The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Tri a glutenin

Sequence 21743

Full FASTA alignment

Sequence name:
Query sequence:
MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
SLKVAKAQQLAAQLPAMCRLEGGDALLASQ

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Tri a gluteninCAA43331Go!830778.00.0e+00
2Tri a gluteninAAB02788Go!815463.03.9e-131
3Tri a gluteninCAA31395Go!839370.72.3e-103
4Tri a 26.0101P10388Go!839369.55.6e-103
5Tri a gluteninCAA43361Go!705291.31.6e-79
6Tri a gluteninCAA27052Go!838290.92.5e-79
7Tri a gluteninCAA31396Go!648227.03.4e-60
8Tri a gluteninCAA26847Go!660195.41.1e-50
9Tri a gluteninCAA24933Go!101100.56.3e-23
10Tri a 36.0101AEH31546Go!36960.72.1e-10
11Tri a gluteninCAA30570Go!35660.62.3e-10
12Tri a gliadinAAA34289Go!32759.64.1e-10
13Tri a gliadinAAA34279Go!31357.41.8e-09
14Tri a gliadinCAA26385Go!31357.41.8e-09
15Tri a 21.0101CAY54134Go!28156.62.9e-09
16Tri a gliadinAAA34278Go!31954.51.4e-08
17Tri a gliadinAAA34275Go!31853.03.9e-08
18Tri a gliadinBAA11251Go!27952.25.8e-08
19Tri a gliadinAAA34274Go!29151.88.4e-08
20Tri a gliadinAAA34285Go!30451.88.5e-08
21Tri a gliadinAAA34290Go!29651.41.1e-07
22Tri a gliadinCAA26383Go!29650.91.6e-07
23Tri a gluteninCAA44473Go!28550.61.8e-07
24Tri a gluteninCAA59339Go!26149.53.6e-07
25Tri a gliadinCAA35238Go!30749.44.6e-07
26Hor v 21P80198Go!28949.05.8e-07
27Tri a gliadinAAA34272Go!30248.49.1e-07
28Tri a gluteninCAA59340Go!27648.29.6e-07
29Tri a gliadinAAA34276Go!29147.71.4e-06
30Tri a gliadinCAA26384Go!28647.31.8e-06
31Sin a 2.0101Q2TLW0Go!51048.02.1e-06
32Tri a gliadinAAA34282Go!29746.82.6e-06
33Tri a gliadinAAA34280Go!28646.63.1e-06
34Tri a gliadinCAA25593Go!28646.24.0e-06
35Tri a gluteninCAA31685Go!30746.04.9e-06
36Tri a gliadinAAA34288Go!25144.89.1e-06
37Tri a gluteninCAA36063Go!29544.71.2e-05
38Tri a gliadinAAA34286Go!32344.61.3e-05
39Tri a gliadinAAA34281Go!26244.21.4e-05
40Pru du 6.0101ADN39440Go!55145.21.5e-05
41Tri a gliadinAAA17741Go!28744.31.5e-05
42Tri a gluteninCAA59338Go!22944.01.5e-05
43Tri a gliadinAAA34283Go!28243.91.9e-05
44Pru du 63EHK_AGo!53144.72.1e-05
45Tri a gliadinCAA25261Go!28642.07.2e-05
46Tri a gluteninCAA24934Go!3938.79.7e-05
47Pru du 6.0201ADN39441Go!50441.61.7e-04
48Tri a gliadinAAA34287Go!24440.12.3e-04
49Tri a gliadinAAA34284Go!18635.73.8e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43331
Sequence identity: 100.00 (830/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
Sequence 2 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
Sequence 2 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
Sequence 2 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
Sequence 2 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
Sequence 2 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
Sequence 2 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
Sequence 2 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
           QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
Sequence 2 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP

Sequence 1 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
           GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
Sequence 2 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
           QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
Sequence 2 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG

Sequence 1 LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
           LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
Sequence 2 LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS

Sequence 1 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
           PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
Sequence 2 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG

Sequence 1 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
           YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
Sequence 2 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA

Sequence 1 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
Sequence 2 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 2
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: AAB02788
Sequence identity: 97.47 (809/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
Sequence 2 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
Sequence 2 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQ------EYYLTSPQ
Sequence 2 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQ------EYYLTSPQ

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           QSGQWQQPGQGQ-GYYPTSPQQSGQ-QPGYYPTSPWQPEQLQQPTQGQQR
Sequence 2 QSGQWQQPGQGQSGYYPTSPQQSGQKQPGYYPTSPWQPEQLQQPTQGQQR

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
Sequence 2 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
Sequence 2 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
Sequence 2 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
Sequence 2 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQ--QGEQGQQPGQGQQGQ
Sequence 2 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQQRQGEQGQQPGQGQQGQ

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
Sequence 2 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
           QQPGQGQQ---------PGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
Sequence 2 QQPGQGQQ---------PGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP

Sequence 1 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
           GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
Sequence 2 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
           QGQQPG-GQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
Sequence 2 QGQQPGEGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG

Sequence 1 LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
           -PGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
Sequence 2 QPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS

Sequence 1 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
           PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
Sequence 2 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG

Sequence 1 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
           YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
Sequence 2 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA

Sequence 1 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
Sequence 2 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 3
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31395
Sequence identity: 78.31 (650/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQ---EHSLKACRQVV
           M-KRLVLF-AVVVALVALT-AEGEAS-QLQCERELQ---E--LKAC-QV-
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 DQQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQS
           DQQLRD-SPEC-PV---PVA-QYEQQ-VVPPKGGSFYPGETTPPQQLQQ-
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 ILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLT
           I-WGIPALL-RYY-SVT-PQQVSYYPGQAS-QRPGQGQQPGQGQQ-YY-T
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 SPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQG
           SPQQ-GQWQQP-QGQ-GYYPTSPQQ-----PG----------QLQQP-QG
Sequence 2 SPQQPGQWQQPEQGQQGYYPTSPQQ-----PG----------QLQQPAQG

Sequence 1 QQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ-QPGQLQQLAQGQQGQ
           QQ---PGQGQQ------GQQ-GQGQP-YYPTSSQ-QPGQLQQ-AQGQQGQ
Sequence 2 QQ---PGQGQQ------GQQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQ

Sequence 1 QPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQG
           QP---QQGQQ-GQGQQ-GQGQQGQQPGQ-QQ-GQGQQG------QQLGQG
Sequence 2 QPGQAQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQG------QQLGQG

Sequence 1 QQ---------SGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQ
           QQ---------SGQGQ-GYYPTS-QQ-GQGQSGYYPTS-QQPGQ-QQ--Q
Sequence 2 QQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQ

Sequence 1 EQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQ
           -QQ-----Q-QQ-GQG-QGQQ-GQ-QQ-QQ-GQGQQPGQ-QPGYY-TSPQ
Sequence 2 LQQ---PAQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQ

Sequence 1 QLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQG
           Q-GQGQP-YYPTS-QQP----------------Q-QQP-QGQQGQQ-GQG
Sequence 2 QSGQGQPGYYPTSSQQP---------------TQSQQPGQGQQGQQVGQG

Sequence 1 EQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQ
           -Q-QQPGQGQQ---PGQGQPGYYPTSPQQSGQGQPGYY-TSPQQSGQ-QQ
Sequence 2 QQAQQPGQGQQ---PGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQGQQ

Sequence 1 P------AQGQQPGQEQQGQQPGQGQQGQQPGQGQ---QPGQGQPGYYPT
           P------AQGQ---Q--QGQQPGQGQQGQQPGQGQ---QPGQGQPGYYPT
Sequence 2 PGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPT

Sequence 1 SPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQG
           SPQQSGQ-QQ--QWQQ-GQGQPG-YPTSPLQPGQGQPGY-PTSPQQ-GQG
Sequence 2 SPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQG

Sequence 1 QQPGQLQQPTQGQQGQQ---------------------------------
           QQPGQLQQP-QGQQGQQ---------------------------------
Sequence 2 QQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQ

Sequence 1 ---------------------PGQGQQGQQPGQGQQGQQPGQGQQPGQGQ
           ---------------------PGQGQ-GQQPGQGQQGQQPGQGQQPGQGQ
Sequence 2 GQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQ

Sequence 1 PGYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQ
           P-YYPTS-Q-SGQGQQPGQWQQPGQG-PGYY-T-S-----GQQGYYPTS-
Sequence 2 PWYYPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSL

Sequence 1 QQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGY
           QQPGQG-QPGQWQQSGQGQ--YYPTSP--SGQGQ-PGQWLQPGQ--Q-GY
Sequence 2 QQPGQGQQPGQWQQSGQGQHWYYPTSPKLSGQGQRPGQWLQPGQG-QQGY

Sequence 1 YLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYP
           Y-TSPQQ--QGQQ--QWLQP-QGQQGYYPTS-QQ-GQGQQ-GQGQQGYY-
Sequence 2 YPTSPQQPPQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYY-

Sequence 1 TSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGD
           --------------S-YHVS-EHQAASLKVAKAQQLAAQLPAMCRLEGGD
Sequence 2 --------------SSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGD

Sequence 1 ALLASQ
           AL-ASQ
Sequence 2 ALSASQ



Alignment 4
Sequence 1:
Sequence 2: Allergen Tri a 26.0101, Sequence: P10388
Sequence identity: 78.07 (648/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQ---EHSLKACRQVV
           M-KRLVLF-AVVVALVALT-AEGEAS-QLQCERELQ---E--LKAC-QV-
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 DQQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQS
           DQQLRD-SPEC-PV---PVA-QYEQQ-VVPPKGGSFYPGETTPPQQLQQ-
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR

Sequence 1 ILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLT
           I-WGIPALL-RYY-SVT-PQQVSYYPGQAS-QRPGQGQQPGQGQQ-YY-T
Sequence 2 IFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPT

Sequence 1 SPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQG
           SPQQ-GQW--P-QGQ-GYYPTSPQQ-----PG----------QLQQP-QG
Sequence 2 SPQQPGQWEEPEQGQQGYYPTSPQQ-----PG----------QLQQPAQG

Sequence 1 QQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ-QPGQLQQLAQGQQGQ
           QQ---PGQGQQ------GQQ-GQGQP-YYPTSSQ-QPGQLQQ-AQGQQGQ
Sequence 2 QQ---PGQGQQ------GQQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQ

Sequence 1 QPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQG
           QP---QQGQQ-GQGQQ-GQGQQGQQPGQ-QQ-GQGQQG------QQLGQG
Sequence 2 QPGQAQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQG------QQLGQG

Sequence 1 QQ---------SGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQ
           QQ---------SGQGQ-GYYPTS-QQ-GQGQSGYYPTS-QQPGQ-QQ--Q
Sequence 2 QQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQ

Sequence 1 EQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQ
           -QQ-----Q-QQ-GQG-QGQQ-GQ-QQ-QQ-GQGQQPGQ-QPGYY-TSPQ
Sequence 2 LQQ---PAQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQ

Sequence 1 QLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQG
           Q-GQGQP-YYPTS-QQP----------------Q-QQP-QGQQGQQ-GQG
Sequence 2 QSGQGQPGYYPTSSQQP---------------TQSQQPGQGQQGQQVGQG

Sequence 1 EQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQ
           -Q-QQPGQGQQ---PGQGQPGYYPTSPQQSGQGQPGYY-TSPQQSGQ-QQ
Sequence 2 QQAQQPGQGQQ---PGQGQPGYYPTSPQQSGQGQPGYYLTSPQQSGQGQQ

Sequence 1 P------AQGQQPGQEQQGQQPGQGQQGQQPGQGQ---QPGQGQPGYYPT
           P------AQGQ---Q--QGQQPGQGQQGQQPGQGQ---QPGQGQPGYYPT
Sequence 2 PGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQPGYYPT

Sequence 1 SPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQG
           SPQQSGQ-QQ--QWQQ-GQGQPG-YPTSPLQPGQGQPGY-PTSPQQ-GQG
Sequence 2 SPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQG

Sequence 1 QQPGQLQQPTQGQQGQQ---------------------------------
           QQPGQLQQP-QGQQGQQ---------------------------------
Sequence 2 QQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQ

Sequence 1 ---------------------PGQGQQGQQPGQGQQGQQPGQGQQPGQGQ
           ---------------------PGQGQ-GQQPGQGQQGQQPGQGQQPGQGQ
Sequence 2 GQQPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPGQGQ

Sequence 1 PGYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQ
           P-YYPTS-Q-SGQGQQPGQWQQPGQG-PGYY-T-S-----GQQGYYPTS-
Sequence 2 PWYYPTSPQESGQGQQPGQWQQPGQGQPGYYLTFSVAARTGQQGYYPTSL

Sequence 1 QQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGY
           QQPGQG-QPGQWQQSGQGQ--YYPTSP--SGQGQ-PGQWLQPGQ--Q-GY
Sequence 2 QQPGQGQQPGQWQQSGQGQHWYYPTSPKLSGQGQRPGQWLQPGQG-QQGY

Sequence 1 YLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYP
           Y-TSPQQ--QGQQ--QWLQP-QGQQGYYPTS-QQ-GQGQQ-GQGQQGYY-
Sequence 2 YPTSPQQPPQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYY-

Sequence 1 TSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGD
           --------------S-YHVS-EHQAASLKVAKAQQLAAQLPAMCRLEGGD
Sequence 2 --------------SSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGD

