The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Jun a 2

Sequence 9955725

Full FASTA alignment

Sequence name:
Query sequence:
MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQRWVCSC
HNKIYNP

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Jun a 2CAC05582Go!507769.90.0e+00
2Cha o 2.0101Q7M1E7Go!514638.92.0e-184
3Cry j 2P43212Go!514561.93.1e-161
4Cry j 2BAA06172Go!514558.24.0e-160
5Sor h 13.0201A0A077B569Go!410201.38.8e-53
6Pla a 2Q6H9K0Go!377199.52.8e-52
7Sor h 13.0101A0A077B155Go!422197.11.6e-51
8Cari p 1.0101C9EA45Go!494195.94.5e-51
9Pla or 2.0101ABY21306Go!378193.41.9e-50
10Phl p 13CAB42886Go!394193.42.0e-50
11Ole e 14.0101W8PPL3Go!379174.87.3e-45
12Sal k 6.0101AHL24657Go!379170.51.5e-43
13Sal k 6.0101ARS33724Go!401170.51.6e-43
14Cup s 2.0101C0HKB1Go!16472.71.8e-14

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Jun a 2, Sequence: CAC05582
Sequence identity: 100.00 (507/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
Sequence 2 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
Sequence 2 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
Sequence 2 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN

Sequence 1 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
           LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
Sequence 2 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL

Sequence 1 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
           TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
Sequence 2 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC

Sequence 1 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
           TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
Sequence 2 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL

Sequence 1 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
           DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
Sequence 2 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS

Sequence 1 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
           AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
Sequence 2 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF

Sequence 1 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
           LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
Sequence 2 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL

Sequence 1 MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQRWVCSC
           MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQRWVCSC
Sequence 2 MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQRWVCSC

Sequence 1 HNKIYNP
           HNKIYNP
Sequence 2 HNKIYNP



Alignment 2
Sequence 1:
Sequence 2: Allergen Cha o 2.0101, Sequence: Q7M1E7
Sequence identity: 81.85 (415/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           M-MKFMAA-AFLALQLIVMAA-EDQSAQIMLDSD--QY-RS-R-L-K-VH
Sequence 2 MGMKFMAAVAFLALQLIVMAAAEDQSAQIMLDSDIEQYLRSNRSLKKLVH

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           --RHD-A-VFNVE-YGAVGDGKHDST-AF--TWNAAC-K-SAV-LVPANK
Sequence 2 -SRHDAATVFNVEQYGAVGDGKHDSTEAFATTWNAACKKASAVLLVPANK

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           KF-VNNLVF-GPCQPH-SFKVDGTI-A-PDPA-WKNSKIW--FA-LTDFN
Sequence 2 KFFVNNLVFRGPCQPHLSFKVDGTIVAQPDPARWKNSKIWLQFAQLTDFN

Sequence 1 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
           LMGTGVIDGQG--WW--QCK--NGRTVCND--RPTAIKID-SKSVTVKEL
Sequence 2 LMGTGVIDGQGQQWWAGQCKVVNGRTVCNDRNRPTAIKIDYSKSVTVKEL

Sequence 1 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
           TL-NSPEFHLVFGEC-GVKIQG-KIKAPRDSPNTDGIDIFASKRF-IEKC
Sequence 2 TLMNSPEFHLVFGECEGVKIQGLKIKAPRDSPNTDGIDIFASKRFHIEKC

Sequence 1 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
           -IGTGDDC-A-GTGSSNITIKDL-CGPGHG-SIGSLG--NSR-EVS-VH-
Sequence 2 VIGTGDDCIAIGTGSSNITIKDLICGPGHGISIGSLGRDNSRAEVSHVHV

Sequence 1 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
           --AKFIDTQNGLRIKTWQGGSGLAS-ITYENVEMIN-ENPILINQFYCTS
Sequence 2 NRAKFIDTQNGLRIKTWQGGSGLASYITYENVEMINSENPILINQFYCTS

Sequence 1 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
           A-AC-NQRSAV-IQ-VT-KNIHGTSAT-AAIQLMCSDSVPC--I-LSNV-
Sequence 2 ASACQNQRSAVQIQGVTYKNIHGTSATAAAIQLMCSDSVPCTGIQLSNVS

