The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Cyn d 24

Sequence 51950706

Full FASTA alignment

Sequence name:
Query sequence:
STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY
AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN
TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQ
KPY

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Cyn d 24.0101AAU15051Go!153241.95.8e-66
2Art ar 2.0101A0A2L1DGQ3Go!16393.53.0e-21
3Art ca 2.0101AVD29824Go!16393.53.0e-21
4Art la 2.0101AVD29826Go!16393.53.0e-21
5Art si 2.0101AVD29827Go!16393.53.0e-21
6Art an 2.0101AVD29822Go!16393.04.0e-21
7Art gm 2.0101AVD29825Go!16393.04.0e-21
8Pru p 9.0101XP_007199020Go!16184.91.1e-18
9Sco m 5.0101QEA69430Go!21057.62.4e-10
10Pol a 5Q05109Go!20956.55.1e-10
11Pol e 5.0101P35759Go!20555.21.2e-09
12Vesp m 5P81657Go!20254.02.9e-09
13Vesp c 5P35782Go!20254.02.9e-09
14Pol f 5P35780Go!20554.02.9e-09
15Dol a 5Q05108Go!20353.73.4e-09
16Pol e 5.0101AAT95009Go!22653.83.7e-09
17Vesp c 5P35781Go!20253.53.9e-09
18Vesp v 5.0101P0DMB9Go!20252.29.5e-09
19Pol d 5P81656Go!20651.61.5e-08
20Ves g 5P35784Go!20451.41.7e-08
21Pol g 5P83377Go!20651.02.3e-08
22Ves p 5P35785Go!20450.82.7e-08
23Poly p 5.0101C0HJV9Go!20650.82.7e-08
24Poly s 5.0101Q7Z156Go!20750.82.7e-08
25Dol m 5.02AAA28302Go!21249.95.0e-08
26Dol m 5.02P10737Go!21549.95.0e-08
27Ves f 5P35783Go!20449.37.6e-08
28Dol m 5.0101P10736Go!22749.38.1e-08
29Ves m 5P35760Go!20449.18.8e-08
30Ves vi 5P35787Go!20648.81.0e-07
31Ves s 5P35786Go!20548.41.4e-07
32Ves v 5Q05110Go!22748.31.7e-07
33Poly p 5.0102P86686Go!20747.82.1e-07
34Sol g 3.0101AAY32926Go!7038.15.8e-05
35Sol r 3P35779Go!21139.56.9e-05
36Sol i 3P35778Go!23438.91.2e-04
37Pac c 3.0101C0ITL3Go!19935.88.1e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Cyn d 24.0101, Sequence: AAU15051
Sequence identity: 100.00 (153/153)
Sequence 1 STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY
           STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY
Sequence 2 STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY

Sequence 1 AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN
           AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN
Sequence 2 AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN

Sequence 1 TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQ
           TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQ
Sequence 2 TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQ

Sequence 1 KPY
           KPY
Sequence 2 KPY



Alignment 2
Sequence 1:
Sequence 2: Allergen Art ar 2.0101, Sequence: A0A2L1DGQ3
Sequence identity: 39.87 (61/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           -------------------L-------G-------D----HN--R-----
Sequence 2 MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC---HSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW-----VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANSERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           --I-C-Y-PPGN---QKPY
Sequence 2 YIIVCNYDPPGNVVGQKPY



Alignment 3
Sequence 1:
Sequence 2: Allergen Art ca 2.0101, Sequence: AVD29824
Sequence identity: 39.87 (61/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           -------------------L-------G-------D----HN--R-----
Sequence 2 MGHLRNILLVLAISFAILHLSHAHGTYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC---HSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW-----VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANSERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           --I-C-Y-PPGN---QKPY
Sequence 2 YIIVCNYDPPGNVVGQKPY



Alignment 4
Sequence 1:
Sequence 2: Allergen Art la 2.0101, Sequence: AVD29826
Sequence identity: 39.22 (60/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           ---------------------------G-------D----HN--R-----
Sequence 2 MGHLRNISLVLAISFAILHSSHAHETYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC---HSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAETRTP-DCSLIHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW-----VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANSERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           --I-C-Y-PPGN---QKPY
Sequence 2 YIIVCNYDPPGNVVGQKPY



Alignment 5
Sequence 1:
Sequence 2: Allergen Art si 2.0101, Sequence: AVD29827
Sequence identity: 40.52 (62/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           -------------------L-------G-------D----HN--R-----
Sequence 2 MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC--VHSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAEARTA-DCSLVHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW-----VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANSERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           --I-C-Y-PPGN---QKPY
Sequence 2 YIIVCNYDPPGNVVGQKPY



Alignment 6
Sequence 1:
Sequence 2: Allergen Art an 2.0101, Sequence: AVD29822
Sequence identity: 40.52 (62/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           -------------------L-------G-------D----HN--R-----
Sequence 2 MGHLRNISLVLAILFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC--VHSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAETRTP-DCSLVHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW--T--VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANTERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           ----C-Y-PPGN---QKPY
Sequence 2 YITVCNYDPPGNVVGQKPY



Alignment 7
Sequence 1:
Sequence 2: Allergen Art gm 2.0101, Sequence: AVD29825
Sequence identity: 40.52 (62/153)
Sequence 1 ----------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHV
           -------------------L-------G-------D----HN--R-----
Sequence 2 MGHLRNISLVLAISFAILHLSHAHETYGEPGNTPDDYVHAHNCIRRVLGM