Sequence 1 ALLASQ
           AL-ASQ
Sequence 2 ALSASQ



Alignment 5
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA43361
Sequence identity: 60.00 (498/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVD--
           M-KRLVLFA-VV--LVALTAAEGEAS-QLQCERELQE-SL-ACRQVVD--
Sequence 2 MAKRLVLFATVVITLVALTAAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 ----------------QQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGS
           ----------------QQLRDVS--C-PV----V-RQYEQ--VVPPKGGS
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRPVAVSQVVRQYEQ-TVVPPKGGS

Sequence 1 FYPGETTPPQQLQQSILWGIPA-LLRRYYLSVTSPQQVSYYPGQASSQRP
           FYPGETTP-QQLQQ-I-WG--------YY-SV-SPQQ--YYPGQAS-Q-P
Sequence 2 FYPGETTPLQQLQQVIFWGTSSQTVQGYYPSVSSPQQGPYYPGQASPQQP

Sequence 1 GQGQQPGQGQQEYYLTSPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYY
           GQGQQPG----------------WQ--GQGQ-GYYPTS--QSGQ-Q-GYY
Sequence 2 GQGQQPGK---------------WQELGQGQQGYYPTSLHQSGQGQQGYY

Sequence 1 PTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ
           P-S----------------QQPGQGQQ--QGQQG---------YYPTS-Q
Sequence 2 PSS---------------LQQPGQGQQIGQGQQG---------YYPTSLQ

Sequence 1 QPGQLQQLAQGQQGQQPERGQ---QGQQSGQGQQLGQGQQ---GQQPGQK
           QPGQ-QQ--QGQQG--P---Q---Q-QQ-GQGQQ-GQGQQ---G-Q-GQ-
Sequence 2 QPGQGQQIGQGQQGYYPTSPQHPGQRQQPGQGQQIGQGQQLGQGRQIGQG

Sequence 1 QQSGQGQQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTS
           QQSGQGQQGYYP-SPQQLGQGQQ-GQ-Q---------QSGQGQ-GYYPTS
Sequence 2 QQSGQGQQGYYPTSPQQLGQGQQPGQWQ---------QSGQGQQGYYPTS

Sequence 1 AQQPGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPG
           -QQPGQ------------------------GQQ-GQ----QQ-----QPG
Sequence 2 QQQPGQ------------------------GQQ-GQYPASQQ-----QPG

Sequence 1 QRQPGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQP
           Q-Q-G-Y--S-QQ-GQGQ---YP-S-QQPGQ------------GQQG---
Sequence 2 QGQQGQYPASQQQPGQGQQGQYPASQQQPGQ------------GQQGHY-

Sequence 1 EQGQQGQQPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYY
           ----Q-QQPGQG-Q---P---QQ---PGQGQ-G-Y--S-QQ-GQGQ-G-Y
Sequence 2 -LASQ-QQPGQGQQRHYPASLQQ---PGQGQQGHYTASLQQPGQGQQGHY

Sequence 1 PTSPQQSGQLQQPAQGQQPGQEQQGQQPGQGQQ---GQQPGQGQQPGQGQ
           P-S-QQ-GQ------GQQ-GQ--Q-QQPGQGQQ---GQQ--QGQQPGQGQ
Sequence 2 PASLQQVGQ------GQQIGQLGQRQQPGQGQQTRQGQQLEQGQQPGQGQ

Sequence 1 PGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSP
           ---------Q--Q-QQLEQ----GQ-----------QPGQGQ-GYYPTSP
Sequence 2 ---------QTRQGQQLEQ----GQ-----------QPGQGQQGYYPTSP

Sequence 1 QQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQ
           QQ-GQGQQPGQ-QQP-QGQQG---------QQPGQG-QG--P---QQPGQ
Sequence 2 QQSGQGQQPGQSQQPGQGQQGYY---SSSLQQPGQGLQGHYPASLQQPGQ

Sequence 1 GQPGYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQG------Q
           G-PG------QQ-GQGQQP-Q-QQPGQG--GYYPTS--QP-QG------Q
Sequence 2 GHPGQR----QQPGQGQQPEQGQQPGQGQQGYYPTSPQQPGQGKQLGQGQ

Sequence 1 QGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQP
           QGYYPTS-QQPGQG-QPGQ------GQQG--PTSPQQ-GQ-QQPGQ----
Sequence 2 QGYYPTSPQQPGQGQQPGQ------GQQGHCPTSPQQTGQAQQPGQ----

Sequence 1 GQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLG
           GQ------------Q-GQ-QQP-Q------GQQGYYP-S-QQSGQGQQ-G
Sequence 2 GQ------------QIGQVQQPGQ------GQQGYYPISLQQSGQGQQSG

Sequence 1 QGQQ---GYYPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQ
           QGQQ---G------QQSGQ-QQGYD-PYHV--E-Q-AS-KVAK-QQ-A-Q
Sequence 2 QGQQSGQGHQLGQGQQSGQEQQGYDNPYHVNTEQQTASPKVAKVQQPATQ

Sequence 1 LPAMCRLEGGDALLASQ
           LP-MCR-EGGDAL-ASQ
Sequence 2 LPIMCRMEGGDALSASQ



Alignment 6
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA27052
Sequence identity: 78.67 (653/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQ---EHSLKACRQVV
           M-KRLVLF-AVVVALVALT-AEGEAS-QLQCERELQ---E--LKAC-QV-
Sequence 2 MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM

Sequence 1 DQQLRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQS
           DQQLRD-SPEC-PV---PVA-QYEQQ-VVP-KGGSFYPGETTPPQQLQQ-
Sequence 2 DQQLRDISPECHPVVVSPVAGQYEQQIVVP-KGGSFYPGETTPPQQLQQR

Sequence 1 ILWGIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQE----
           I-WGIPALL-RYY-SVTSPQQVSYYPGQAS-QRPGQGQQPGQGQQ-----
Sequence 2 IFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQ

Sequence 1 --YYLTSPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQL
           --YY-TSPQQ-GQWQQP-QGQ---------------PGYYPTSP-QP-QL
Sequence 2 QGYYPTSPQQPGQWQQPEQGQ---------------PGYYPTSPQQPGQL

Sequence 1 QQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ-QPGQLQQLA
           QQP-QGQQ---PGQGQQ------G-Q-GQGQP-YYPTSSQ-QPGQLQQ-A
Sequence 2 QQPAQGQQ---PGQGQQ------GRQPGQGQPGYYPTSSQLQPGQLQQPA

Sequence 1 QGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISP
           QGQQGQQP--GQQGQQ-GQGQQ-GQGQQGQQPGQ-QQ-GQGQQG------
Sequence 2 QGQQGQQPGQGQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQG------

Sequence 1 QQLGQGQQ---------SGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQ
           QQLGQGQQ---------SGQGQ-GYYPTS-QQ-GQGQSGYYPTS-QQPGQ
Sequence 2 QQLGQGQQGYYPTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQ

Sequence 1 LQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGY
           -QQ--Q-QQ--Q-QQ--Q---G-QGQQ-GQ-QQ-QQ-GQGQQPGQ-QPGY
Sequence 2 GQQPGQLQQPAQGQQPEQ---GQQGQQPGQGQQGQQPGQGQQPGQGQPGY

Sequence 1 YSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQG
           Y-TSPQQ-GQGQP-YYPTS-QQP----------------Q-QQP-QGQQG
Sequence 2 YPTSPQQSGQGQPGYYPTSSQQP---------------TQSQQPGQGQQG

Sequence 1 QQPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQ
           QQ-GQG-Q-QQPGQGQQ---PGQGQPGYYPTSP-QSGQGQPGYY-TSPQQ
Sequence 2 QQVGQGQQAQQPGQGQQ---PGQGQPGYYPTSPLQSGQGQPGYYLTSPQQ

Sequence 1 SGQLQQP------AQGQQPGQEQQGQQPGQGQQGQQPGQGQQ---PGQGQ
           SGQ-QQP------AQGQ---Q--QGQQPGQGQQGQQPGQGQQ---PGQGQ
Sequence 2 SGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQ

Sequence 1 PGYYPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSP
           PGYYPTSPQQSGQ-QQ--QWQQ-GQGQPG-YPTSPLQPGQGQPGY-PTSP
Sequence 2 PGYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSP

Sequence 1 QQIGQGQQPGQLQQPTQGQQGQQ---------------------------
           QQ-GQGQQPGQLQQP-QGQQGQQ---------------------------
Sequence 2 QQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQ

Sequence 1 ---------------PGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPT
           ---------------P-QGQQGQQPGQGQQGQQPGQGQQPGQGQP-YYPT
Sequence 2 LGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYYPT

Sequence 1 SLQQSGQGQQPGQWQQPGQ------GLPGYYPTSSLQPEQGQQGYYPTSQ
           S-Q-SGQGQQPGQWQQPGQ------G-PGYY-TS-LQ--QGQQGYYPTS-
Sequence 2 SPQESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSL

Sequence 1 QQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGY
           QQPGQG-QPGQWQQSGQGQ-GYYPTSPQ-SGQGQ-PGQWLQPGQ--Q-GY
Sequence 2 QQPGQGQQPGQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQG-QQGY

Sequence 1 YLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYP
           Y-TSPQQ-GQGQQ--QWLQP-QGQQGYYPTS-QQ-GQGQQ-GQGQQGYY-
Sequence 2 YPTSPQQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYY-

Sequence 1 TSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGD
           --------------S-YHVS-EHQAASLKVAKAQQLAAQLPAMCRLEGGD
Sequence 2 --------------SSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGD

Sequence 1 ALLASQ
           AL-ASQ
Sequence 2 ALSASQ



Alignment 7
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31396
Sequence identity: 56.75 (471/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           M-KRLVLFAAVV-ALVALT-AEGEAS-QLQCERELQE-SL-ACRQVVDQQ
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 L------------------RDVSPECQPVGGGPVARQYEQQVVVPPKGGS
           L------------------RDVS--C--V----VARQYEQ--VVPPKGGS
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQ-TVVPPKGGS

Sequence 1 FYPGETTPPQQLQQSILWGIPA-LLRRYYLSVTSPQQVSYYPGQASSQRP
           FYPGETTP-QQLQQ-I-WG--------YY--VTSP-Q-SYYPGQAS-Q-P
Sequence 2 FYPGETTPLQQLQQGIFWGTSSQTVQGYYPGVTSPRQGSYYPGQASPQQP

Sequence 1 GQGQQPGQGQQEYYLTSPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYY
           GQGQQPG----------------WQ-PGQGQ--YYPTS------------
Sequence 2 GQGQQPGK---------------WQEPGQGQQWYYPTS------------

Sequence 1 PTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ
           -------------------QQPGQGQQ---GQQG---------YYPTS-Q
Sequence 2 ------------------LQQPGQGQQIGKGQQG---------YYPTSLQ

Sequence 1 QPGQLQQLAQGQQGQQPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQG
           QPGQ------GQQG--P------Q--GQ-QQ-----QGQQP-Q-QQ-GQ-
Sequence 2 QPGQ------GQQGYYPT---SLQHTGQRQQ---PVQGQQPEQGQQPGQW

Sequence 1 QQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQ
           QQGYYP-SPQQLGQGQQ---------P---QQSGQGQ-G-YPTS-QQPGQ
Sequence 2 QQGYYPTSPQQLGQGQQ---------PRQWQQSGQGQQGHYPTSLQQPGQ

Sequence 1 LQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGY
           ------------------------GQQ-G-----QQ-----QPGQ-Q-G-
Sequence 2 ------------------------GQQ-GHYLASQQ-----QPGQGQQGH

Sequence 1 YSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQG
           Y--S-QQ-GQGQ---YP-S-QQPGQ------------GQQG--P---Q--
Sequence 2 YPASQQQPGQGQQGHYPASQQQPGQ------------GQQGHYPASQQE-

Sequence 1 QQPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQ
           --PGQG-QGQ-P---QQ---PGQGQ-G-YP-S-QQ-GQGQ-G-YPTS-QQ
Sequence 2 --PGQGQQGQIPASQQQ---PGQGQQGHYPASLQQPGQGQQGHYPTSLQQ

Sequence 1 SGQLQQPAQGQQPGQEQQGQQPGQGQ---QGQQPGQGQQPGQGQPGYYPT
           -GQ------GQQ-GQ--Q-QQPGQGQ---QGQQP-Q-QQPGQGQ-GYYPT
Sequence 2 LGQ------GQQTGQPGQKQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPT

Sequence 1 SPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQG
           S-QQ-GQ-QQ-------GQGQ-G-YPTS--QPGQGQ-G-YP-S-------
Sequence 2 SLQQPGQGQQ------QGQGQQGYYPTSLQQPGQGQQGHYPAS-------

Sequence 1 QQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYY
           -----LQQP-QGQ-GQ--------QQPGQGQ----P-QG-QPGQGQ-GYY
Sequence 2 -----LQQPGQGQPGQR-------QQPGQGQH---PEQGKQPGQGQQGYY

Sequence 1 PTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPG
           PTS-QQ-GQGQQ-GQ---------------------GQQGYYPTS-QQPG
Sequence 2 PTSPQQPGQGQQLGQ---------------------GQQGYYPTSPQQPG

Sequence 1 QGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTS
           QG-QPGQ------GQQG--PTSPQQSGQ-QQPGQ----GQ----------
Sequence 2 QGQQPGQ------GQQGHCPTSPQQSGQAQQPGQ----GQ----------