Sequence 1 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
           LKLTSGK-A-CV-KNA-G-Y---L-P-CK-L-PG--PKE-EL-Q-PTT--
Sequence 2 LKLTSGKPASCVDKNARGFYSGRLIPTCKNLRPGPSPKEFELQQQPTTV-

Sequence 1 MDEKMGA---------SLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDY
           MDE--GA---------SL-SSPPNCKNKCKGCQPCKPKLIIVHPN-P-DY
Sequence 2 MDENKGACAKGDSTCISLSSSPPNCKNKCKGCQPCKPKLIIVHPNKPQDY

Sequence 1 YPQRWVCSCHNKIYNP
           YPQ-WVCSCHNKIYNP
Sequence 2 YPQKWVCSCHNKIYNP



Alignment 3
Sequence 1:
Sequence 2: Allergen Cry j 2, Sequence: P43212
Sequence identity: 70.41 (357/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           M-MKF-A--AF-A-QLI-MAA-EDQSAQIMLDSD--QY-RS-R-LRK-V-
Sequence 2 MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRK-VE

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           H-RHD----FNVE-YGAVGDGKHD-T-AF---W-AAC-K-SA--LVP-NK
Sequence 2 HSRHDAINIFNVEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNK

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           KFVVNNL-F-GPCQPHF-FKVDG-IAAY--PA-WKN--IW--FA-LT-F-
Sequence 2 KFVVNNLFFNGPCQPHFTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFT

Sequence 1 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
           LMG-GVIDGQG--WW--QCK--NGR--CND--RPTAIK-DFS-------L
Sequence 2 LMGKGVIDGQGKQWWAGQCKWVNGREICNDRDRPTAIKFDFSTGLIIQGL

Sequence 1 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
           -L-NSPEFHLVFG-C-GVKI-GI-I-APRDSPNTDGIDIFASK-F---K-
Sequence 2 KLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFASKNFHLQKN

Sequence 1 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
           TIGTGDDCVA-GTGSSNI-I-DL-CGPGHG-SIGSLG--NSR-EVS-VH-
Sequence 2 TIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHV

Sequence 1 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
           -GAKFIDTQNGLRIKTWQGGSG-ASHI-YENVEMIN-ENPILINQFYCTS
Sequence 2 NGAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTS

Sequence 1 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
           A-AC-NQRSAV-IQDVT-KNI-GTSAT-AAIQL-CSDS-PC--IKLS---
Sequence 2 ASACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDIS

Sequence 1 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
           LKLTSGK-A-C-N-NANGY------P-CK-L-P----KE---H--P-T--
Sequence 2 LKLTSGKIASCLNDNANGYFSGHVIPACKNLSPSAKRKESKSHKHPKTVM

Sequence 1 MDEKMGAS---------LNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDY
           ----MGA----------L-S-PPNC-NKC-GC-PCK-KL-IVH---P--Y
Sequence 2 V-KNMGAYDKGNRTRILLGSRPPNCTNKCHGCSPCKAKLVIVHRIMPQEY

Sequence 1 YPQRWVCSCHNKIYNP
           YPQRW-CS-H-KIY-P
Sequence 2 YPQRWMCSRHGKIYHP



Alignment 4
Sequence 1:
Sequence 2: Allergen Cry j 2, Sequence: BAA06172
Sequence identity: 69.82 (354/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           M-MK--A--AFLA-QLI-MAA-EDQSAQIMLDS----Y-RS-R-LRK-V-
Sequence 2 MAMKLIAPMAFLAMQLIIMAAAEDQSAQIMLDSVVEKYLRSNRSLRK-VE

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           H-RHD----FNVE-YGAVGDGKHD-T-AF---W-AAC---SA--LVP--K
Sequence 2 HSRHDAINIFNVEKYGAVGDGKHDCTEAFSTAWQAACKNPSAMLLVPGSK

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           KFVVNNL-F-GPCQPHF-FKVDG-IAAY--PA-WKN--IW--FA-LT-F-
Sequence 2 KFVVNNLFFNGPCQPHFTFKVDGIIAAYQNPASWKNNRIWLQFAKLTGFT

Sequence 1 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
           LMG-GVIDGQG--WW--QCK--NGR--CND--RPTAIK-DFS-------L
Sequence 2 LMGKGVIDGQGKQWWAGQCKWVNGREICNDRDRPTAIKFDFSTGLIIQGL

Sequence 1 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
           -L-NSPEFHLVFG-C-GVKI-GI-I-APRDSPNTDGIDIFASK-F---K-
Sequence 2 KLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFASKNFHLQKN

Sequence 1 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
           TIGTGDDCVA-GTGSSNI-I-DL-CGPGHG-SIGSLG--NSR-EVS-VH-
Sequence 2 TIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHV

Sequence 1 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
           -GAKFIDTQNGLRIKTWQGGSG-ASHI-YENVEMIN-ENPILINQFYCTS
Sequence 2 NGAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTS

Sequence 1 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
           A-AC-NQRSAV-IQDVT-KNI-GTSAT-AAIQL-CSDS-PC--IKLS---
Sequence 2 ASACQNQRSAVQIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDIS

Sequence 1 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
           LKLTSGK-A-C-N-NANGY------P-CK-L-P----KE---H--P-T--
Sequence 2 LKLTSGKIASCLNDNANGYFSGHVIPACKNLSPSAKRKESKSHKHPKTVM

Sequence 1 MDEKMGAS---------LNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDY
           --E-M-A----------L-S-PPNC-NKC-GC-PCK-KL-IVH---P--Y
Sequence 2 V-ENMRAYDKGNRTRILLGSRPPNCTNKCHGCSPCKAKLVIVHRIMPQEY

Sequence 1 YPQRWVCSCHNKIYNP
           YPQRW-CSCH-KIY-P
Sequence 2 YPQRWICSCHGKIYHP



Alignment 5
Sequence 1:
Sequence 2: Allergen Sor h 13.0201, Sequence: A0A077B569
Sequence identity: 28.60 (145/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           ---------------------G----A---L-------------------
Sequence 2 -----------------MACTGNAMRAFFLLAFVCAAHAGKDAPAKDGDA

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSA-VFLVPAN
           -A-------F-----GA-GDGK-DST-A----W--AC--------L-P--
Sequence 2 KAASGPGGSFDISKLGASGDGKKDSTKAVQEAWTSACGGTGKQTILIPKG

Sequence 1 KKFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDF
           ----V--L-F-GPC-------VDG---A--D----K----W----R----
Sequence 2 D-YLVGPLNFTGPCKGDVTIQVDGNLLATTDLSQYKGN--WIEILRVDNL

Sequence 1 NLMGTGVIDGQGNRWWS-DQCKTINGRTVCNDKGRPTAIKIDFSKSVTVK
           ---G-G--DGQG---WS---C--------C--K--P-----D------V-
Sequence 2 VITGKGKLDGQGPAVWSKNSCAK---KYDC--KILPNSLVLDYVNNGEVS

Sequence 1 ELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIE
           --TL-N---FH-----C-GV-I------AP-DSPNTDGI-I--S----I-
Sequence 2 GITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSSKVTIT

Sequence 1 KCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFV
           --TIG-GDDC---G-GS--I-----TCGPGHG-S-GSLG-------V---
Sequence 2 GTTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDI

Sequence 1 HLDGAKFIDTQNGLRIKTWQGGSGL--ASHITYENVEMINAENPILINQF
           ---------T-NG-RIK----------AS---YEN--M----NPI-I---
Sequence 2 NVKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMK

Sequence 1 YCTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKL
           YC----------S-V---DVTFKNI-GTS-T--A--L-CSD--PCS----
Sequence 2 YCPNKICTAKGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTM

Sequence 1 SNVFL--KLTSGK-VATCVNKNANGYYTNPLNP-SCKSLHPGRTPKELEL
           -N-----K-T--K--A-C---NA-G--T--L----C--------------
Sequence 2 DNIKVEYKGTNNKTMAVC--QNAKGSATGCLKELACF-------------

Sequence 1 HQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQRWVCSCHNKIYNP
           ---------------
Sequence 2 ---------------



Alignment 6
Sequence 1:
Sequence 2: Allergen Pla a 2, Sequence: Q6H9K0
Sequence identity: 27.22 (138/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAAC-NKLSAVFLVPAN
           --------VFNV--YGA-G-G--D---A--K-W-AAC--------L-P--
Sequence 2 RGVQSSGSVFNVNDYGAKGAG--DISQAVMKAWKAACASQGPSTVLIPKG

Sequence 1 KKFVVNNLVFYGPCQ-PHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTD
           -----------GPC------F--DG---A--DP-K-K-S--W--F-R---
Sequence 2 N-YNMGEVAMQGPCKGSKIGFQIDGVVKAPADPSKFK-SDGWVSFYRIDG

