--A-SN-N---
Sequence 2 RSRGSYQGETRGRP-SYQRVASRLTRGTVVIIPAGHPFVAVASSNQNLQV

Sequence 1 FAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQR
           -----NA-NN----LAG---NV--Q------ELAF---A--VE-----Q-
Sequence 2 LCFEVNANNNEKFPLAGRR-NVMNQLEREAKELAFGMPAREVEEVSRSQQ

Sequence 1 ESYFVDAQPKKKEEGNKGRKGPLSSILRAFY
           E--F----P-----G----------------
Sequence 2 EEFFFKG-PRQQQQGRADA------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Jug r 6.0101, Sequence: A0A2I4E5L6
Sequence identity: 26.12 (158/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------MAFKPK

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           ----------------------Q----K--K---------DE-E--E---
Sequence 2 IPIALLLLTSLLAICAGLALAMQDPELKQCKHQCRHQRQFDEQE-KEHCQ

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELR-RHKNKNPFLFG
           R------------ER-E-----E---RE-E--E--EL-------NP--F-
Sequence 2 RSCDEYHIEKKARERAERRRSEEGSSRE-EGYEEEELGGEREEENPYVFE

Sequence 1 SNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN
           ---FET------GRI-VL--F--RS--L------R-------P-T---P-
Sequence 2 DEDFETRVRTDEGRIQVLEKFTKRSKLLRGIENFRVAILEANPQTFISPA

Sequence 1 HADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPD
           H-DA--------G-A----V----R-------GD--R-P-GT--Y--N-D
Sequence 2 HFDAELVVFVAKGRATITTVREEKRENFNVEQGDIMRIPAGTPVYLINRD

Sequence 1 NNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK
           -NE-L-------PV--PG-FE-F--S--E---S----FS---LEA---T-
Sequence 2 ENEKLYIVKILRPVSVPGHFEAFHGSGGEDPESFYRAFSWEVLEAALKTR

Sequence 1 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI
           -----K-LF-----Q-QG-------VI---SKEQIR--SK------R---
Sequence 2 RDQLEK-LFGK---QTQG-------VIIKASKEQIRSMSKHEETTPRIWP

Sequence 1 SSED--KPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNE
           ---D---PFNL----P--SN--G--FE--P----QL-DLD---S------
Sequence 2 FGGDSTHPFNLFHKRPSQSNQFGRLFETDPKECKQLQDLDLMVSFANITK

Sequence 1 GALLLPHFNSKAIVILVINEGDANIELV--GLKEQQQEQQQEEQPLEVRK
           G----P--NS-A--I-V--EG----E-----L-------Q-E------R-
Sequence 2 GSMAGPYYNSRATKISVVIEGEGYFEMACPHLSSSGSRGQREGSGSSRRR

Sequence 1 YRAELSEQDI---------FVIPAGYPVVVNAT--SNLNFFAIGINAENN
           -R---S-Q-I---------FV-PAG-PV-V-A----NL-------NA--N
Sequence 2 SRSGPSYQQIRGRLRPGMVFVAPAGHPVAVIASRNKNLQVLCFDVNAQGN

Sequence 1 QRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPK
           -R--LAG---N----------ELAF---A--VEK---NQ----F------
Sequence 2 IRFPLAG-KNNIVNEFEKEAKELAFNFPAREVEKIFRNQDQEFFFPGPSR

Sequence 1 KKEEGNKGRKGPLSSILRAFY
           --EEG----------------
Sequence 2 QPEEGGRAFE-----------



Alignment 21
Sequence 1:
Sequence 2: Allergen Pis v 3.0101, Sequence: EF116865
Sequence identity: 26.78 (162/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           ---------------------------P----------------E---EQ
Sequence 2 ------------------------KTDPELKQCKHQCKVQRQYDEEQKEQ

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDED-------
           ---------------E-E--EE-EW--------E----E--E--------
Sequence 2 CAKGCEKYYKEKKGREQEEEEEEEWGSGRGRGDEFSTHEPGEKRLSQCMK