Sequence 1 PQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQ---QGYYPT
           --Q-GQ-QQP-Q------GQQGYYPTS-QQ-GQGQQ-GQGQ---QG--P-
Sequence 2 --QIGQVQQPGQ------GQQGYYPTSVQQPGQGQQSGQGQQSGQGHQPG

Sequence 1 SPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDA
           --QQSGQ-QQGYDSPYHVSAE-QAAS--VAKAQQ-A-QLP--CR-EGGDA
Sequence 2 QGQQSGQEQQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEGGDA

Sequence 1 LLASQ
           L-ASQ
Sequence 2 LSASQ



Alignment 8
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA26847
Sequence identity: 56.99 (473/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           M-KRLVLFAAVV-ALVALT-AEGEAS-QLQCERELQE-SL-ACRQVVDQQ
Sequence 2 MAKRLVLFAAVVIALVALTTAEGEASRQLQCERELQESSLEACRQVVDQQ

Sequence 1 L------------------RDVSPECQPVGGGPVARQYEQQVVVPPKGGS
           L------------------RDVS--C--V----VARQYEQ--VVPPKGGS
Sequence 2 LAGRLPWSTGLQMRCCQQLRDVSAKCRSVAVSQVARQYEQ-TVVPPKGGS

Sequence 1 FYPGETTPPQQLQQSILWGIPA-LLRRYYLSVTSPQQVSYYPGQASSQRP
           FYPGETTP-QQLQQ-I-WG--------YY-SVTSP-Q-SYYPGQAS-Q-P
Sequence 2 FYPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYPGQASPQQP

Sequence 1 GQGQQPGQGQQEYYLTSPQQSGQWQQPGQGQAGYYPTSPQQSGQEQPGYY
           GQGQQPG----------------WQ-PGQGQ--YYPTS------------
Sequence 2 GQGQQPGK---------------WQEPGQGQQWYYPTS------------

Sequence 1 PTSPWQPEQLQQPTQGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQ
           -------------------QQPGQGQQ---G-QG---------YYPTS-Q
Sequence 2 ------------------LQQPGQGQQIGKGKQG---------YYPTSLQ

Sequence 1 QPGQLQQLAQGQQGQQPERGQ---QGQQSGQGQQLGQGQQGQQPGQKQQS
           QPGQ-QQ--QGQQG--P---Q---Q-QQ--QGQQ-GQGQQ---P-Q-QQ-
Sequence 2 QPGQGQQIGQGQQGYYPTSPQHTGQRQQPVQGQQIGQGQQ---PEQGQQP

Sequence 1 GQGQQGYYPISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQ
           GQ-QQGYYP-SPQQLGQGQQ-GQ-Q---------QSGQGQ-G-YPTS-QQ
Sequence 2 GQWQQGYYPTSPQQLGQGQQPGQWQ---------QSGQGQQGHYPTSLQQ

Sequence 1 PGQLQQSTQEQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQ
           PGQ------------------------GQQ-G-----QQ-----QP-Q-Q
Sequence 2 PGQ------------------------GQQ-GHYLASQQ-----QPAQGQ

Sequence 1 PGYYSTSPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQG
           -G-Y--S-QQ-GQGQ---YP-S-QQPGQ------------GQQG--P---
Sequence 2 QGHYPASQQQPGQGQQGHYPASQQQPGQ------------GQQGHYPASQ

Sequence 1 QQGQQPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTS
           Q----PGQG-QGQ-P---QQ---PGQGQ-G-YP-S-QQ-GQ---G-YPTS
Sequence 2 QE---PGQGQQGQIPASQQQ---PGQGQQGHYPASLQQPGQ--QGHYPTS

Sequence 1 PQQSGQLQQPAQGQQPGQEQQGQQPGQGQ---QGQQPGQGQQPGQGQPGY
           -QQ-GQ------GQQ-GQ--Q-QQPGQGQ---QGQQP-Q-QQPGQGQ-GY
Sequence 2 LQQLGQ------GQQIGQPGQKQQPGQGQQTGQGQQPEQEQQPGQGQQGY

Sequence 1 YPTSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQI
           YPTS-QQ-GQ-QQ-------GQGQ-G-YPTS--QPGQGQ-G-YP-S-QQ-
Sequence 2 YPTSLQQPGQGQQ------QGQGQQGYYPTSLQQPGQGQQGHYPASLQQP

Sequence 1 GQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQP
           GQGQ----------GQ-GQ--------QQPGQGQ----P-QGQQPGQGQ-
Sequence 2 GQGQ----------GQPGQR-------QQPGQGQH---PEQGQQPGQGQQ

Sequence 1 GYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQ
           GYYPTS-QQ-GQGQQ-GQ---------------------GQQGYYPTS-Q
Sequence 2 GYYPTSPQQPGQGQQLGQ---------------------GQQGYYPTSPQ

Sequence 1 QPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYY
           QPGQG-QPGQ------GQQG--P-SPQQ-GQ-QQ----------------
Sequence 2 QPGQGQQPGQ------GQQGHCPMSPQQTGQAQQ----------------

Sequence 1 LTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQ---GY
           ------LGQGQQ--Q--QP-QGQQGYYPTS-QQ-GQGQQ-GQGQQ---G-
Sequence 2 ------LGQGQQIGQVQQPGQGQQGYYPTSLQQPGQGQQSGQGQQSGQGH

Sequence 1 YPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEG
           -P---QQSGQ--QGYDSPYHVSAE-QAAS--VAKAQQ-A-QLP--CR-EG
Sequence 2 QPGQGQQSGQEKQGYDSPYHVSAEQQAASPMVAKAQQPATQLPTVCRMEG

Sequence 1 GDALLASQ
           GDAL-ASQ
Sequence 2 GDALSASQ



Alignment 9
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA24933
Sequence identity: 11.93 (99/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
           -------------------------------LGQGQQPRQWLQPRQGQQG
Sequence 2 -----------------------------EKLGQGQQPRQWLQPRQGQQG

Sequence 1 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
           YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
Sequence 2 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA

Sequence 1 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
Sequence 2 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ



Alignment 10
Sequence 1:
Sequence 2: Allergen Tri a 36.0101, Sequence: AEH31546
Sequence identity: 15.30 (127/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           ------------------------------------Q------PG-E---
Sequence 2 -----------------MKTFLIFALLAIVATSAIAQMENSHIPGLERPS

Sequence 1 QQ-PGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQ
           QQ-P---QQ-----Q-QQP-Q-QP---P-S-QQ----QQ--Q---S-Q-Q
Sequence 2 QQQPLPPQQTLSHHQQQQPIQQQP--QPFSQQQPCSQQQ--QQPLSQQQQ

Sequence 1 PGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQG
           P---P-S--QP---Q----P-S-QQ----Q-P---QQP---QQ-QQP---
Sequence 2 P---PFSQQQPPFSQQQQQPLSQQQ----QPPFSQQQPPFSQQ-QQPPFS

Sequence 1 QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQS--GQGQQPGQWQQP
           QQ--QP---QQ-QQP---QQP---Q----P-S-QQS---Q-QQ----QQP
Sequence 2 QQ--QPPFSQQ-QQPVLPQQPSFSQQQLPPFSQQQSPFSQQQQIVLQQQP

Sequence 1 GQGLPGYYPTSSLQP---EQGQQGYYPTSQQQPGQGPQPGQWQQSGQ--G
           ---L----P----QP----Q-QQ---P--QQ-P---P---Q---------
Sequence 2 -PFLQQQQPSLPQQPPFSQQQQQLVLP-QQQIPFVHPSILQQLNPCKVFL

Sequence 1 QQGYYPTS-PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQW
           QQ---P---PQ-----Q---Q--------Q----L----Q-------R--
Sequence 2 QQQCSPVAMPQSLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAI

Sequence 1 -----LQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQG-QQ
           -----LQ--Q--QG---T-PQQ--Q-QQLGQ--------S-QQ-GQ--QQ
Sequence 2 IYSIILQEQQQVQGSIQT-PQQ--QPQQLGQCVSQPQQQSQQQLGQQPQQ

Sequence 1 GYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ-----
           -----------HQ-A-L-V-----L---LP-MCR----------------
Sequence 2 QQLAQGTFLQPHQIAQLEVMTSIALRT-LPTMCRVNVPLYRTTTSVPFGV

Sequence 1 -------
           -------
Sequence 2 GTGVGSY



Alignment 11
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA30570
Sequence identity: 14.58 (121/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           ----------------------------QQ-Q-P----Q-QQP---QQ-Q
Sequence 2 ------MKTFLVFALLALAAASAVAQISQQQQAPPFSQQ-QQPPFSQQ-Q

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           QP---Q----P-S-QQ----QP-----------Q-QQP---QQP---QQ-
Sequence 2 QPPFSQQQQSPFSQQQQ---QPPF--------AQQQQPPFSQQPPISQQQ

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
           Q-P---QQ--Q--Q-QQP--------P-S-QQ-----Q--Q---S-Q-QP
Sequence 2 QPPFSQQQQPQFSQQQQP--------PYSQQQQPPYSQQQQPPFSQQQQP

Sequence 1 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQP-GQLQQPTQGQQGQQPGQG
           ------P----Q-QP----T--QQ--Q-QQP--Q-QQP---QQ---P---
Sequence 2 ------PFSQQQQQPPF--TQQQQQQQQQQPFTQQQQPPFSQQ---PPIS

Sequence 1 QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQ
           QQ-QQP---QQ-Q-P----Q--Q--P---P--LQQ------P-------Q
Sequence 2 QQ-QQPPFLQQ-QRPPFSRQ--QQIPVIHPSVLQQ----LNPCKVFLQQQ

Sequence 1 GLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPT
           --P-------------QQ------QQQ--Q-------Q------------
Sequence 2 CIPVAMQRCLARSQMLQQSICHVMQQQCCQQLRQIPEQSRHESIRAIIYS

Sequence 1 SPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQG-QQPRQWLQPRQGQ
           ---Q--Q-QQ--Q--Q-GQ-----Y----PQQLGQ---QP-Q-LQ---GQ
Sequence 2 IILQQQQQQQQQQQQQQGQSIIQ-YQQQQPQQLGQCVSQPLQQLQQQLGQ

Sequence 1 QGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQ
           Q------PQQ-----Q--Q-------------------------------
Sequence 2 Q------PQQQQLAHQIAQLEVMTSIALRTLPTMCNVNVPLYETTTSVPL

Sequence 1 AASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -----V--------------------------
Sequence 2 GVGIGVGVY-----------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34289
Sequence identity: 13.73 (114/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           -----------------------------------T--------------
Sequence 2 ---------------------------------MKTLLILTILAMAITIG

Sequence 1 GQGRQGQQSGQRQ--QDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYP
           ----Q---SGQ-Q--Q-Q---Q-QQP---QP------PQQ----QP----
Sequence 2 TANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQV

Sequence 1 TSPQQPGQEQQPR-QLQQPEQGQQGQQP-EQGQQGQQPGQGEQGQQP-GQ
           --PQQP---QQP--Q-QQP---QQ-QQP--Q-QQ-QQP----Q-QQP--Q
Sequence 2 PQPQQP---QQPFLQPQQPFP-QQPQQPFPQTQQPQQPFP-QQPQQPFPQ

Sequence 1 GQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQS-GQLQQPAQGQQP
           -QQ-QQP--------P--PQQ-----P------PQQ---QLQQP---QQP
Sequence 2 TQQPQQP-------FPQQPQQ-----PFPQTQQPQQPFPQLQQP---QQP

Sequence 1 GQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQ
           ----Q-Q-P----Q-QQP-Q---P-Q--P---P---QQ----------QQ
Sequence 2 FPQPQQQLP----QPQQPQQSF-PQQQRPFIQPSLQQQLNPCKNI-LLQQ

Sequence 1 SGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPT------
           S----------S---P------------QQ--Q---P-QLQ---------
Sequence 2 SKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQ--IPQQLQCAAIHSVVH

Sequence 1 ----QGQQGQQPGQG-------QQGQQPGQGQ--QGQQPGQGQQPGQGQP
           ----Q-QQ-QQ--QG--------Q--Q-GQG---QGQ---Q-QQP-Q---
Sequence 2 SIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEA

Sequence 1 GYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQ
           --------------------------P-----------------------
Sequence 2 IRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQ------------

Sequence 1 QPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LLASQ
           -----
Sequence 2 -----



Alignment 13
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34279
Sequence identity: 12.29 (102/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ---------------------MKTFLILALVATTATTAVRVPVPQLQPKN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ-Q-P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFPGQQQQFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP---QP---P--P----Q--P---P--PQQ-----QP---QQP---Q
Sequence 2 FPQP---QP-FLPQLPYPQPQSFPPQQPY-PQQRPKYLQP---QQPISQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQG--QPGYYPTSP---QQ------SGQEQ
           Q-QQ--Q-QQ-QQ--Q-QQ--Q---Q----P------QQ------S-Q--
Sequence 2 QAQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVL

Sequence 1 QLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQP
           Q----Q---Q---------P-Q----Q------------Q--Q--QLQQ-
Sequence 2 QQSTYQLLQQLCCQQLLQIPEQ-SRCQAIHNVVHAIIMHQQEQQQQLQQQ

Sequence 1 TQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQ
           -Q-Q--QQ--Q-QQ-QQP------QQP-Q-Q-P---Q----P-------Q
Sequence 2 QQQQLQQQQQQQQQQQQPSSQVSFQQPQQ-QYPSS-QGSFQPSQQNPQAQ