Sequence 1 FNLMGTGVIDGQGNRWWS-DQC-KTINGRTVCNDKGRPTAIKIDFSKSVT
           ----GTG--DGQG---W----C-K--N----C--K--------DF-K---
Sequence 2 LTVSGTGTLDGQGQTAWAKNNCDKNPN----C--KHAAMNLRFDFLKHAM

Sequence 1 VKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFE
           V---T--NS--FH----EC-----Q-----AP--S-NTDGI----SK---
Sequence 2 VRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVT

Sequence 1 IEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVS
           I----I-TGDDC---G-GS-N-TI----CGPGHG-SIGSLG--N---EV-
Sequence 2 ITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVR

Sequence 1 FVHLDGAKFIDTQNGLRIKTWQGGS-GLASHITYENVEMINAENPILINQ
           -----G--F--T-NG-R-KTW-----G-A---T-----M-N--NP----Q
Sequence 2 GITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQ

Sequence 1 FYCTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIK
           -YC----------S--K-----F-NI-GTS----A----CS---PCSN-K
Sequence 2 EYCPYGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMK

Sequence 1 LSNVFLKLT-SGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQ
           -----L-----G--AT----N----------P--K---------------
Sequence 2 IGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAIKCA-------------

Sequence 1 KPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RWVCSCHNKIYNP
           -------------
Sequence 2 -------------



Alignment 7
Sequence 1:
Sequence 2: Allergen Sor h 13.0101, Sequence: A0A077B155
Sequence identity: 27.81 (141/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           -----MA------------A------------------------------
Sequence 2 -----MALGSNAMRVFFLLAMVVCAAHAAGKAAPKEKEKGKDDKSGGAPA

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           -A----A--------GA-GDGK-DST-A----W-AAC-K-----L-----
Sequence 2 EAPSGSAGGSDISKLGAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKG

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           ------L-F-GPC--------DG------D----K----W----------
Sequence 2 DYLTGPLNFSGPCKGSVTIQLDGNLLGTTDLSAYKTN--WIEIEHVDNLV

Sequence 1 LMGTGVIDGQGNRWW-SDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKE
           --G-G--DGQG---W----C--------C--K--P-----D------V--
Sequence 2 ISGKGTLDGQGKQVWDNNKCAQ---KYDC--KILPNSLVLDYVNNGEVSG

Sequence 1 LTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEK
           -TL-N---FH-----C-GV-I------AP-DSPNTDGI-I--S----I--
Sequence 2 ITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSSKVTITG

Sequence 1 CTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVH
           -TIG-GDDC---G-GS--I-----TCGPGHG-S-GSLG-------V----
Sequence 2 TTIGVGDDCISIGPGSTGINVTGVTCGPGHGISVGSLGRYKDEKDVTDIN

Sequence 1 LDGAKFIDTQNGLRIKTWQGGSGL--ASHITYENVEMINAENPILINQFY
           --------T-NG-RIK----------AS---YEN--M----NPI-I---Y
Sequence 2 VKDCTLKKTSNGVRIKSYEDAACVITASKLHYENIAMDDVANPIIIDMKY

Sequence 1 CTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLS
           C----------S-V---DVTFKNI-GTS-T--A--L-CSD--PCS-----
Sequence 2 CPNKICTAKGDSKVTVKDVTFKNITGTSSTPEAVSLLCSDKIPCSGVTMD

Sequence 1 NVFL--KLTSGK-VATCVNKNANGYYTNPLNP-SCKSLHPGRTPKELELH
           N-----K-T--K--A-C---NA-G--T--L----C---------------
Sequence 2 NIKVEYKGTNNKTMAVC--QNAKGSATGCLKELACF--------------

Sequence 1 QKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QRWVCSCHNKIYNP
           --------------
Sequence 2 --------------



Alignment 8
Sequence 1:
Sequence 2: Allergen Cari p 1.0101, Sequence: C9EA45
Sequence identity: 28.80 (146/507)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 MAVLYYDNYNRTHLLILSFSILFFSFSSRLVNSGFHGERRRERVHGYHYD

Sequence 1 -------MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSR
           ---------------L-------------------------T--------
Sequence 2 ELNNFSEDQEGGLTLLSGAGYDPEAHPSFLSSINGDRDEEFTEAEPSVLS