Sequence 1 EDEEQD---ERQFPFPR--PPHQKEERNEEEDEDEEQQRESEESEDSELR
           --E-QD-----Q----R------KE-R------DEE---E--E----E--
Sequence 2 QCERQDGGQQKQLCRFRCQEKYKKERREHSYSRDEEEEEEGDEEQEEE--

Sequence 1 RHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEF
           -----NP--F----F-T--K---G---VL--F--RS--L--L--YR----
Sequence 2 ---DENPYVFEDEHFTTRVKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFL

Sequence 1 NSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVP
           ---P-----PNH-DAD-------G-----------R-S-----GD--R--
Sequence 2 VANPQAFVVPNHMDADSIFFVSWGRGTITKIRENKRESMNVKQGDIIRIR

Sequence 1 SGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFS
           -GT--Y-VN-D-NE-L----L--PVN-PG--E-F-----E---S----FS
Sequence 2 AGTPFYIVNTDENEKLYIVKLLQPVNLPGHYEVFHGPGGENPESFYRAFS

Sequence 1 RNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALS
           R--LEA---T------K------EG------------IV--SKEQIRA-S
Sequence 2 REVLEAALKTPRDKLEKLFEKQDEG-----------AIVKASKEQIRAMS

Sequence 1 KRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLD
           -R----S-----------FNL---DP--SN--G--FE------P-L--LD
Sequence 2 RRGEGPSIWPFTGKSTGTFNLFKKDPSQSNNYGQLFESEFKDYPPLQELD

Sequence 1 IFLSIVDMNEGALLLPHFNSKA--IVILVINEGDANIELVGLKEQQQEQQ
           I--S-V----G----P--NS-A--I-I-V--EG---I----L-------Q
Sequence 2 IMVSYVNITKGGMSGPFYNSRATKIAIVVSGEGRLEIACPHLSSSKNSGQ

Sequence 1 QEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNF--FAIGINAEN
           ----P----K----------FV-PAG-P-V--A--N-N--------NAE-
Sequence 2 EKSGP-SYKKLSSSIRTDSVFVVPAGHPFVTVASGNQNLEILCFEVNAEG

Sequence 1 NQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQP
           N-R--LAG---N-I--------ELAF------V-K----Q-E--F----P
Sequence 2 NIRYTLAGKK-NIIEVMEKEAKELAFKTKGEEVDKVFGKQDEEFFFQG-P

Sequence 1 KKKEEGNKGRKGPLSSILRAFY
           K-------GR------------
Sequence 2 KWRQH-QQGRADE---------



Alignment 22
Sequence 1:
Sequence 2: Allergen Pin k 2.0101, Sequence: V9VGU0
Sequence identity: 19.34 (117/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 -----------------------------MAFVSLLTILLAISSSSVALT

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           -------------E-----------------------------NP--F-S
Sequence 2 EPVASMADQGVFPEQHGRGHHGVFPEEHGRGHHRGGREEEREENPYVFHS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           -RF--------G-IR-L--F---S--L-----YR------KPNT--LP--
Sequence 2 DRFRIRASSEAGEIRALPNFGEVSELLEGISRYRVTCIEMKPNTVMLPHY

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           -DA--------G------V---------L--GD---VPSG-T-Y-VN-D-
Sequence 2 IDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVNNDD

Sequence 1 NENLRLITLA-IPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTK
           ---LR---L--------G--E-F--------------FS---LEA---T-
Sequence 2 HNSLRIASLLRTESTMRGEYEPFYVAGGRNPETVYSAFSDDVLEAAFNTD

Sequence 1 FEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTI
           -------------G-----------VI-----EQIR----R---S---T-
Sequence 2 VQKLEHIFGAHRRG-----------VIFYANEEQIREMMRRGGFSAESTS

Sequence 1 SSED-KPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG
           -SE--KPFNLR---P---N--G-F----P--NP-L---D--------N-G
Sequence 2 ASEQPKPFNLRNQKPDFENDNGRFTRAGPKDNPFLDSVDVTVGFGVLNPG

Sequence 1 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQE-----QQQEEQPLEV
           ----P--N-KA--I----EG---IE-------Q------------Q----
Sequence 2 TMTAPSHNTKATSIAIVMEGEGRIEMACPHLGQEHGWSSPRERGHQDINY