Sequence 1 GQ-QPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQW
           G--QP-Q--Q----------T--------------T-----G--------
Sequence 2 GSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN---

Sequence 1 QQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------------
Sequence 2 --------------------------------------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26385
Sequence identity: 12.29 (102/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ---------------------MKTFLILALVATTATTAVRVPVPQLQPKN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ-Q-P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFPGQQQQFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP---QP---P--P----Q--P---P--PQQ-----QP---QQP---Q
Sequence 2 FPQP---QP-FLPQLPYPQPQSFPPQQPY-PQQRPMYLQP---QQPISQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQG--QPGYYPTSP---QQ------SGQEQ
           Q-QQ--Q-QQ-QQ--Q-QQ--Q---Q----P------QQ------S-Q--
Sequence 2 QAQQQQQQQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVL

Sequence 1 QLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQP
           Q----Q---Q---------P-Q----Q------------Q--Q--QLQQ-
Sequence 2 QQSTYQLLQQLCCQQLLQIPEQ-SRCQAIHNVVHAIIMHQQEQQQQLQQQ

Sequence 1 TQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQ
           -Q-Q--QQ--Q-QQ-QQP------QQP-Q-Q-P---Q----P-------Q
Sequence 2 QQQQLQQQQQQQQQQQQPSSQVSFQQPQQ-QYPSS-QGSFQPSQQNPQAQ

Sequence 1 GQ-QPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQW
           G--QP-Q--Q----------T--------------T-----G--------
Sequence 2 GSVQPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGIFGTN---

Sequence 1 QQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------------
Sequence 2 --------------------------------------------



Alignment 15
Sequence 1:
Sequence 2: Allergen Tri a 21.0101, Sequence: CAY54134
Sequence identity: 12.65 (105/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           -------------------------------------------P---P--
Sequence 2 --------------------------------------VRVPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQG
           P-QQ--QEQ-P---QQ---GQQ-QQ---GQQ---P-Q-----QP----Q-
Sequence 2 PSQQQPQEQVPLVQQQQFLGQQ-QQHFPGQQQPFPPQ-----QPYPQPQP

Sequence 1 QQPGQGQPGYYPTSPQQS-GQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --P----P---P--PQQS--Q-QP--YP--PQQ----QQ-AQ-QQ--Q-Q
Sequence 2 FLPQLPYPQPQPFPPQQSYPQPQP-QYP-QPQQPIS-QQQAQLQQQQQQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQG
           Q-QQ--Q----QQ----------QP-----S-Q-S-Q--QL-Q-Q---Q-
Sequence 2 Q-QQILQQILQQQLIPCRDVVLQQPNIAHASSQVSQQSYQLLQ-QLCCQ-

Sequence 1 QPGHYPT-SPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPG
           Q----P--S--Q-------------QQ----QQ--Q-QQ--Q-QQ-QQ--
Sequence 2 QLWQTPEQSRCQAIHNVIHAIILHHQQ----QQQQQQQQQQQQQQQQQQQ

Sequence 1 QGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQG-QQPGQWQQ
           Q-QQ-QQP------QQP-Q-Q-P--GQ----P-------QG--QP-Q--Q
Sequence 2 QQQQQQQPSSQVSYQQPQQ-QYPS-GQGSFQPSQQNPQAQGFVQPQQLPQ

Sequence 1 PGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGY
           ----------T-----------Y--T-----G------------------
Sequence 2 FEEIRNLALQTLPAMCNVYIPPYCSTTIAPFGIFSTN-------------

Sequence 1 YPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------
Sequence 2 ----------------------------------



Alignment 16
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34278
Sequence identity: 12.41 (103/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ------------------MKTFLILALLAIVATTATTAVRVPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ-Q-P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFPGQQQQFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGY-YPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQE
           --QP----P---YP--PQ-----QP--YP----Q--Q-QQP---QQ--Q-
Sequence 2 FPQPQPFPPQLPYP-QPQSFPPQQP--YPQQQPQYLQPQQPISQQQAQQQ

Sequence 1 QQGQQPGQGQQG--QQPGQGQQ-PGQG---QPGYYPTSPQQSGQEQQLEQ
           QQ-QQ--Q-QQ---QQ--Q-Q--P------Q---------Q--Q------
Sequence 2 QQQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQL

Sequence 1 WQQSGQGQPGHYPT-SPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQG
           -QQ----Q----P--S--Q-------------QQ--Q--Q--QLQQ--Q-
Sequence 2 LQQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQ

Sequence 1 QQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQ-
           QQ--Q--Q-QQ-QQP------QQP-Q-Q-P---Q----P--L----QG--
Sequence 2 QQQLQQQQQQQQQQPSSQVSFQQPQQ-QYPSS-QVSFQPSQLNPQAQGSV

Sequence 1 QPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQS
           QP-Q--Q----------T--------------T-----G-----------
Sequence 2 QPQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN------

Sequence 1 GQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -----------------------------------------
Sequence 2 -----------------------------------------



Alignment 17
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34275
Sequence identity: 12.41 (103/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ------------------MKTFLILALLAIVATTATTAVRVPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ-Q-P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFPGQQQQFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP----P--YP--PQ-----QP--YP----Q--Q-QQP---QQ--Q-Q
Sequence 2 FPQPQPFPPLPYP-QPQSFPPQQP--YPQQQPQYLQPQQPISQQQAQQQQ

Sequence 1 QGQQPGQGQQG--QQPGQGQQ-PGQG---QPGYYPTSPQQSGQEQQLEQW
           Q-QQ--Q-QQ---QQ--Q-Q--P------Q---------Q--Q-------
Sequence 2 QQQQQQQQQQQILQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSTYQLL

Sequence 1 QQSGQGQPGHYPT-SPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQ
           QQ----Q----P--S--Q-------------QQ--Q--Q--QLQQ--Q-Q
Sequence 2 QQLCCQQLLQIPEQSQCQAIHNVAHAIIMHQQQQQQQEQKQQLQQQQQQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQ-Q
           Q--Q--Q-QQ-QQP------QQP-Q-Q-P---Q----P--L----QG--Q
Sequence 2 QQLQQQQQQQQQQPSSQVSFQQPQQ-QYPSS-QVSFQPSQLNPQAQGSVQ

Sequence 1 PGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSG
           P-Q--Q----------T--------------T-----G------------
Sequence 2 PQQLPQFAEIRNLALQTLPAMCNVYIPPHCSTTIAPFGISGTN-------

Sequence 1 QGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 WLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------------
Sequence 2 ----------------------------------------



Alignment 18
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: BAA11251
Sequence identity: 11.81 (98/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSG--QGQQPGQRQPGYYSTSPQQLGQGQPRYYP
           ----Q---SGQ-Q--QQ----Q--QP---QP------PQQ----QP----
Sequence 2 --NIQVDPSGQVQWPQQQPFPQPHQPFSQQPQQTFPQPQQTFPHQPQQQF

Sequence 1 TSPQQPGQEQQPRQLQQPEQGQQGQQPEQ--GQQGQQP-GQGEQGQQP-G
           --PQQP---QQ--Q-QQP------QQP-Q---Q--QQP--Q--Q-QQP--
Sequence 2 SQPQQP--QQQFIQPQQPFP----QQPQQTYPQRPQQPFPQTQQPQQPFP

Sequence 1 QGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQP
           Q-QQ-QQP--------P---QQ--Q------P--PQQS---QQP---QQ-
Sequence 2 QSQQPQQP-------FPQPQQQFPQ------PQQPQQSFPQQQPSLIQQS

Sequence 1 GQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQ
           -Q-Q----P------QQ---------------P-S--Q----Q---Q--Q
Sequence 2 LQQQLN--PCKNFLLQQCKPVSLVSSLWSMILPRSDCQVMRQQCCQQLAQ

Sequence 1 SGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPG-QLQQPTQGQQG
           --Q----------LQ-------------QQ--Q-Q--G-Q---P---QQ-
Sequence 2 IPQ---------QLQCAAIHSIVHSIIMQQEQQEQRQGVQILVPLSQQQ-

Sequence 1 QQPGQGQQGQQPGQGQ-QGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           -Q-GQG---Q--GQG--Q-QQP-Q-------------T------------
Sequence 2 -QVGQGTLVQ--GQGIIQPQQPAQLEVIRSSVLQTLATMCNVYVPPYCST

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           ----------G---------------------------------------
Sequence 2 IRAPFASIVAGIGGQ-----------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34274
Sequence identity: 10.96 (91/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           -----------------------------------T--------------
Sequence 2 ---------------------------------MKTLLILTILAMAITIA

Sequence 1 GQGRQGQQSGQRQQDQQSG--QGQQPGQRQPGYYSTSPQQLGQGQPRYYP
           ----Q---SGQ-Q--QQ----Q--QP---QP------PQQ----QP----
Sequence 2 TANMQADPSGQVQWPQQQPFLQPHQPFSQQPQQIFPQPQQTFPHQPQQQF

Sequence 1 TSPQQPGQE-QQPRQL--QQPEQ--GQQGQQP-EQGQQGQQP-GQGEQGQ
           --PQQP-Q---QPRQ---QQP-Q---QQ-QQP--Q-QQ-QQP--Q--Q-Q
Sequence 2 PQPQQPQQQFLQPRQPFPQQPQQPYPQQPQQPFPQTQQPQQPFPQSKQPQ

Sequence 1 QPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQ--PA
           QP----Q-QQP-Q--P---P---QQS-Q-Q-------P-----LQQ--P-
Sequence 2 QPFP--QPQQPQQSFPQQQPSLIQQSLQQQ-----LNPCKNFLLQQCKPV

Sequence 1 QGQQ-------PGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQ
           -----------P----Q-------QQ--Q--Q--Q-------------QQ
Sequence 2 SLVSSLWSIILPPSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQ

Sequence 1 SGQEQ--------QLEQWQQSGQG--QPGHYPTSPLQPGQGQPGYYPTSP
           --QEQ---------L-Q-QQ-GQG----G-----P-QP-Q----------
Sequence 2 EQQEQLQGVQILVPLSQQQQVGQGILVQGQGIIQPQQPAQLEVIRSLVLQ

Sequence 1 QQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQ
           ---------------T-------------GQ-------------------
Sequence 2 TLPTMCNVYVPPYCSTIRAPFASIVASIGGQ-------------------

Sequence 1 GQPGYYPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SQQQPGQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GYYLTSPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPTSPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GDALLASQ
           --------
Sequence 2 --------



Alignment 20
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34285
Sequence identity: 12.41 (103/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           -----------------TS---------------PWQ----QQP---QQ-
Sequence 2 ---MKTFLVFALIAVVATSAIAQMETSCISGLERPWQ----QQPLPPQQS

Sequence 1 --QQPGQGQQLRQGQQGQQS-GQGQPRYYPTSSQQPGQLQQLAQGQQGQQ
           --QQP---QQ--Q----Q-S--Q-QP---P-S-QQP---QQ----QQ-QQ
Sequence 2 FSQQPPFSQQQQQPLPQQPSFSQQQP---PFSQQQPILSQQPPFSQQ-QQ

Sequence 1 PERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQ
           P---QQ---S-Q-Q-----QQ-QQ----QQ----Q----P---QQL----
Sequence 2 PVLPQQSPFSQQQQLVLPPQQQQQQLVQQQIPIVQ----PSVLQQLNPCK

Sequence 1 QSGQGQLGYYPTS-PQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQ
           ---Q-Q----P---PQ-----Q------S-----Q-Q---Q-QQ---EQ-
Sequence 2 VFLQQQCS--PVAMPQRLARSQ--MWQQSSCHVMQQQCCQQLQQI-PEQS

Sequence 1 DQQSGQG------RQGQQSG----QRQQDQQSGQGQQPGQRQPGYYSTSP
           --------------Q-QQ-G----Q-QQ-QQSGQG----Q-Q------S-
Sequence 2 RYEAIRAIIYSIILQEQQQGFVQPQQQQPQQSGQGVSQSQQQ------SQ

Sequence 1 QQLGQGQPRYYPTSPQQPGQE--QQPRQLQQPEQGQQGQ--QPEQGQQGQ
           QQLGQ--------S-QQP-Q---QQP-Q-QQ--Q--QG---QP-Q-----
Sequence 2 QQLGQ-------CSFQQPQQQLGQQPQQ-QQQQQVLQGTFLQPHQIAHLE

Sequence 1 QPGQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQS
           ----------P------------------------G--------------
Sequence 2 AVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGAY------------

Sequence 1 GQLQQPAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ------------------------------------------------
Sequence 2 ------------------------------------------------



Alignment 21
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34290
Sequence identity: 11.57 (96/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           ------------------------------------QP-Q-Q-P-Q-Q--
Sequence 2 ----------MKTFLILALLAIVATTATTAVRVPVPQP-QPQNPSQPQPQ

Sequence 1 QQPGQGQQGQQPGQGQQ-PGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQ
           -Q----QQ-Q-PGQ-QQ-P-Q-QP--YP--PQ-----Q---Q-Q---Q-Q
Sequence 2 RQVPLVQQQQFPGQQQQFPPQ-QP--YP-QPQPFPSQQPYLQLQPFPQPQ

Sequence 1 PGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQG
           P---P--P--P----P---P--P----Q-Q-P-Q-QQP---QQ-QQ--Q-
Sequence 2 P--FP--PQLPYPQPPPFSPQQPYPQPQPQYP-QPQQPISQQQAQQQQQQ