Sequence 1 NLRKRVHHARHDVAIVFNVEHYGAVGDGKHDSTD-AFEKTWNAACN-KLS
           ----------------FNV---GA-GDG-HD-T---FE--W--AC--K--
Sequence 2 FKGIEDLRSAKPRSVIFNVDDFGAEGDGIHDDTQQVFEEAWEKACSYKGP

Sequence 1 AVFLVPANKKFVVNNLVFYGPCQPHF--SFKVDGTIAAYPDPAKW-KNSK
           A-FLVP-----------F-GPC-----------GTI-A--------K---
Sequence 2 ALFLVPERRTYLIGPIRFLGPCKSNLVIQVQISGTILASDNRSDYRKDPR

Sequence 1 IWMHFARLTDFNLMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIK
           -W------------G-G-I-G-G--WW---CK-------C------T--K
Sequence 2 HWIVIDSVDNLLVEGGGTIHGNGQIWWRNSCKAP-----CKEAPTVTFYK

Sequence 1 IDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGID
           ----K---V--------------F--C--V--------AP--SPNTDGI-
Sequence 2 ---CKNLMVRNVKVQDAQQMQVSFEKCSEVTASDLTVTAPEKSPNTDGIH

Sequence 1 IFASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGK
           --------I----IG-GDDC-----GS-N--I--LTCGPGHG----SLG-
Sequence 2 VTNTQNILITNTFIG-GDDCISIESGSHNVQIEELTCGPGHGINVDSLGD

Sequence 1 GNSRSEVSFVHLDGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAE
           -NS---VSFV---GAK---T-NG-RIKT-QGGSG-AS-I---NV-M-N--
Sequence 2 NNSKAFVSFVTVNGAKLSGTTNGVRIKTYQGGSGSASNIKFQNVDMENVK

Sequence 1 NPILINQFYCTSAAACKNQ-RSAVKIQDVTFKNIHGTSATTAAIQLMCSD
           NPI-I-Q-YC-----CK-Q--SAV---DV---NI-G-SA---AI---CS-
Sequence 2 NPIIIDQNYCDQKKPCKKQQKSAVQVKDVLYQNIQGNSASDVAIDFDCSE

Sequence 1 SVPCSNIKLSNVFLKLTS--GKVATCVNKNANGYYTNPLNPSCKSLHPGR
           --PC---KL-NV-L---------A-----------T----P-C---H---
Sequence 2 NYPCLGVKLQNVRLQRADRVDEEAKAICNHVELTETGVVFPRCPDYHLKH

Sequence 1 TPKELELHQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHP
           --------------------------------------------------
Sequence 2 DEL-----------------------------------------------

Sequence 1 NQPEDYYPQRWVCSCHNKIYNP
           ----------------------
Sequence 2 ----------------------



Alignment 9
Sequence 1:
Sequence 2: Allergen Pla or 2.0101, Sequence: ABY21306
Sequence identity: 26.82 (136/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           --------------------------------------------------
Sequence 2 -------------------------------------------------M

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAAC-NKLSAVFLVPAN
           ---------FNV--YGA-G-G--D---A--K-W-AAC--------L-P--
Sequence 2 RGVQSSGGTFNVNDYGAKGSG--DISQAVMKAWEAACASPGPSTVLIPTG

Sequence 1 KKFVVNNLVFYGPCQ-PHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTD
           -----------GPC------F--DG---A--D----K-S--W--F-----
Sequence 2 N-YIMGEVLLEGPCKGSKIGFQLDGVVKAPADVSAFK-SEGWVVFNHVDG

Sequence 1 FNLMGTGVIDGQGNRWWS-DQC-KTINGRTVCNDKGRPTAIKIDFSKSVT
           ----G-G--DGQG---W----C-K--N----CN----P--I---F-K---
Sequence 2 LTVSGKGTFDGQGQKAWAANNCDKDEN----CNRP--PMNIRFNFLKNAV

Sequence 1 VKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFE
           V---T--NS--FH----ECD----Q---I-AP--S-NTDGI-I--S----
Sequence 2 VRDITSMNSKMFHINVLECDNISFQHVTISAPGTSINTDGIHIGLSRGVT

Sequence 1 IEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVS
           I----I-TGDDCV--G-GS-N-T-----CGPGHG-S-GSLGK------V-
Sequence 2 ITDTNIATGDDCVSIGPGSQNVTVTKVNCGPGHGISVGSLGKYKDEKDVR