Sequence 1 RKYRAELSEQDIFVIPAGYPVVVNATSN--LNFFAIGINAENNQRNFLAG
           ---RA-L------V-PAG-P----A--N--L------IN---N-R-FLAG
Sequence 2 ERVRARLRTGTVYVVPAGHPITEIASTNGRLEILWFDINTSGNEREFLAG

Sequence 1 SQDNVISQIPSQVQELAFP-GSAQAVEKLLKNQRESYFVDAQPKKKEEGN
           ---NV-------V--L-F--------E--L--Q-----------------
Sequence 2 -KNNVLQTLEKEVRHLSFNIPRGEEIEEVLQAQKDQVILRGPQRQRRDEP

Sequence 1 KGRKGPLSSILRAFY
           ---------------
Sequence 2 RSSS-----------



Alignment 23
Sequence 1:
Sequence 2: Allergen Cor a 11, Sequence: AAL86739
Sequence identity: 24.46 (148/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           ----------------------------------K---E---------DE
Sequence 2 -------------------------------MLPKEDPELKKCKHKCRDE

Sequence 1 RQFPFPRPPHQKEERNE--EEDEDEEQQRESEESEDSELRRHKNKNPFLF
           RQF-------Q--------EE---E-QQ-E---SE-S--------NP--F
Sequence 2 RQFD----EQQRRDGKQICEEKARERQQEEGNSSEES-YGKEQEENPYVF

Sequence 1 GSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLP
           ----FE---K---GR--VL--F--RS--L------R-------P-T---P
Sequence 2 QDEHFESRVKTEEGRVQVLENFTKRSRLLSGIENFRLAILEANPHTFISP

Sequence 1 NHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNP
           -H-DA--------G-A----V----R-S-----GD--R-P-GT--Y--N-
Sequence 2 AHFDAELVLFVAKGRATITMVREEKRESFNVEHGDIIRIPAGTPVYMINR

Sequence 1 DNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDT
           D-NE-L-------PV--PG-FE-F-----E---S----FS---LEA----
Sequence 2 DENEKLFIVKILQPVSAPGHFEAFYGAGGEDPESFYRAFSWEVLEAALKV

Sequence 1 KFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRK-
           --E---KV----------GEQ------IV--S-E-IRALS-------R--
Sequence 2 RREQLEKVF---------GEQ--SKGSIVKASREKIRALSQHEEGPPRIW

Sequence 1 TISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMN
           ----E---P-NL----P--SN--G---E--P----QL-DLD---S-----
Sequence 2 PFGGESSGPINLLHKHPSQSNQFGRLYEAHPDDHKQLQDLDLMVSFANIT

Sequence 1 EGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKY
           -G----P--NS-A--I-V--EG----E---------------------K-
Sequence 2 KGSMAGPYYNSRATKISVVVEGEGFFEMACPHLSSSSGSYQ-------KI

Sequence 1 RAELSEQDIFVIPAGYPVVVNAT--SNLNFFAIGINAENNQRNFLAGSQD
           -A-L-----FV-PAG-PV-V-A----NL-------NA--N-R--LAG---
Sequence 2 SARLRRGVVFVAPAGHPVAVIASQNNNLQVLCFEVNAHGNSRFPLAG-KG

Sequence 1 NVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRK
           N----------ELAF------VE---KNQ----F-----K--EEG--G--
Sequence 2 NIVNEFERDAKELAFNLPSREVERIFKNQDQAFFFPGPNKQQEEGGRGGR

Sequence 1 GPLSSILRAFY
           -----------
Sequence 2 AFE--------



Alignment 24
Sequence 1:
Sequence 2: Allergen Ana o 1.0102, Sequence: AAM73729
Sequence identity: 26.28 (159/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           ----------L------------------P-------Q-------DE---
Sequence 2 --PPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 PRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE
           -----------------E-EHE--EE-EW-------G--G--E----E--
Sequence 2 EQCVKECEKYYKEKKGREREHEE-EEEEW-------GTGGVDEPSTHEPA