Sequence 1 QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQ
           QQ-QQ--Q-QQ---P---QQ--Q--P------LQQ--------Q--Q---
Sequence 2 QQQQQQQQQQQQILPQILQQ--QLIPCR-DVVLQQHNIAHARSQVLQQST

Sequence 1 GLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPT
           ----Y-P---L---Q--Q-------Q------------Q--Q-QQ-----
Sequence 2 ----YQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQPSSQV

Sequence 1 SPQQSGQGQQPGQ-WLQPGQWLQSGYYLTSPQQLGQGQQPRQW-LQ--PR
           S-QQ--Q----GQ---QP-Q----------PQQL-Q----R---LQ--PR
Sequence 2 SLQQPQQQYPSGQGFFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPR

Sequence 1 QGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSA
           -------P------------G-----------------------------
Sequence 2 MCNVYIPPYCSTTTAPFGIFGTN---------------------------

Sequence 1 EHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -----------------------------------
Sequence 2 -----------------------------------



Alignment 22
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26383
Sequence identity: 11.81 (98/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ-Q
           ------------------------------------QP-Q-Q-P-Q-Q-Q
Sequence 2 ----------MKTFLILALLAIVATTATTAVRVPVPQP-QPQNPSQPQPQ

Sequence 1 GQQPGQGQQGQQPGQGQQ-PGQGQPGYYPTSPQQSGQEQQLEQWQQSGQG
           GQ-P---QQ-Q-PGQ-QQ-P-Q-QP--YP--PQ-----Q---Q-Q---Q-
Sequence 2 GQVP-LVQQQQFPGQQQQFPPQ-QP--YP-QPQPFPSQQPYLQLQPFPQP

Sequence 1 QPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQ
           QP---P--P--P----P---P--P----Q-Q-P-Q-QQP---QQ-QQ--Q
Sequence 2 QP--FP--PQLPYPQPPPFSPQQPYPQPQPQYP-QPQQPISQQQAQQQQQ

Sequence 1 GQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPG
           -QQ-QQ--Q-QQ-QQ--Q-----Q--P------LQQ--------Q--Q--
Sequence 2 QQQQQQ--QQQQQQQILQQILQQQLIPCR-DVVLQQHNIAHARSQVLQQS

Sequence 1 QGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYP
           -----Y-P---L---Q--Q-------Q------------Q----QQ----
Sequence 2 T----YQPLQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQRQQQPSSQ

Sequence 1 TSPQQSGQGQQPGQ-WLQPGQWLQSGYYLTSPQQLGQGQQPRQW-LQ--P
           -S-QQ--Q----GQ---QP-Q----------PQQL-Q----R---LQ--P
Sequence 2 VSLQQPQQQYPSGQGFFQPSQQNPQAQGSVQPQQLPQFEEIRNLALQTLP

Sequence 1 RQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVS
           R-------P------------G----------------------------
Sequence 2 RMCNVYIPPYCSTTIAPFGIFGTN--------------------------

Sequence 1 AEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ------------------------------------
Sequence 2 ------------------------------------



Alignment 23
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA44473
Sequence identity: 11.08 (92/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 ----------------------------------------------MKTF

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           ---ALL-----S-------S--PG-----RP-Q-QQP---QQ------P-
Sequence 2 LVFALLAVVATSAIAQMDTSCIPGL---ERPWQ-QQPLPPQQTFPQQPPF

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           ---Q-QQP--------P--P--S-Q-QP---P--P--P-Q-Q-P---QQ-
Sequence 2 SQQQQQQP-------FPQQPSFS-QQQP-ILPQGPPFPQQTQ-PVLPQQS

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQG----QQGQ
           ----Q-Q-----QQ-QQ--Q-Q------S--QP--LQQL-------QQ--
Sequence 2 PFSQQQQLILPPQQQQQLPQQQ-----ISIVQPSVLQQLNPCKVFLQQQC

Sequence 1 QPERGQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYY----PISPQQ
           -P----Q-----Q--Q-------QQ----Q-S----Q--Y-----I----
Sequence 2 SPVAIPQRLARSQMWQQSSCHVMQQQCCQQLSQIPEQSRYDAIRAITYSI

Sequence 1 LGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLG
           --Q-QQ-GQ-Q-------PQQSGQG-S-----S-QQ-GQ-------QQLG
Sequence 2 ILQEQQQGQSQ----QQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLG

Sequence 1 QEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQG
           Q--Q-QQ--QG---Q-----------------------------------
Sequence 2 QQPQQQQVQQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYSSTTSV

Sequence 1 QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ
           --------------------------------------------------
Sequence 2 PFGV----------------------------------------------

Sequence 1 PGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 24
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59339
Sequence identity: 12.77 (106/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           -------------------------------------------------S
Sequence 2 ----------------------------------------------HIPS

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQ---GQQPGQGEQGQQPGQGQ
           ---P-Q-QQP--LQQ----QQ-QQP-Q-Q-----QQP----Q-QQP---Q
Sequence 2 LEKPLQ-QQPLPLQQILWYQQ-QQPIQQQPQPFPQQPPCSQQ-QQPPLSQ

Sequence 1 QGQQP-GQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQ
           Q-Q-P--Q-QP---P-S-QQ----QP---P--P--S-Q-QQ--Q-QQP--
Sequence 2 QQQPPFSQQQP---PFSQQQ----QP-ILPQQPPFSQQQQQFPQQQQPLL

Sequence 1 EQQG----QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           -QQ-----QQP---QQ-QQP---QQ--Q-QP------P----Q---L-Q-
Sequence 2 PQQPPFSQQQPPFSQQQQQPPFSQQ--QQQPILLQQPPFSQHQQPVLPQ-

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           QQ----QP-----S-LQ------------P------QQ------P-----
Sequence 2 QQIPSVQP-----SILQQ---------LNPCKVFLQQQCSPVAMPQSLAR

Sequence 1 GQQPGQGQQG--QQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQ--QSGQG
           -Q---Q------QQ----Q--Q-P-Q-----------Y---LQ--Q-GQG
Sequence 2 SQMLWQSSCHVMQQQCCRQLPQIPEQSRYDAI-RAIIYSIVLQEQQHGQG

Sequence 1 QQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQ
           ----Q-QQP-Q---G-------QP-Q-Q------S-QQP-Q---------
Sequence 2 LNQPQQQQPQQSVQGVS-----QPQQQQKQLGQCSFQQPQQ---------

Sequence 1 SGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ------------------------------------------
Sequence 2 ------------------------------------------



Alignment 25
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA35238
Sequence identity: 11.20 (93/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 ----------------------------------------------MKTF

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSP-QQSGQLQQP-AQGQQ-PGQE
           -----------T---------P---P--P-QQ--Q-Q-P--Q-QQ-PGQ-
Sequence 2 LILALLAIVATTARIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQ-

Sequence 1 QQGQQPGQGQQGQQPGQGQQPG-QGQPGYYPTSPQQSGQEQQLEQWQQSG
           QQ---P-Q-----QP---QQP--Q-QP---P--PQ------QL----Q--
Sequence 2 QQPFPPQQPYPQPQPFPSQQPYLQLQP--FP-QPQLPYPQPQLP-YPQPQ

Sequence 1 QGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQP
           ---P---P--P-QP-------YP-S--Q--Q-QQP---QQ--Q-QQ-QQ-
Sequence 2 LPYPQPQPFRPQQP-------YPQSQPQYSQPQQPISQQQQQQQQQQQQK

Sequence 1 GQGQQGQQPGQGQQGQQ--PGQGQQPGQGQPGYYPTSLQQSGQGQQPGQ-
           -Q-QQ-QQ--Q----QQ--P-------Q----Y------Q----Q---Q-
Sequence 2 QQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQL

Sequence 1 -----WQQPG----QGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQG---P
           -----WQ-P-----Q----------L---Q-QQ------QQQP-------
Sequence 2 CCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQ---QQQQQQPLSQVSFQ

Sequence 1 QPGQWQQSGQGQQGYYPTSPQQSGQGQ-QPGQWLQPGQWLQSGYYLTSPQ
           QP-Q---SGQG-----P-------QG--QP-Q--Q---------------
Sequence 2 QPQQQYPSGQGS--FQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAM

Sequence 1 QLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQS
           --------------------------------------------------
Sequence 2 CNVYIPPYCTIAPVGIFGTN------------------------------

Sequence 1 GQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------



Alignment 26
Sequence 1:
Sequence 2: Allergen Hor v 21, Sequence: P80198
Sequence identity: 11.33 (94/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ------------Q----------P-Q--P-------Q-L-Q-QP------
Sequence 2 ------ITTTTMQFNPSGLELERPQQLFPQW-----QPLPQ-QPPFLQQE

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQ-PGQGEQGQQPGQGQQG
           P-QP---QQP---QQP---QQ-Q-P-Q-Q--QQ-P-Q----Q-P-Q-QQ-
Sequence 2 PEQPYPQQQPLPQQQPFP-QQPQLPHQHQFPQQLPQQQFPQQMPLQPQQ-

Sequence 1 QQPGQG--QPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQE
           Q-P-Q---QP---P--PQQ---GQ--Y-----QQ----QQP---QQP--E
Sequence 2 QFPQQMPLQPQQQPQFPQQKPFGQ--YQQPLTQQPYPQQQPLAQQQPSIE

Sequence 1 QQGQQPGQGQ-QGQQPGQGQQPGQGQPGYYPTSPQQSGQEQ-QLEQWQQS
           -Q-Q---------QQ----------Q-------P--S-Q---QL---Q--
Sequence 2 EQHQLNLCKEFLLQQCTLDEKVPLLQSVISFLRPHISQQNSCQLKRQQCC

Sequence 1 GQ-GQPGHYPTSP-LQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQG---
           -Q----------P--Q-------------QQ-G-G----QLQQ--QG---
Sequence 2 QQLANINEQSRCPAIQTIVHAIVMQQQVQQQVGHGFVQSQLQQLGQGMPI

Sequence 1 QQGQQPGQG-----QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQS
           Q--QQPGQ------QQ-Q----G----Q-----------P---P------
Sequence 2 QLQQQPGQAFVLPQQQAQFKVVGSLVIQTLPMLCNVHVPPYCSPFGSMAT

Sequence 1 GQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQ
           G-G-Q---------------------------------------------
Sequence 2 GSGGQ---------------------------------------------

Sequence 1 WQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ---------------------------------------------
Sequence 2 ---------------------------------------------



Alignment 27
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34272
Sequence identity: 11.93 (99/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           -------------------------Q--P------PQQ----QP---P--
Sequence 2 ----MKTLLILTILAMATTIATANMQVDPSGQVQWPQQ----QP--FP-Q

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQG-QQGQQPGQGEQGQQPGQGQQG
           PQQP---Q--R---QP-Q-----QP-Q---Q-QQ-------QQ--Q-QQ-
Sequence 2 PQQPFCQQPQRTIPQPHQTFH-HQPQQTFPQPQQTYPHQPQQQFPQTQQP

Sequence 1 QQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQP-GQEQ
           QQP--------P--PQQ---------P--PQ----L--P-Q-QQP--Q-Q
Sequence 2 QQP-------FP-QPQQT-------FPQQPQ----LPFPQQPQQPFPQPQ

Sequence 1 QGQQP-GQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQ
           Q-QQP--Q-QQ-QQP----QP-Q--P---P--PQQS---QQ----Q---Q
Sequence 2 QPQQPFPQSQQPQQPFP--QPQQQFP--QPQQPQQSFPQQQQPAIQSFLQ

Sequence 1 GQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQ-LQQPTQGQQGQQP
           -Q----P-------Q--------S---I-------Q--QQ----Q--Q-P
Sequence 2 QQMN--PCKNFLLQQCNHVSLVSSLVSIILPRSDCQVMQQQCCQQLAQIP

Sequence 1 GQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQ
           ---QQ-Q--------------Q---QG-P---P--L-Q--QG----Q-QQ
Sequence 2 ---QQLQCAAIHSVAHSIIMQQEQQQGVPILRP--LFQLAQGLGIIQPQQ

Sequence 1 PGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGY
           P-Q------------P--------P-------------------------
Sequence 2 PAQLEGIRSLVLKTLPTMCNVYVPPDCSTINVPYANIDAGIGGQ------

Sequence 1 YPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------
Sequence 2 ----------------------------------



Alignment 28
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59340
Sequence identity: 12.41 (103/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           -------------------------------------------------S
Sequence 2 ----------------------------------------------HIPS

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQG---QQPGQGEQGQQPGQGQ
           ---P-Q-QQP--LQQ-----Q-QQP-Q-Q-----QQP----Q-QQP---Q
Sequence 2 LEKPSQ-QQPLPLQQILWYHQ-QQPIQQQPQPFPQQPPCSQQ-QQPPLSQ

Sequence 1 QGQQP-GQGQPGYYPTSPQQSGQGQPGYYPTSPQQS--GQLQQP--AQGQ
           Q-Q-P--Q-QP---P-S-Q----------P--PQQ----Q-QQP---Q-Q
Sequence 2 QQQPPFSQQQP---PFSQQE--------LPILPQQPPFSQQQQPQFSQQQ

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           QP---QQ--QP---QQ---P---Q-P---Q----P--PQQ----QQ--Q-
Sequence 2 QPFPQQQ--QPLLLQQ--PPFSQQRPPFSQQQQQPVLPQQPPFSQQQQQQ