Sequence 1 FVHLDGAKFIDTQNGLRIKTWQGGS-GLASHITYENVEMINAENPILINQ
           -----G--F--T-NG-R-KTW-----G-A-----E---M-N--NP----Q
Sequence 2 GITVTGCTFTGTSNGVRVKTWPDSPPGVATDMAFEDLTMKNVQNPVILDQ

Sequence 1 FYCTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIK
           -YC----------S-VK-----F-NI-GTS----AI---CS---PCSN--
Sequence 2 EYCPYGQCSLKAPSRVKLSNIKFNNIRGTSSGPDAIVIACSHGFPCSNLE

Sequence 1 LSNVFLKL-TSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQ
           -----L-L---G--A-----NA---------P--K---------------
Sequence 2 IGEINLALHAAGAPANSTCTNAKPIFSGKQVPAIKCA-------------

Sequence 1 KPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQ
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 RWVCSCHNKIYNP
           -------------
Sequence 2 -------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Phl p 13, Sequence: CAB42886
Sequence identity: 27.61 (140/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           ----------------------------------------------K---
Sequence 2 ------------------------------------GKKEEKKEEKKESG

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           -A-------------GA--DGK-D-T---E--W--AC--------V----
Sequence 2 DAASGADGTYDITKLGAKPDGKTDCTKEVEEAWASACGGTGKNTIVIPKG

Sequence 1 KFVVNNLVFYGPCQ-PHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDF
           -F----L-F-GPC-------K-DG------D-AK-K----W----R----
Sequence 2 DFLTGPLNFTGPCKGDSVTIKLDGNLLSSNDLAKYKAN--WIEIMRIKKL

Sequence 1 NLMGTGVIDGQGNRWWS-DQC-KTINGRTVCNDKGRPTAIKIDFSKSVTV
           ---G-G--DGQG---W----C-K--N----C--K--P-----DF------
Sequence 2 TITGKGTLDGQGKAVWGKNSCAKNYN----C--KILPNTLVLDFCDDALI

Sequence 1 KELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEI
           ---TL-N---FH----EC-GV------I-AP-DSPNTDGI-I--S----I
Sequence 2 EGITLLNAKFFHMNIYECKGVTVKDVTITAPGDSPNTDGIHIGDSSKVTI

Sequence 1 EKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSF
           ---TIGTGDDC---G-GS----I---TCGPGHG-S-GSLG-------V--
Sequence 2 TDTTIGTGDDCISIGPGSTGLNITGVTCGPGHGISVGSLGRYKDEKDVTD

Sequence 1 VHLDGAKFIDTQNGLRIKTWQGGSG--LASHITYENVEMINAENPILINQ
           ------------NGLRIK----------AS--TYENV-M-----PI-I-Q
Sequence 2 ITVKNCVLKKSTNGLRIKSYEDAKSPLTASKLTYENVKMEDVGYPIIIDQ

Sequence 1 FYCTSAAACKNQRSA-VKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNI
           -YC----------SA-V---DVTF-NI-GTS-T--A--L-CSD--PC---
Sequence 2 KYCPNKICTSKGDSARVTVKDVTFRNITGTSSTPEAVSLLCSDKQPCNGV

Sequence 1 KLSNVFLKL--TSGK-VATCVNKNANGYYTNPLNPSCKSLHPGRTPKELE
           ----V------T--K--A-C-N-----------N--C-------------
Sequence 2 TMNDVKIEYSGTNNKTMAVCTNAKVTAKGVSEAN-TCAA-----------

Sequence 1 LHQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YPQRWVCSCHNKIYNP
           ----------------
Sequence 2 ----------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Ole e 14.0101, Sequence: W8PPL3
Sequence identity: 24.85 (126/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           --------------------------------------------------
Sequence 2 --------------------------------------------IPHNGV

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           ---------F-V--YGA--DG--D---AF-K-W-AAC--------V----
Sequence 2 RRGLVGETIFDVMKYGAKADGRFDNAQAFIKAWKAACESTGPAKVVIPKG

Sequence 1 KFVVNNLVFYGPCQ-PH-FSFKVDGTIAAYPDPAKWKNSKIWMHFARLTD
           -FV----VF-GPC--P--------G---A--D---------W--------
Sequence 2 DFVAGEVVFQGPCTAPKPITIEIQGNVLASTDVSAYTSGS-WIMLEEIDG