Sequence 1 E----QDERQFPFPRPPHQKE-------ERNEEEDEDEEQQRESEESEDS
           E----Q--RQ--------QK--------ER---E-------RE--E-ED-
Sequence 2 EKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDE

Sequence 1 ELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRI
           --------NP--F----F-T--K---G----L--F-Q-S--L--L--YR-
Sequence 2 DEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL

Sequence 1 LEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDAL
           ------P-----P-H-DAD-------G-----------R-S-----GD--
Sequence 2 AVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIV

Sequence 1 RVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQ
           ---SGT--Y--N-D-NE-L-L-----PVN-PG-FE-F-----E---S---
Sequence 2 SISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYR

Sequence 1 GFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR
           -FS--ILEA---T------K-LF---E-Q-QG--------I---SKEQ-R
Sequence 2 AFSWEILEAALKTSKDTLEK-LF---EKQDQG-------TIMKASKEQVR

Sequence 1 ALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLR
           A-S-R-----------E----F-L---DP--SNK-G--FE------P-L-
Sequence 2 AMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLE

Sequence 1 DLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQ
           -LD---S------G----P--NS-A--I-----G----E-----------
Sequence 2 KLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLSS

Sequence 1 QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAE
           -----P----K-RA-------F--PAG-P----A--N-N--------NAE
Sequence 2 SKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE

Sequence 1 NNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ
           -N-R--LAG---N-I--------ELAF------V-K----Q-E--F----
Sequence 2 GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGP

Sequence 1 PKKKEEGNKGRKGPLSSILRAFY
           ---KE----GR------------
Sequence 2 EWRKEK--EGRADE---------



Alignment 25
Sequence 1:
Sequence 2: Allergen Ana o 1.0101, Sequence: AAM73730
Sequence identity: 26.45 (160/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           ----------L------------------P-------Q-------DE---
Sequence 2 MGPPTKFSFSLFLVSVLVLCLGFALAKIDPELKQCKHQCKVQRQYDEQQK

Sequence 1 PRPIP----FPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE
           -----------------E-EHE--EE-EW-------G--G--E----E--
Sequence 2 EQCVKECEKYYKEKKGREREHEE-EEEEW-------GTGGVDEPSTHEPA

Sequence 1 E----QDERQFPFPRPPHQKE-------ERNEEEDEDEEQQRESEESEDS
           E----Q--RQ--------QK--------ER---E-------RE--E-ED-
Sequence 2 EKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDDEDEDE

Sequence 1 ELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRI
           --------NP--F----F-T--K---G----L--F-Q-S--L--L--YR-
Sequence 2 DEAEEEDENPYVFEDEDFTTKVKTEQGKVVLLPKFTQKSKLLHALEKYRL

Sequence 1 LEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDAL
           ------P-----P-H-DAD-------G-----------R-S-----GD--
Sequence 2 AVLVANPQAFVVPSHMDADSIFFVSWGRGTITKILENKRESINVRQGDIV

Sequence 1 RVPSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQ
           ---SGT--Y--N-D-NE-L-L-----PVN-PG-FE-F-----E---S---
Sequence 2 SISSGTPFYIANNDENEKLYLVQFLRPVNLPGHFEVFHGPGGENPESFYR

Sequence 1 GFSRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIR
           -FS--ILEA---T------K-LF---E-Q-QG--------I---SKEQIR
Sequence 2 AFSWEILEAALKTSKDTLEK-LF---EKQDQG-------TIMKASKEQIR

Sequence 1 ALSKRAKSSSRKTISSEDK-PFNLRSRDPIYSNKLGKFFEITPEKNPQLR
           A-S-R-----------E----F-L---DP--SNK-G--FE------P-L-
Sequence 2 AMSRRGEGPKIWPFTEESTGSFKLFKKDPSQSNKYGQLFEAERIDYPPLE

Sequence 1 DLDIFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQ
           -LD---S------G----P--NS-A--I-----G----E-----------
Sequence 2 KLDMVVSYANITKGGMSVPFYNSRATKIAIVVSGEGCVEIAC---PHLSS