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPT-----SPQQIGQGQQPGQLQQP
           ----Q--P------P--P-Q--P---P-------P------QQ------P
Sequence 2 PILPQQPPFSLHQQPVLPQQQIPYVQPSILQQLNPCKVFLQQQCSPVAMP

Sequence 1 TQGQQGQQPGQG--QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSL--Q
           ------Q---Q------QQ----Q----P-Q-----------Y---L--Q
Sequence 2 QSLARSQMLWQSSCHVMQQQCCQQLPRIPEQSRYDAI-RAIIYSIVLQEQ

Sequence 1 QSGQG-QQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQ
           Q-GQG--QP-Q-QQP-Q---G-------QP-Q-Q------S-QQP-Q---
Sequence 2 QHGQGFNQP-QQQQPQQSVQGVS-----QPQQQQKQLGQCSFQQPQQ---

Sequence 1 PGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ------------------------------------------------
Sequence 2 ------------------------------------------------



Alignment 29
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34276
Sequence identity: 10.24 (85/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           ------------------------------QLQ-----QQ--QEQ-----
Sequence 2 ----MKTFPILALLAIVATTATTAVRVPVPQLQLQNPSQQQPQEQVPLVQ

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSP---QQLGQGQPRYY
           -Q--QGQQ--Q----QQ-----QP---Q--Y----P----QL---QP---
Sequence 2 EQQFQGQQ--QPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQ--

Sequence 1 PTSPQQPGQEQQPR--QLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ--P
           P--PQQP----QP---Q-QQP---QQ-QQ--Q-QQ-QQ--Q----QQ--P
Sequence 2 PFRPQQPYPQPQPQYSQPQQPISQQQQQQQQQQQQQQQILQQILQQQLIP

Sequence 1 GQGQQGQQPG--QGQPGYYPTSPQQSGQG----QPGYYPTSPQ-QSGQ--
           ------QQ-----G-------S--Q--Q-----Q----P-----Q-----
Sequence 2 CRDVVLQQHNIAHGSSQVLQESTYQLVQQLCCQQLWQIPEQSRCQAIHNV

Sequence 1 -----LQQPAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQG--QPGYYP
           -----L-Q-----Q--Q-QQ-QQP------QQP-Q----GQG--QP----
Sequence 2 VHAIILHQQHHHHQQQQQQQQQQPLSQVSFQQPQQQYPSGQGFFQPSQQN

Sequence 1 TSPQQSGQEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQ
           ---Q-S-Q-QQL-Q------------P--------------P--------
Sequence 2 PQAQGSFQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN-

Sequence 1 GQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLT
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 ASQ
           ---
Sequence 2 ---



Alignment 30
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA26384
Sequence identity: 10.96 (91/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ------------------MKTFLILVLLAIVATTATTAVRFPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ---P-Q-Q---QP-Q----Q-P--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFLGQQQPFPPQ-QPYPQP-QPFPSQLPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP---Q--Y----PQQ----QP--YP----Q--Q-QQP---QQ--Q-Q
Sequence 2 FPQP---QLPY--SQPQQFRPQQP--YPQPQPQYSQPQQPISQQQQQQQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQ--WQQSG
           Q-QQ--Q-QQ--Q----QQ----------------G--Q-L-Q---Q---
Sequence 2 QQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQ

Sequence 1 QGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQP
           -----H----P-Q--Q-Q----------I---QQ--Q-QQP------QQP
Sequence 2 ELCCQHLWQIPEQ-SQCQAIHNVV--HAIILHQQQKQQQQPSSQVSFQQP

Sequence 1 GQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQ
           -Q----Q-P--GQ----P-Q-Q-P-Q-Q----P--L-Q------------
Sequence 2 LQ----QYP-LGQGSFRPSQ-QNP-QAQGSVQPQQLPQFEEIRNLALQTL

Sequence 1 PGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGY
           P--------P-----P----------------------------------
Sequence 2 PAMCNVYIPPYCTIAPFGIFGTN---------------------------

Sequence 1 YPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------
Sequence 2 ----------------------------------



Alignment 31
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 12.65 (105/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           -----------------------V-------------------L----L-
Sequence 2 ----------------------MVKLAHLLVATVGVLLVLNGCLARQSLG

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --P-------L------Q----------Q---------Q-----------
Sequence 2 VPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQIRCAGVSIARL

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           ------------------S----G----G-------------QP-QGQQ-
Sequence 2 VIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQG

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           QQ--QGQQ--QGQQGQQ--QGQ------------Q-QQ--QGQQGQQ---
Sequence 2 QQ--QGQQGQQGQQGQQGQQGQ------------QGQQGQQGQQGQQGQQ

Sequence 1 GQQGQQSGQG-----QQLGQGQQGQQ----PGQKQQ-SGQGQQGYYPISP
           GQQGQQ-GQG-----Q-------G------PG--Q-----G-Q-----S-
Sequence 2 GQQGQQ-GQGFRDMHQKVEHVRHGDAIAMTPGSAQWIYNTGDQPLIIVSL

Sequence 1 QQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQ
           ----------Q-QL---P------G--Q-G------QQ----------Q-
Sequence 2 IDIA----NYQNQLDRNPRTFRLAGNNQQGSSQQQQQQQQNILSGFDPQV

Sequence 1 LGQEQQ-DQQSGQGRQGQQSGQRQQDQQSGQGQ--QPGQRQPGYYSTSPQ
           L-Q----D----Q--Q-QQ----------G--Q---P--RQ--Y-S----
Sequence 2 LAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVRPPLRQ-AYESEQWR

Sequence 1 QLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQG
           ------PR--P-SPQ--G-E---------E--------------------
Sequence 2 H-----PRGPPQSPQDNGLEETICSMRTHENIDDPARADIYKPNLGRVTS

Sequence 1 EQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQ
           ---------Q--------------------------------Q-----Q-
Sequence 2 VNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQV

Sequence 1 PAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQ
           -----Q----QQ-Q--------Q------Q--------------------
Sequence 2 VNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQNNFEWISFKTNANAMIST

Sequence 1 QLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQP
           --------------------------------------------GQ--Q-
Sequence 2 LAGRTSALRALPLEVITNAYQISLEEARKIKFNTLETTLTRARGGQQPQL

Sequence 1 TQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQ
           --------------------------------------------------
Sequence 2 IEEIVEV-------------------------------------------

Sequence 1 GQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 32
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34282
Sequence identity: 10.84 (90/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           -------------------------------------------P----Q-
Sequence 2 --------------------MKTFLILALRAIVATTATIAVRVPVPQLQP

Sequence 1 QQPGQGQ-QGQQP--GQGQQPGQGQPGYYPTSPQQS-GQEQQLEQWQQSG
           Q-P-Q-Q-Q-Q-P---Q-Q-PGQ-QP---P--PQQ---Q-Q-----Q---
Sequence 2 QNPSQQQPQKQVPLVQQQQFPGQQQP--FP--PQQPYPQQQPFPSQQPYM

Sequence 1 QGQPGHYPTSPL-QPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQ
           Q-QP---P--P--QP----P---P--PQQ-----QP-Q--QP------QQ
Sequence 2 QLQPFPQPQLPYPQPQLPYPQPQPFRPQQSYPQPQP-QYSQP------QQ

Sequence 1 PGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQ-W
           P---QQ-QQ--Q-QQ-QQ--Q-----Q--P------LQQ--------Q--
Sequence 2 PISQQQQQQQQQQQQQQQILQQILQQQLIPCR-DVVLQQHSIAHGSSQVL

Sequence 1 QQPGQGLPGYYPTSSLQ--PEQGQ-QGYYPTSQQQPGQGPQPGQWQQSGQ
           QQ----L--------L---PEQ---Q--------------Q--Q-QQ--Q
Sequence 2 QQSTYQLVQQFCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQ

Sequence 1 GQQGYYPTSPQQSGQGQQPGQW-LQPGQWLQSGYYLTSPQQLGQGQQPRQ
           -QQ-------QQS-Q----GQ---QP-Q----------PQQL-Q----R-
Sequence 2 QQQPLSQVCFQQSQQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRN

Sequence 1 WLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSP
           ---------------P----------------------------------
Sequence 2 LALETLPAMCNVYIPPYCTIAPVGIFGTN---------------------

Sequence 1 YHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------------
Sequence 2 ----------------------------------------



Alignment 33
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34280
Sequence identity: 9.88 (82/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           ------------------------------------------------L-
Sequence 2 ----------------------------------------MKTFLILVLL

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQR--PGQGQQPGQGQQEYYLTS
           -I-A-----------PQ-----P-Q---Q---P---QQ---GQQ------
Sequence 2 AIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPF--P

Sequence 1 PQQSGQWQQPGQGQAGYYPTSP---QQSGQEQPGYYPTSPWQPEQLQQPT
           PQQ-----QP---Q--Y----P----Q----QP---P--P-QP----QP-
Sequence 2 PQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQP--QPFRPQQPYPQPQP-

Sequence 1 QGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQG
           Q--Q-QQP---QQ--Q-QQ-QQ--Q-Q--------QQ----------Q--
Sequence 2 QYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHN

Sequence 1 QQPERGQQGQQSGQG--QQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQL
           ----R-Q--QQS-----Q-L------Q-P-Q-Q-----------I--QQ-
Sequence 2 IAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQ

Sequence 1 GQGQQSGQGQLGYYPTSP-QQSGQGQSGYYPTSAQQPGQLQQSTQEQQLG
           -Q-QQ----Q-------P-QQ---GQ----P---QQ--Q-Q-S-Q-QQL-
Sequence 2 KQ-QQQPSSQVSFQ--QPLQQYPLGQGSFRPS--QQNPQAQGSVQPQQLP

Sequence 1 QEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQG
           Q-------------------------------------------------
Sequence 2 QFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN--------------

Sequence 1 QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 34
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA25593
Sequence identity: 9.88 (82/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           ------------------------------------------------L-
Sequence 2 ----------------------------------------MKTFLILVLL

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQR--PGQGQQPGQGQQEYYLTS
           -I-A-----------PQ-----P-Q---Q---P---QQ---GQQ------
Sequence 2 AIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPF--P

Sequence 1 PQQSGQWQQPGQGQAGYYPTSP---QQSGQEQPGYYPTSPWQPEQLQQPT
           PQQ-----QP---Q--Y----P----Q----QP---P--P-QP----QP-
Sequence 2 PQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQP--QPFRPQQPYPQPQP-

Sequence 1 QGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQG
           Q--Q-QQP---QQ--Q-QQ-QQ--Q-Q--------QQ----------Q--
Sequence 2 QYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHN

Sequence 1 QQPERGQQGQQSGQG--QQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQL
           ----R-Q--QQS-----Q-L------Q-P-Q-Q-----------I--QQ-
Sequence 2 IAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAILKVVHAIILHQQQ

Sequence 1 GQGQQSGQGQLGYYPTSP-QQSGQGQSGYYPTSAQQPGQLQQSTQEQQLG
           -Q-QQ----Q-------P-QQ---GQ----P---QQ--Q-Q-S-Q-QQL-
Sequence 2 KQ-QQQPSSQVSFQ--QPLQQYPLGQGSFRPS--QQNPQAQGSVQPQQLP

Sequence 1 QEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQG
           Q-------------------------------------------------
Sequence 2 QFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN--------------

Sequence 1 QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 35
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA31685
Sequence identity: 12.29 (102/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 ----------------------------------------------MKTF

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           ---ALL-----S----------PG-----RP-Q-QQP---QQ------PQ
Sequence 2 LVFALLAVAATSAIAQMETRCIPGL---ERPWQ-QQPLPPQQTF----PQ

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           Q-----Q--Q-Q----P--P--S-Q-QP------P--P---QQP---QQ-
Sequence 2 QP-LFSQQQQQQ--LFPQQPSFS-QQQPPFWQQQP--PFSQQQPILPQQ-

Sequence 1 QQP-GQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPE
           --P--Q-QQL---QQ---S-Q-QP---P--S--P-Q-QQ--Q--Q-Q-P-
Sequence 2 -PPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPV

Sequence 1 -RGQQGQQSGQGQQLGQGQQG--QQPGQKQQSGQGQQGYYPISPQQLGQG
           ------QQ--------Q-Q------P-----S---QQ-------QQ--Q-
Sequence 2 VQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQ-

Sequence 1 QQSGQGQLGYYPTSPQQSGQG--QSGYYPTSAQQPGQLQQSTQEQQLGQE
           ------QL---P--PQQS---------Y----Q---Q-Q-S-Q-QQ----
Sequence 2 ------QL---PQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQ----

Sequence 1 QQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQ--PGYYSTSPQQLGQG
           QQ-QQ------GQ---Q-QQ--Q---GQQP-Q-Q---G-----P-Q--Q-
Sequence 2 QQPQQ-----LGQCVSQPQQQSQQQLGQQPQQQQLAQGTF-LQPHQIAQL

Sequence 1 QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ
           -----------P--------L-----------------------------
Sequence 2 EVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY-----------

Sequence 1 PGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 36
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34288
Sequence identity: 12.53 (104/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW-QQSGQGQ
           ---------------------------T---Q-----Q--QW-QQ----Q
Sequence 2 ----------MKTLLILTILAMAITIGTANMQVDPSSQV-QWPQQQPVPQ

Sequence 1 PGHYPTSPLQPGQ--GQPGY-YPTSPQQIGQGQQPGQLQQPTQGQQGQQP
           P-H-P-S--QP-Q---QP----P--PQQ--Q--QP-Q-QQ--Q--Q-QQP
Sequence 2 P-HQPFSQ-QPQQTFPQPQQTFPHQPQQ--QFPQPQQPQQ--QFLQPQQP