Sequence 1 FNLMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSK--SVT
           ----G-G-I-G-G---W--------G----N--G--------F-K-----
Sequence 2 LVINGGGTINGRGKSSWQ-----FAG---ANNEGPLLPVSLTFKKVKNSE

Sequence 1 VKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFE
           --------S--FH---------KI---KI-AP-DSPNTDG--I--S----
Sequence 2 MHDVNFVDSMGFHSKVADSENIKISKLKISAPGDSPNTDGMHISCSTNVN

Sequence 1 IEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVS
           -----IGTGDDCV--G-G---I-----TCGPGHG-S-GSLGK------V-
Sequence 2 VTDSIIGTGDDCVSIGHGTTDILVSGITCGPGHGISVGSLGKRPDETDVK

Sequence 1 FVHLDGAKFIDTQNGLRIKTWQGGSGL-ASHITYENVEMINAENPILINQ
           -----------T-NG-RIKT--------AS-I-Y---------NPILI-Q
Sequence 2 GISVINCTLTGTTNGARIKTYHASPSIQASDILYKDIIVTDVKNPILIDQ

Sequence 1 FYCTSAAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIK
           -Y-------K---S-VKI--V-F-NI-GT--------L-CS--VPC----
Sequence 2 HYDSKK---KPEQSKVKISGVHFVNIKGTTVSEIPVALNCSEAVPCEDVE

Sequence 1 LSNVFLKLTSGKVATCVNKNANGYYT---NPLNPSCKSLHPGRTPKELEL
           L----L---SG---------AN--------P--P-C--------------
Sequence 2 LADIDLA-PSGAAGSLKSVCANAKFVLKGKPIPPGC--------------

Sequence 1 HQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PQRWVCSCHNKIYNP
           ---------------
Sequence 2 ---------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Sal k 6.0101, Sequence: AHL24657
Sequence identity: 24.46 (124/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLS-AVFLVPAN
           ---------------GA------D-T-A----W--AC-----A---VPA-
Sequence 2 ------QGPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAG

Sequence 1 KKFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFAR---L
           --F--N-----GPC---------G---A--D-A--K----W--------L
Sequence 2 E-FLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGL

Sequence 1 TDFNLMGTGVIDGQGNR-WWSDQCKTINGRTVCNDKGRPTAIKIDFSKSV
           T---L---G--DGQG---W----C----G---CN----P-----------
Sequence 2 TITCLPTGGTFDGQGQAAWKQNKCAQ-SG--MCNSL--PYNFRFNTLTNA

Sequence 1 TVKELTLTNSPEFHL-VFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKR
           --------NS---H--V-G-C------G--I-AP-DS-NTDG--I--S--
Sequence 2 QISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNTDGMHIGRSNG

Sequence 1 FEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE
           -------IGTGDDC---G-G---------TCGPGHG-SIGS-GK------
Sequence 2 VHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAP

Sequence 1 VSFVHLDGAKFIDTQNGLRIKTWQGG-SGLASHITYENVEMINAENPILI
           ----------F-DT-NG-RIK-W-------AS----E-----N--NP--I
Sequence 2 NTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVII

Sequence 1 NQFYCTSAAACKNQR-SAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCS
           -Q-YC-----CK----S-VK-----FKN-HG---------L-CS--VPC-
Sequence 2 DQEYCPYNH-CKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCD

Sequence 1 NIKLSNVFLKLTSGK-VATCVNKNANGYYTNPLNP-SCKSLHPGRTPKEL
           ---L----L----G--V--C--KN-----T---NP--C--------P---
Sequence 2 GVELADIDLTFPGGAAVSQC--KNVKPIVTGKQNPVACGAPATPAAP---

Sequence 1 ELHQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPED
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YYPQRWVCSCHNKIYNP
           -----------------
Sequence 2 -----------------



Alignment 13
Sequence 1:
Sequence 2: Allergen Sal k 6.0101, Sequence: ARS33724
Sequence identity: 24.65 (125/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           -----------------------------------K--------------
Sequence 2 ----------------------------------MKTFNLPLLVALFYLF

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLS-AVFLVPAN
           ---------------GA------D-T-A----W--AC-----A---VPA-
Sequence 2 VSVARSQGPIDITKFGAKPNA--DATSALLAAWKEACAAAAPAKIVVPAG