Sequence 1 QQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIG--INAE
           -----P----K-RA-------F--PAG-P----A--N-N--------NAE
Sequence 2 SKSSHP-SYKKLRARIRKDTVFIVPAGHPFATVASGNENLEIVCFEVNAE

Sequence 1 NNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQ
           -N-R--LAG---N-I--------ELAF------V-K----Q-E--F----
Sequence 2 GNIRYTLAGKK-NIIKVMEKEAKELAFKMEGEEVDKVFGKQDEEFFFQGP

Sequence 1 PKKKEEGNKGRKGPLSSILRAFY
           ---KE----GR------------
Sequence 2 EWRKEK--EGRADE---------



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m Bd28K, Sequence: BAB21619
Sequence identity: 17.69 (107/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPFLFGS
           ---------------------------------D-E----K--------S
Sequence 2 ----------KTTLLLLLFVLCHGVATTTMAFHDDEGGDKKSPKSLFLMS

Sequence 1 NRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPNH
           N-----FK---G--RVL-----R-------R---I------P--L--P--
Sequence 2 NSTR-VFKTDAGEMRVLKSHGGRIFY----RHMHIGFISMEPKSLFVPQY

Sequence 1 ADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVNPDN
           -D----I-I--G-A-L-----D-----RL--GD----PSG---Y-VN---
Sequence 2 LDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGE

Sequence 1 NENLRLITLAIPVNKPG--RFESFFLSSTEAQQSYLQGFSRNILEASYD-
           ---L--I----P----G---F-SF---------S-L-GF---ILE-----
Sequence 2 GQRLHVICSIDPSTSLGLETFQSFYIGGGANSHSVLSGFEPAILETAFNE

Sequence 1 --TKFEEI------NKVLF----------------SREEGQQQGEQRLQE
           --T--EEI----------F----------------------QQ-----Q-
Sequence 2 SRTVVEEIFSKELDGPIMFVDDSHAPSLWTKFLQLKKDDKEQQLKKMMQD

Sequence 1 SVIVEISKEQIRALSKRAKSSSRKT---ISSED---KP--FNLRS-RDPI
           ----E--K---R---K-------K----I---D----P---NL-------
Sequence 2 QEEDEEEKQTSRSWRKLLETVFGKVNEKIENKDTAGSPASYNLYDDKKAD

Sequence 1 YSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVILV
           --N--G----------P-L---DI----V----G--L-PH-N--------
Sequence 2 FKNAYGWSKALHGGEYPPLSEPDIGVLLVKLSAGSMLAPHVNPISDEYTI

Sequence 1 INEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGYPV
           ---G-------G-------------P---R---------D-FV-P---P-
Sequence 2 VLSGYGELH-IGY------------PNGSRAMKTKIKQGDVFVVPRYFPF

Sequence 1 --VVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGS
           --V------L-FF-----A--N---FLAG----------------AF--S
Sequence 2 CQVASRDGPLEFFGFSTSARKNKPQFLAGAASLLRTLMGPELSA-AFGVS

Sequence 1 AQAVEKLLKNQRESYFV-DAQPKKKEEGNKGRKGPLSSILRAFY------
           ----------Q-E------A-----E---K----------R-F-------
Sequence 2 EDTLRRAVDAQHEAVILPSAWAAPPENAGKLKMEEEPNAIRSFANDVVMD

Sequence 1 --
           --
Sequence 2 VF



Alignment 27
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 17.85 (108/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDEDEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDEEQDE
           --------------------------------------------------
Sequence 2 ---------------------------------------------MVSAM

Sequence 1 RQFPFPRPPHQKEERNEEEDEDEEQQRESEESEDSELRRHKNKNPF---L
           -------------------------Q----E-------------P----L
Sequence 2 GDRTASAILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSPEDRGL

Sequence 1 FGSNRFETLFKNQYGRIRVLQRFNQRSPQLQNLRDYRILEFNSKPNTLLL
           F---R-----K---G--R-------R-----N-----I------PNTL--
Sequence 2 FILRRSKEVLKTDAGEVRLMMGYRYRG----NHSPMHIGFITMEPNTLYI