Sequence 1 GQGQQGQQPGQGQQGQQP-GQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQ
           ---QQ-QQP---QQ-QQP--Q-QQP-Q------P----QS-Q-QQ--Q--
Sequence 2 FP-QQPQQP-YPQQPQQPFPQTQQPQQ----LFP----QSQQPQQ--QFS

Sequence 1 QPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGP--QPGQWQQSGQGQ
           QP-Q--P--------QP-Q-QQ---P--QQQP---P--QP---QQ-----
Sequence 2 QPQQQFP--------QPQQPQQSF-P--QQQP---PFIQPSLQQQVNPCK

Sequence 1 ----QGYYPTS----------PQQSGQ--GQQPGQWL-QPGQWLQSGYYL
           ----Q---P-S----------PQ---Q---QQ--Q-L-Q--Q-LQ-----
Sequence 2 NFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIH

Sequence 1 TSPQQLGQGQQPRQWLQPRQGQQGYYPT-SPQQSGQGQQLGQGQQGYYPT
           T--------QQ--Q--Q--QG-----P----QQ-GQG--L-QGQ------
Sequence 2 TIIHSIIM-QQEQQEQQ--QGMHILLPLYQQQQVGQGT-LVQGQGIIQ--

Sequence 1 SPQQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LLASQ
           -----
Sequence 2 -----



Alignment 37
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA36063
Sequence identity: 11.20 (93/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 ----------------------------------------------MKTF

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           ---ALL-----S-------S--PG-----RP-Q--QP---Q-------PQ
Sequence 2 LVFALLAVVATSTIAQMETSCIPGL---ERPWQ-EQPLPPQHTLF---PQ

Sequence 1 QSG--QWQQPGQGQAGYYPTSPQQSG--QEQPGYYPTSPWQPEQLQQPTQ
           Q----Q-QQP--------P-S-QQ----Q-QP---P--P----Q-QQP--
Sequence 2 QQPFPQQQQP--------PFSQQQPSFLQQQP-ILPQLPFS--QQQQPVL

Sequence 1 GQQRQQPGQGQQLRQGQQGQQSGQGQ-PRYYPTSSQQ--PGQL---QQLA
           -QQ-----Q---L---QQ-QQ--Q-Q-P---P---QQ--P------QQ--
Sequence 2 PQQSPFSQQQLVLPPQQQYQQVLQQQIPIVQPSVLQQLNPCKVFLQQQCN

Sequence 1 QGQQGQQPERGQQGQQSGQGQQLGQGQQGQQ-PGQKQQSGQG--QQGYYP
           -----Q---R-Q--QQS-------Q-Q--QQ-P----QS---------Y-
Sequence 2 PVAMPQRLARSQMLQQSSC--HVMQQQCCQQLPQIPEQSRYDVIRAITYS

Sequence 1 ISPQQLGQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQ
           I--Q---QG----Q-Q-------PQQ-GQG-S-----S-QQ-GQ------
Sequence 2 IILQEQQQGFVQAQQQ------QPQQLGQGVSQSQQQSQQQLGQCSFQQP

Sequence 1 EQQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQ
           -QQLGQ--Q-QQ--QG---Q------------------------------
Sequence 2 QQQLGQQPQQQQVLQGTFLQPHQIAHLEVMTSIALRTLPTMCSVNVPLYS

Sequence 1 QLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQG
           --------------------------------------------------
Sequence 2 STTSVPFSVGTGVGAYL---------------------------------

Sequence 1 EQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 TQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 DSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------------
Sequence 2 -------------------------------------------



Alignment 38
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34286
Sequence identity: 9.40 (78/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 -----------TITRTFPIPTISSNNNHHFRSNSNHHFHSNNNQFYRNNN

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQ-QPAQGQQ-PGQEQ
           -PG---P-----SP-------------SP----Q----P------P----
Sequence 2 SPGHNNPLNNNNSPNNNSPSN--HHNNSPNNNFQYHTHPSNHKNLPHTNN

Sequence 1 -QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQS--GQEQQLEQWQQS
           -Q-QQP---QQ-Q-P---QQ---------P--PQQS---Q-QQL----Q-
Sequence 2 IQQQQPPFSQQQQPPFSQQQQ--------PVLPQQSPFSQQQQLVLPPQQ

Sequence 1 GQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQP---TQGQQ
           -Q-Q---------QP---Q-------P------QQ------P------Q-
Sequence 2 QQQQLVQQQIPIVQPSVLQQ----LNPCKVFLQQQCSPVAMPQRLARSQM

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQG-QQP
           -QQ-------QQ--Q--Q-Q-P-Q-----------Y---LQ---QG--QP
Sequence 2 WQQSSCHVMQQQCCQQLQ-QIPEQSRYEAI-RAIIYSIILQEQQQGFVQP

Sequence 1 GQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQ
           -Q-QQP-Q---G----------Q--Q------QQQ-GQ-PQ--Q-QQ--Q
Sequence 2 -QQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQQLGQQPQQQQQQQVLQ

Sequence 1 GQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQW
           G---------------------L----------Y----------------
Sequence 2 GTFLQPHQIAHLEAVTSIALRTLPTMCSVNVPLYSATTSVPFGVGTGVGA

Sequence 1 LQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPY
           --------------------------------------------------
Sequence 2 Y-------------------------------------------------

Sequence 1 HVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ---------------------------------------
Sequence 2 ---------------------------------------



Alignment 39
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34281
Sequence identity: 10.84 (90/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ------------------MKTFLILALLAIVATTATTAVRVPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ---P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFLGQQQPFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP--------P--PQQ-----P--YP----Q--Q-QQP---QQ--Q-Q
Sequence 2 FLQPQLPYSQPQPFRPQQ-----P--YPQPQPQYSQPQQPISQQQQQQQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQS---GQEQQLEQ--WQ
           Q-QQ--Q-QQ-QQ--Q-----Q--P-------Q-----G--Q-L-Q---Q
Sequence 2 QQQQ--QQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQ

Sequence 1 QSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQG
           --------H----P-Q--Q-Q----------I---QQ--Q-QQP------
Sequence 2 LLQELCCQHLWQIPEQ-SQCQAIHNVV--HAIILHQQQKQQQQPSSQVSF

Sequence 1 QQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQ
           QQP-Q----Q-P--GQ----P-Q-Q-P-Q-Q----P--L-Q---------
Sequence 2 QQPLQ----QYP-LGQGSFRPSQ-QNP-QAQGSVQPQQLPQFEEIRNLAR

Sequence 1 WQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQ
           --------------------------------------------------
Sequence 2 K-------------------------------------------------

Sequence 1 QGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------
Sequence 2 -------------------------------------



Alignment 40
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 13.86 (115/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------L-----------
Sequence 2 ------------------------------MAKAFVFSLCLLLVFNGCLA

Sequence 1 GQQGQQSGQGQ-QLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLG-QG--
           --Q-Q-S-Q-Q-QL-Q--Q---P----Q---GQ--------------G--
Sequence 2 ARQSQLSPQNQCQLNQ-LQAREPDNRIQAEAGQIETWNFNQEDFQCAGVA

Sequence 1 ------QQSGQGQLGYYPTSPQQ----SGQGQSG-YYPTSAQQPGQLQQS
           ------Q--G---L--Y---PQ------G-G--G-------------QQS
Sequence 2 ASRITIQRNGL-HLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQS

Sequence 1 TQE-QQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYST
           -Q---Q--QEQ--QQ--QG-QG-Q-GQ--Q-QQ--QG-Q-G--Q------
Sequence 2 SQQGRQQEQEQERQQQQQGEQGRQQGQQEQ-QQERQGRQQGRQQ------

Sequence 1 SPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQP
           --Q--G--Q--------QQ-GQ---P-Q-QQ--Q----Q-------G---
Sequence 2 --QEEGRQQE-------QQQGQQGRPQQQQQFRQFDRHQKTRRIREGDVV

Sequence 1 GQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQ
           -----G--------G-Q-----------S--------P------------
Sequence 2 AI-PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE

Sequence 1 LQQPAQGQQPGQEQQGQQPGQGQQG-QQPGQGQQPGQGQPGYYPTSPQQS
           --Q--Q-Q---Q--QG--PGQ-QQ----P-Q--Q-G-G---------Q--
Sequence 2 FNQQGQSQPRQQGEQGR-PGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL

Sequence 1 GQEQQL-EQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQI-GQGQQP
           -Q-----E------QGQ-----------G-------P---Q-------Q-
Sequence 2 AQALNVNEETARNLQGQNDNRNQIIRVRGNLDFVQPPRGRQEREHEERQQ

Sequence 1 GQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTS
           -QLQQ--Q-Q-GQ----G--------------------------------
Sequence 2 EQLQQERQQQGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIST

Sequence 1 LQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGP
           L-----------------G--------S----------------------
Sequence 2 LNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQV

Sequence 1 QPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQ
           -------------------------G-------Q----------------
Sequence 2 VNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN

Sequence 1 LGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSG
           ---G--------P-------Y--S--Q--Q-----Q--------------
Sequence 2 TLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAV

Sequence 1 QGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------------------
Sequence 2 V------------------------------------------------



Alignment 41
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA17741
Sequence identity: 11.20 (93/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           ---------------------------------T---------P---P--
Sequence 2 ------------------MKTFLILALLAIVATTATTAVRVPVPQLQPQN

Sequence 1 P-QQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPG-QGQQ
           P-QQ--QEQ-P---QQ---GQQ---P-Q-Q---QP-Q----QQP--Q-Q-
Sequence 2 PSQQQPQEQVPLVQQQQFLGQQQPFPPQ-QPYPQP-QPFPSQQPYLQLQP

Sequence 1 GQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQ
           --QP--------P--PQQ-----P--YP----Q--Q-QQP---QQ--Q-Q
Sequence 2 FLQPQLPYSQPQPFRPQQ-----P--YPQPQPQYSQPQQPISQQQQQQQQ

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQS---GQEQQLEQ--WQ
           Q-QQ--Q-QQ-QQ--Q-----Q--P-------Q-----G--Q-L-Q---Q
Sequence 2 QQQQ--QQQQQQQIIQQILQQQLIPCMDVVLQQHNIVHGKSQVLQQSTYQ

Sequence 1 QSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQG
           --------H----P-Q--Q-Q----------I---QQ--Q-QQP------
Sequence 2 LLQELCCQHLWQIPEQ-SQCQAIHNVV--HAIILHQQQKQQQQPSSQVSF

Sequence 1 QQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQ
           QQP-Q----Q-P--GQ----P-Q-Q-P-Q-Q----P--L-Q---------
Sequence 2 QQPLQ----QYP-LGQGSFRPSQ-QNP-QAQGSVQPQQLPQFEEIRNLAL

Sequence 1 WQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQ
           ---P--------P-----P-------------------------------
Sequence 2 QTLPAMCNVYIPPYCTIAPFGIFGTN------------------------

Sequence 1 QGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------
Sequence 2 -------------------------------------



Alignment 42
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA59338
Sequence identity: 9.88 (82/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 ---------------------------------FALIAVVATSTIAQMET

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           ---PG-E--P-Q-QQP---QQ---P-Q----QQ-----Q-QQP---QQ-Q
Sequence 2 SCIPGLER-PWQ-QQPLPPQQTLFPQQQPFPQQQPPFSQ-QQPSFSQQ-Q

Sequence 1 QP-GQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQ--PGQE
           -P--Q-QP---P--P--S-Q-QP-----SP----QL--P-Q-QQ--P-Q-
Sequence 2 PPFSQQQP-ILPEPPF-SLQQQPVLPQQSPFSQQQLVLPPQQQQQLPQQQ

Sequence 1 QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSG-
           ----QP---QQ---P-------Q--P------PQ-----Q----WQQS--
Sequence 2 ISIVQPSVLQQ-LNPCKVFLQQQCSP---VAMPQRLARSQM---WQQSRC

Sequence 1 --QGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQ
           ----Q------S------------------I-Q-QQ-G--Q---Q-QQ-Q
Sequence 2 HVMQQQCCQQLSQIPEQSRYDAICAITYSIILQEQQQGFVQ--AQQQQPQ

Sequence 1 QPGQG-QQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQ
           Q-GQG--Q-QQ--Q-Q-GQ-----QQP-Q---------------------
Sequence 2 QSGQGVSQSQQQSQQQLGQC--SFQQPQQ---------------------

Sequence 1 WQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHV
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------
Sequence 2 -------------------------------------



Alignment 43
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34283
Sequence identity: 10.84 (90/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 -------------------------MKTFLILALLAIVATTATSAVRVPV

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQ--GQQPGQGQQ
           PQ---Q-Q-P-Q-QQP------Q-P---QQ-Q-PGQ-EQ---QQP---QQ
Sequence 2 PQL--QPQNPSQ-QQPQE----QVPLMQQQQQFPGQQEQFPPQQPYPHQQ

Sequence 1 ---GQQP-GQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQP
           ----QQP--Q-QP---P--P----Q-QP---P--P----Q-Q-P-Q-QQP
Sequence 2 PFPSQQPYPQPQP-FPPQLPYP--QTQP-FPPQQPYPQPQPQYP-QPQQP