Sequence 1 KKFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFAR---L
           --F--N-----GPC---------G---A--D-A--K----W--------L
Sequence 2 E-FLLNAVKLQGPCKAPLTIEIAGNFKAPADVAQMKGEDTWVKIENVQGL

Sequence 1 TDFNLMGTGVIDGQGNR-WWSDQCKTINGRTVCNDKGRPTAIKIDFSKSV
           T---L---G--DGQG---W----C----G---CN----P-----------
Sequence 2 TITCLPTGGTFDGQGQAAWKQNKCAQ-SG--MCNSL--PYNFRFNTLTNA

Sequence 1 TVKELTLTNSPEFHL-VFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKR
           --------NS---H--V-G-C------G--I-AP-DS-NTDG--I--S--
Sequence 2 QISGIKSLNSKLYHMGVMG-CKNITLTGLTIDAPKDSLNTDGMHIGRSNG

Sequence 1 FEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSE
           -------IGTGDDC---G-G---------TCGPGHG-SIGS-GK------
Sequence 2 VHATNSKIGTGDDCISMGDGAVDVHVEGITCGPGHGISIGSMGKFANEAP

Sequence 1 VSFVHLDGAKFIDTQNGLRIKTWQGG-SGLASHITYENVEMINAENPILI
           ----------F-DT-NG-RIK-W-------AS----E-----N--NP--I
Sequence 2 NTGIFVKNCSFTDTDNGVRIKSWMNSFEASASDLHFEDITVTNVLNPVII

Sequence 1 NQFYCTSAAACKNQR-SAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCS
           -Q-YC-----CK----S-VK-----FKN-HG---------L-CS--VPC-
Sequence 2 DQEYCPYNH-CKEKTPSKVKLSKISFKNVHGAAKSAEVVKLLCSSAVPCD

Sequence 1 NIKLSNVFLKLTSGK-VATCVNKNANGYYTNPLNP-SCKSLHPGRTPKEL
           ---L----L----G--V--C--KN-----T---NP--C--------P---
Sequence 2 GVELADIDLTFPGGAAVSQC--KNVKPIVTGKQNPVACGAPATPAAP---

Sequence 1 ELHQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPED
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 YYPQRWVCSCHNKIYNP
           -----------------
Sequence 2 -----------------



Alignment 14
Sequence 1:
Sequence 2: Allergen Cup s 2.0101, Sequence: C0HKB1
Sequence identity: 26.63 (135/507)
Sequence 1 MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVH
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HARHDVAIVFNVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANK
           ----DVAIVFNVEH-------------------------LSAVFLVPANK
Sequence 2 ----DVAIVFNVEH------------------------TLSAVFLVPANK

Sequence 1 KFVVNNLVFYGPCQPHFSFKVDGTIAAYPDPAKWKNSKIWMHFARLTDFN
           K-------------------VDG-IAAYPDP-K-----IWMHFAR-----
Sequence 2 K-------------------VDGIIAAYPDPVK-----IWMHFAR-----

Sequence 1 LMGTGVIDGQGNRWWSDQCKTINGRTVCNDKGRPTAIKIDFSKSVTVKEL
           -------------------------TVCNDKGRPTAIKIDFSKS----EL
Sequence 2 -------------------------TVCNDKGRPTAIKIDFSKS----EL

Sequence 1 TLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIFASKRFEIEKC
           TL-NSPEFHLVFGECDGVKIQGIKIK-----------------RFEIEK-
Sequence 2 TLMNSPEFHLVFGECDGVKIQGIKIK-----------------RFEIEK-

Sequence 1 TIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
           ---------------------DLTCGPGHGMSIGSLGKGNSRSEVSFVHL
Sequence 2 ---------------------DLTCGPGHGMSIGSLGKGNSRSEVSFVHL

Sequence 1 DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTS
           DGAKFIDTQNGLR---------------Y---------------------
Sequence 2 DGAKFIDTQNGLRSAVKIEDVTFKNANGYYTNPLNPPCK-----------

Sequence 1 AAACKNQRSAVKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVF
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LKLTSGKVATCVNKNANGYYTNPLNPSCKSLHPGRTPKELELHQKPTTLL
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 MDEKMGASLNSSPPNCKNKCKGCQPCKPKLIIVHPNQPEDYYPQRWVCSC
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 HNKIYNP
           -------
Sequence 2 -------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.