Sequence 1 PNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRVPSGTTYYVVN
           P---DA--------G-A-------------RL-SG-----P-G---Y-VN
Sequence 2 PQYIDASLILFVRRGEAKVGYIYKNKLVEKRLKSGYVDAIPAGSSFYIVN

Sequence 1 PDNNENLRLI----TLAIPVNKPGRF-ESFFLSSTEAQQSYLQGFSRNIL
           -D--E-L--I----TL-------G----SF---------S-L-GF----L
Sequence 2 SDKSERLHIICSIDTLE-SMEYYGAYPQSFYVGGGVLPRSVLSGFDASTL

Sequence 1 EASYDTKFEEINKVLFSREEGQ------QQGEQRLQESVIVEISKEQI--
           -A------------L-S---G----------EQR---S-I----------
Sequence 2 SAAFNVSSDQLEMILNSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQE

Sequence 1 ---------------------RALSKR--AKSSSR----KTISSEDKPFN
           ---------------------R-L-K----K---R--------------N
Sequence 2 KEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYN

Sequence 1 LRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNS
           L----P-Y-N--G----I-------L---------V----GA-L-PH-N-
Sequence 2 LYDTEPSYQNDYGYSIAIDGHDYSALKHSNLGVYLVNLKAGAMLSPHVNP

Sequence 1 KAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
           -A-----I--G---I--V--------------P-------A--SE-D-F-
Sequence 2 TATEYGIILRGSGTIQVVF-------------PNGTAAMNAKVSEGDVFW

Sequence 1 IPAGYPV--VVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQ
           IP---P----------L-FF-----A--N---FL-G--------------
Sequence 2 IPRYFPFCQIASDGAPLEFFGFTTSARKNRPQFLVG-KSSLLHSMRGPEL

Sequence 1 ELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY
           --AF--S----E---K-QRE-------P----E---G-K------L----
Sequence 2 AAAFGVSEEQLERIVKAQREAVILPTSPHREMEEINGKKWKGEEVLVMKR

Sequence 1 ----
           ----
Sequence 2 GLFA



Alignment 28
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 15.21 (92/605)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP

Sequence 1 -----------------MMRARFPLLLLGLVFLASVSVSFGIAYWEKENP
           -----------------------------L-----V----G----E----
Sequence 2 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET

Sequence 1 KHNKCLQSCNSERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHP
           ------Q-----R-----Q-------------------------------
Sequence 2 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE

Sequence 1 EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEE---EHEQREEQEWPRKEE
           ---------K-----E-------P--Q--Q-E---E-E--E----P----
Sequence 2 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP

Sequence 1 KRGEKGSEEEDEDEDEEQDERQFPFP-RPPHQKEE----RNEEEDEDEEQ
           -R---G--E-DEDEDE--D----P-P-RP---K-E------E-EDEDE-Q
Sequence 2 RRPSHGKREQDEDEDEDEDK---PRPSRPSQGKREQDQDQDEDEDEDEDQ

Sequence 1 QRESEE--SEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR
           -R-S-E--S-----RR-----P---G---------N--------------
Sequence 2 PRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEEN-ICTLKLHENIARP

Sequence 1 S-PQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNND
           S-----N----RI---NS-----L------A-Y-----NG--I-S-----
Sequence 2 SRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG--IYS-----

Sequence 1 DRDSYRLQSGDALRVPSGT-TYYVVNPDNN-----ENLRLITLAIPVN--
           ------L-------V--G-----VVN---N-----E--R---L--P-N--
Sequence 2 --PHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFV

Sequence 1 ---KPGR--FESF-FLSSTEAQQSYLQGFSRNI----LEASYDTKFEEIN
           -----G---FE---F-----A--SYL----R-I----L--SY--------
Sequence 2 VAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVS

Sequence 1 KVLFSREEG------QQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT
           --------G-------QQG--R----------------------------
Sequence 2 ELKYEGNWGPLVNPESQQGSPRVKVA------------------------

Sequence 1 ISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVIS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SILRAFY
           -------
Sequence 2 -------



Alignment 29
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 11.90 (72/605)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 GQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 ---------------MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKH
           --------------------------------------------------
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGD

Sequence 1 NKCLQSCNSERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHPER
           -----------------------NL--V----------PR-------PE-
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EPQQPGEKE-EDEDEQPRPIPFPRP--QPRQEEEHEQREE-------QEW
           E--Q-G--------EQ-RP-----P---PRQ-E--------------Q--
Sequence 2 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL

Sequence 1 PRKEEKRGEKGSEEEDEDEDEEQDER---QFPFPRPPHQKEERNEEEDED
           --------E-------------Q--R------F--PP----ER--EE---
Sequence 2 AQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQ

Sequence 1 EEQQRESEESEDSELRRHKNKNPFL-------FGSNRFETLFKNQYGRIR
           E--Q-E--------L--------F---------G-------F----GRI-
Sequence 2 EQLQQERQQ-QGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS

Sequence 1 VLQRFNQRSPQLQNLRDYRILEFNSKPNTLLLPN-HADADYLIVILNGTA
           -L---N---P-L--LR------F----N----P-----A--------G-A
Sequence 2 TLNSHNL--PILRFLRLSAERGFFYR-NGIYSPHWNVNAHSVVYVIRGNA

Sequence 1 ILSLVN-NDDRD-SYRLQSGDALRVPSGTTYYVVNPDNNENLRLITLAIP
           ----VN-N-D-------Q-G----VP------V-----N-----------
Sequence 2 RVQVVNENGDAILDQEVQQGQLFIVPQN--HGVIQQAGNQGFEYFAFKTE

Sequence 1 VNKPGRFESFFLSSTEAQQSYLQGFSRNILEASYDTKFEEINKVLFSREE
           -------E--F--------S-L-------L---Y----E--------R-E
Sequence 2 -------ENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQE

Sequence 1 GQQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKTISSEDKPFNLRSRD
           ------------V-------------------------------------
Sequence 2 TIALSSSQQRRAVV------------------------------------

Sequence 1 PIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEGALLLPHFNSKAIVI
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFVIPAGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLSSILRAFY
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34289
Sequence identity: 8.93 (54/605)
Sequence 1 MMRARFPLLLLGLVFLASVSVSFGIAYWEKENPKHNKCLQSCNSERDSYR
           ---------LL-L--LA----------------------Q----------
Sequence 2 ------MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPL

Sequence 1 NQACHARCNLLKVEKEECEEGEIPRPRPRPQHPEREPQQPGEKEEDED--
           -Q---------------------P-P---PQ-P---PQQP----------
Sequence 2 SQQPQQTFPQPQQTFPHQPQQQVPQPQ-QPQQPFLQPQQPFPQQPQQPFP

Sequence 1 --EQPRPIPFPRPQPRQEEEHEQREEQEWPRKEEKRGEKGSEEEDEDEDE
           ---QP---PFP--QP-Q-----Q---Q--P--------------------
Sequence 2 QTQQPQQ-PFPQ-QPQQPFPQTQQPQQPFPQQPQQPFPQ-TQQPQQPFPQ

Sequence 1 EQDERQFPFPRPPHQKEERNEEEDEDEEQQRES-EESEDSELRRHKN---
           -Q---Q-PFP-P--Q-------------QQR-----S----L---KN---
Sequence 2 LQQPQQ-PFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNPCKNILL

Sequence 1 --KNPFLFGSNRFETLFKN---QYGRIRVLQRFNQRSPQLQNLRDYRILE
           ----P----S------------Q--R----Q---Q---QLQ---------
Sequence 2 QQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVH

Sequence 1 FNSKPNTLLLPNHADADYLIVILNGTAILSLVNNDDRDSYRLQSGDALRV
           ----------------D-------------------------Q----L--
Sequence 2 SIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEA

Sequence 1 PSGTTYYVVNPDNNENLRLITLAIPVNKPGRFESFFLSSTEAQQSYLQGF
           -------------N------------------------------------
Sequence 2 IRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQ------------

Sequence 1 SRNILEASYDTKFEEINKVLFSREEGQQQGEQRLQESVIVEISKEQIRAL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SKRAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 IFLSIVDMNEGALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRN
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 FLAGSQDNVISQIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 EGNKGRKGPLSSILRAFY
           ------------------
Sequence 2 ------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.