Sequence 1 GQEQQGQQPGQGQQGQQPGQGQQ--PGQG---QPGYYPTSPQQSGQEQQL
           ---QQ-QQ--Q-QQ--Q----QQ--P------Q---------Q--Q----
Sequence 2 ISQQQAQQQQQQQQTLQQILQQQLIPCRDVVLQQHNIAHASSQVLQQSSY

Sequence 1 EQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQ
           -Q-QQ----Q----P---------Q--------------QQ--Q-QQP--
Sequence 2 QQLQQLCCQQLFQIP----EQSRCQAIHNVVHAIILHHHQQ--QQQQPSS

Sequence 1 GQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQ
           ----QQP----Q-Q-P--GQ---Q--Q-Q-P-Q-Q----P--L-Q-----
Sequence 2 QVSYQQP----QEQYPS-GQVSFQSSQ-QNP-QAQGSVQPQQLPQFQEIR

Sequence 1 QPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQS
           -------P--------P--S------------------------------
Sequence 2 NLALQTLPAMCNVYIPPYCSTTIAPFGIFGTN------------------

Sequence 1 GQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -----------------------------------------
Sequence 2 -----------------------------------------



Alignment 44
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 13.61 (113/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQ-QLGQGQQGQQPGQKQQSGQGQ-------QGYYPISPQQ
           --Q-Q-S-Q-Q-QL-Q--Q---P----Q---GQ-------QG--------
Sequence 2 ARQSQLSPQNQCQLNQ-LQAREPDNRIQAEAGQIETWNFNQGDFQCAGVA

Sequence 1 LGQG--QQSGQGQLGYYPTSPQQ----SGQGQSG-YYPTSAQQPGQLQQS
           ------Q--G---L--Y---PQ------G-G--G-------------QQS
Sequence 2 ASRITIQRNGL-HLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQS

Sequence 1 TQE-QQLGQEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYST
           -Q---Q--QEQ--QQ--QG-QG-Q-GQ--Q-QQ--QG-Q-G--Q------
Sequence 2 SQQGRQQEQEQERQQQQQGEQGRQQGQQEQ-QQERQGRQQGRQQ------

Sequence 1 SPQQLGQGQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQP
           --Q--G--Q--------QQ-GQ---P-Q-QQ--Q----Q-------G---
Sequence 2 --QEEGRQQE-------QQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVV

Sequence 1 GQGEQGQQPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQ
           -----G--------G-Q-----------S--------P------------
Sequence 2 AI-PAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENE

Sequence 1 LQQPAQGQQPGQEQQGQQPGQGQQG-QQPGQGQQPGQGQPGYYPTSPQQS
           --Q--Q-Q---Q--QG--PGQ-QQ----P-Q--Q-G-G---------Q--
Sequence 2 FNQQGQSQPRQQGEQGR-PGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLL

Sequence 1 GQEQQL-EQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQI-GQGQQP
           -Q-----E------QGQ-----------G-------P---Q-------Q-
Sequence 2 AQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQ

Sequence 1 GQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTS
           -QLQQ--Q-QQG-Q-------------------G---------P-----S
Sequence 2 EQLQQERQ-QQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS

Sequence 1 LQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGP
           ---S------------------Y---------------------------
Sequence 2 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ

Sequence 1 QPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQ
           -----------Q------------------Q----G--------------
Sequence 2 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI

Sequence 1 LGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSG
           --------------------------------------------S-Q---
Sequence 2 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRA

Sequence 1 QGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -------------------------------------------------
Sequence 2 VV-----------------------------------------------



Alignment 45
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: CAA25261
Sequence identity: 9.88 (82/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           ------------------------------------------------L-
Sequence 2 ----------------------------------------MKTFLILVLL

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQ--ASSQRPGQGQQPGQGQQEYYLTS
           -I-A-----------PQ-----P-Q-----Q-P---QQ---GQQ------
Sequence 2 AIVATTATTAVRFPVPQLQPQNPSQQLPQEQVPLVQQQQFLGQQQPF--P

Sequence 1 PQQSGQWQQPGQGQAGYYPTSP---QQSGQEQPGYYPTSPWQPEQLQQPT
           PQQ-----QP---Q--Y----P----Q----QP---P--P-QP----QP-
Sequence 2 PQQPYPQPQPFPSQLPYLQLQPFPQPQLPYSQP--QPFRPQQPYPQPQP-

Sequence 1 QGQQRQQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQG
           Q--Q-QQP---QQ--Q-QQ-QQ--Q-Q--------QQ----------Q--
Sequence 2 QYSQPQQPISQQQQQQQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHN

Sequence 1 QQPERGQQGQQSGQG--QQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQL
           ----R-Q--QQS-----Q-L------Q-P-Q-Q-----------I--QQ-
Sequence 2 IAHGRSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQ

Sequence 1 GQGQQSGQGQLGYYPTSP-QQSGQGQSGYYPTSAQQPGQLQQSTQEQQLG
           -Q-QQ----Q-------P-QQ---GQ----P---QQ--Q-Q-S-Q-QQL-
Sequence 2 KQ-QQQPSSQVSFQ--QPLQQYPLGQGSFRPS--QQNPQAQGSVQPQQLP

Sequence 1 QEQQDQQSGQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQG
           Q-------------------------------------------------
Sequence 2 QFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN--------------

Sequence 1 QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 VSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           --------------------------------------
Sequence 2 --------------------------------------



Alignment 46
Sequence 1:
Sequence 2: Allergen Tri a glutenin, Sequence: CAA24934
Sequence identity: 4.22 (35/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQGQPRYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQQPGQGQQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQGQQPGQEQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQWQQSGQGQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQPGQWQQPGQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQGQQGYYPTS
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQWLQPRQGQQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPYHVSAEHQAA
           ------------------------------------------VS-EHQAA
Sequence 2 -----------------------------------------LVSVEHQAA

Sequence 1 SLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           -LKVAKAQQLAAQLPAMCRLEGGDAL-ASQ
Sequence 2 RLKVAKAQQLAAQLPAMCRLEGGDALSASQ



Alignment 47
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 11.93 (99/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQ--
           -------------------G---------GQ-----Q--QL-----D---
Sequence 2 ------------CLLLLFNGCLASRQHIFGQ-NKEWQLNQLEAREPDNHI

Sequence 1 QSGQGRQGQQSGQRQQDQQSG-----QGQQP-GQRQPGYYSTSPQQL---
           QS--G----------Q-Q--G---------P-G---P-Y----PQ-----
Sequence 2 QSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVN-APQLIYIV

Sequence 1 -GQG-QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQ-GQQGQQPGQ
           -G-G------P----------QP-Q-QQ--Q-QQ-----Q-G-QGQQ--Q
Sequence 2 RGRGVLGAVFPGCAETF-EDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQ

Sequence 1 GEQGQQPGQGQQGQQPGQ--GQPGYYPTSPQQSGQGQP----GYYPTSPQ
           GE--Q---Q-------G-----P----------G--QP------------
Sequence 2 GEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGE-QPLVAVSLLDLNND

Sequence 1 QSGQLQQPAQGQQPGQEQQGQQPGQ-GQQGQQPGQGQQPGQGQPGYYPTS
           Q----Q-P------G--Q----P-Q-G-Q-QQ--QGQQ-G-G--------
Sequence 2 QNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQ-GNGNNIFSGFD

Sequence 1 PQQSGQEQQLE-QWQQSGQGQPGHYPTSPLQPGQGQPGYY-PTSPQQIGQ
           -Q---Q------------QGQ------------QGQ-----P-S----G-
Sequence 2 TQLLAQALNVNPETARNLQGQDDNR--NEIVRVQGQLDFVSPFSRSAGGR

Sequence 1 GQQPGQLQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGY
           G-Q--Q-Q---Q-Q------Q--Q-QQ-G-GQ--------------Q---
Sequence 2 GDQERQ-QEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIG

Sequence 1 YPTSLQQSGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQP
           -P-------------------------Y---S------------T-----
Sequence 2 DPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHT

Sequence 1 GQGPQPGQWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLT
           ---------------Q-------P------------L-P-----------
Sequence 2 NANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASN

Sequence 1 SPQQLGQGQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSP
           ------------------------------------------Q-------
Sequence 2 EGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY

Sequence 1 QQSGQGQQGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALL
           -----------SP-------------------------------------
Sequence 2 NRQESRLLSATSPPRGRLMSILGY--------------------------

Sequence 1 ASQ
           ---
Sequence 2 ---



Alignment 48
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34287
Sequence identity: 9.76 (81/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           ----------------------------------------QQ---L--PQ
Sequence 2 ---------------------------------------PQQPFPL-QPQ

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           QS--WQ-----Q--------Q-S-Q-Q------SP--P-----P--G---
Sequence 2 QSFLWQS----QQPFLQQPQQPSPQPQQVVQIISPATPTTI--PSAGKPT

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQ-PRYYPTSSQQ--PGQL---QQLAQGQQ
           --P---QQ----QQ-QQ--Q-Q-P---P---QQ--P------QQ------
Sequence 2 SAPFPQQQ----QQHQQLAQQQIPVVQPSILQQLNPCKVFLQQQCSPVAM

Sequence 1 GQQPERGQQGQQSGQGQQLGQGQQGQQ-PGQKQQSGQGQQGYYPISPQQL
           -Q---R-Q--QQS-------Q-Q--QQ-P---QQS----Q----I-----
Sequence 2 PQRLARSQMLQQSSC--HVMQQQCCQQLPQIPQQSRY--QAIRAIIYSII

Sequence 1 GQGQQSGQGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQ
           -Q-QQ--QG--------PQQ-GQ--S--------QP---QQ--Q-QQLGQ
Sequence 2 LQEQQQVQGSIQSQQQQPQQLGQCVS--------QP---QQQSQ-QQLGQ

Sequence 1 EQQDQQSGQGR--QGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQLGQ
           --Q-QQ--QG---Q--Q--Q------------P-----------------
Sequence 2 QPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVP

Sequence 1 GQPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQGQQGQQPGQGEQGQ
           --------------------------------------------------
Sequence 2 FGVGTGVGAY----------------------------------------

Sequence 1 QPGQGQQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSPQQSGQLQQPAQG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLEQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 WQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQLQQPTQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQSGQGQQP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPGQWQQSGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQGQQPRQW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQQGYDSPY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ---------------------------------------
Sequence 2 ---------------------------------------



Alignment 49
Sequence 1:
Sequence 2: Allergen Tri a gliadin, Sequence: AAA34284
Sequence identity: 7.35 (61/830)
Sequence 1 MTKRLVLFAAVVVALVALTAAEGEASGQLQCERELQEHSLKACRQVVDQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LRDVSPECQPVGGGPVARQYEQQVVVPPKGGSFYPGETTPPQQLQQSILW
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GIPALLRRYYLSVTSPQQVSYYPGQASSQRPGQGQQPGQGQQEYYLTSPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QSGQWQQPGQGQAGYYPTSPQQSGQEQPGYYPTSPWQPEQLQQPTQGQQR
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPGQGQQLRQGQQGQQSGQGQPRYYPTSSQQPGQLQQLAQGQQGQQPER
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQGQQSGQGQQLGQGQQGQQPGQKQQSGQGQQGYYPISPQQLGQGQQSG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGQLGYYPTSPQQSGQGQSGYYPTSAQQPGQLQQSTQEQQLGQEQQDQQS
           ---------------------------QP-Q-Q-S---Q---Q-QQ-QQ-
Sequence 2 --------------------------PQP-QPQYSQPQQPISQQQQQQQ-

Sequence 1 GQGRQGQQSGQRQQDQQSGQGQQPGQRQPGYYSTSPQQ-LGQGQPRYYPT
           ------QQ--Q-QQ-QQ--Q-----Q--P-------Q-----G-------
Sequence 2 ------QQQQQQQQEQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQ

Sequence 1 SPQQPGQEQQPRQLQQ-PEQGQ-QG----------QQPEQGQQGQQPGQG
           S--Q--QE-----L-Q-PEQ-Q-Q------------Q--Q-QQ-QQP---
Sequence 2 STYQLLQELCCQHLWQIPEQSQCQAIHNVVHAIILHQQQQKQQ-QQPSSQ

Sequence 1 EQGQQPGQGQQGQQPGQGQPGYYPT--SPQQSGQGQPGYYPTSPQQSGQL
           ---QQP-Q----Q-P--GQ----P----PQ--G--QP---P--------L
Sequence 2 FSFQQPLQ----QYP-LGQGSFRPSQQNPQAQGSVQPQQLPQFEIRNLAL

Sequence 1 QQ-PAQGQQPGQEQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSPQQSG
           Q--PA-------------P-------------------------------
Sequence 2 QTLPAMCNVYIPPYCTIAPFGIFGTN------------------------

Sequence 1 QEQQLEQWQQSGQGQPGHYPTSPLQPGQGQPGYYPTSPQQIGQGQQPGQL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPGYYPTSLQQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 SGQGQQPGQWQQPGQGLPGYYPTSSLQPEQGQQGYYPTSQQQPGQGPQPG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QWQQSGQGQQGYYPTSPQQSGQGQQPGQWLQPGQWLQSGYYLTSPQQLGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GQQPRQWLQPRQGQQGYYPTSPQQSGQGQQLGQGQQGYYPTSPQQSGQGQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QGYDSPYHVSAEHQAASLKVAKAQQLAAQLPAMCRLEGGDALLASQ
           ----------------------------------------------
Sequence 2 ----------------------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.