Sequence 1 PPLTWNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT
           -PL-W---LAK--Q--AE-----DC--VHSD---GEN-----GAI-----
Sequence 2 KPLCWDDELAKVAQAWAETRTP-DCSLVHSDR-CGENM--AQGAINGSMA

Sequence 1 VDTWSDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKD
           V--W-DE---Y-Y--N-C---KMCGHYT--VW--T--VGCGR-LC-----
Sequence 2 VQLWLDERLDYDYNENKCI--KMCGHYTQIVWANTERVGCGRALCSNGWA

Sequence 1 TMIMCSYWPPGNYENQKPY
           ----C-Y-PPGN---QKPY
Sequence 2 YITVCNYDPPGNVVGQKPY



Alignment 8
Sequence 1:
Sequence 2: Allergen Pru p 9.0101, Sequence: XP_007199020
Sequence identity: 37.91 (58/153)
Sequence 1 ------------STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLT
           ---------------L-------------I-----EHN--R------PL-
Sequence 2 MAFNTKLLLAICCVALVFTLVSANISKEEIDGFVEEHNKARKEVGNKPLK

Sequence 1 WNTTLAKFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTW
           WNTTLA---Q-YA------DC-M-HS----GENL--G-G--S-------W
Sequence 2 WNTTLAQYAQEYADKRVG-DCAMEHSMGRWGENLASGDG-MSGAAATKYW

Sequence 1 SDEKKSYHYGSNTCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIM
           --EK--Y---SN-C-----CGHY-AVVW--TT-VGCG---C---------
Sequence 2 VTEKEFYDEKSNKCVKDE-CGHYLAVVWGKTTEVGCGISKCNNGQN-YVV

Sequence 1 CSYWPPGNYENQKPY
           CSY-P----E---PY
Sequence 2 CSYDPMYQPEDERPY



Alignment 9
Sequence 1:
Sequence 2: Allergen Sco m 5.0101, Sequence: QEA69430
Sequence identity: 30.72 (47/153)
Sequence 1 -----------------------------STQLPSDEPLNGLNDKAIQDI
           -----------------------------------------L--K--Q--
Sequence 2 MTIFLTSTLFVLLVFQILGKGMGCDMKVRGLDANMKKMILDLHNKKRQTV

Sequence 1 LN-EHNMFRAKEHVPPLTWNTTLAKFSQDYAESKL-KKDCKMVHSDSPY-
           -N--------------L-W----A---Q--AE--------K-----S-Y-
Sequence 2 ANGQQSGQPSAANMKELHWDDQIAANAQRSAETCVFQHTAKNLRKTSKYS

Sequence 1 --GENLMFGSGAISWKTTVDTWSDEKKSYHYG--SNTCDQGKMCGHYTAV
           --GEN---GS--------V--W-DE-K-------------G-M-GHYT--
Sequence 2 YLGENIYMGSYPDPIPRSVNAWYDEVKDVTPAVVKSFRSGGPMIGHYTQM

Sequence 1 VWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY-----------
           VW--T---GCG-V---DK--T-I-C-Y-P-GNY-----Y-----------
Sequence 2 VWANTEALGCGLVTASDK-NTYIFCQYGPSGNYPGEPIYKQGSPASDCKK

Sequence 1 -----------
           -----------
Sequence 2 GKSSKYPGLCN



Alignment 10
Sequence 1:
Sequence 2: Allergen Pol a 5, Sequence: Q05109
Sequence identity: 30.72 (47/153)
Sequence 1 -----------------------------STQLPSDEPLNGLNDKAIQDI
           ----------------------------------------G--------I
Sequence 2 SSQGVDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLI

Sequence 1 LNEHNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK
           --EHN-FR-K----------------------L-WN--LA---Q--A---
Sequence 2 VSEHNRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQC

Sequence 1 --LKKD-CKMVHSDSPYGENLMF--GSGAISWKTTVDTWSDEKKSYHYGS
           --L--D-C-------P-G-N-----GS-----------W--E-K---Y--
Sequence 2 QFLVHDKCRNT-AKYPVGQNIAYAGGSNLPDVVSLIKLWENEVKDFNYNT

Sequence 1 NTCDQG-KMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGN
           ----Q-----GHYT--VW--T---GCG---------------C-Y-P-GN
Sequence 2 GITKQNFAKIGHYTQMVWGKTKEIGCGSLKYMENNMQNHYLICNYGPAGN

Sequence 1 YENQKPY---
           Y--Q-PY---
Sequence 2 YLGQLPYTKK



Alignment 11
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: P35759
Sequence identity: 30.07 (46/153)
Sequence 1 -------------------------STQLPSDEPLNGLNDKAIQDILNEH
           ------------------------------------G--------I--EH
Sequence 2 VDYCKIKCPSGIHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVSEH

Sequence 1 NMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK--LK
           N-FR-K----------------------L-WN--LA---Q--A-----L-
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNDLVWNDELAHIAQVWASQCQFLV

Sequence 1 KD-CKMVHSDSPYGENLMFGSGA--ISWKTTVDTWSDEKKSYHYGSNTCD
           -D-C-------P-G-N-----G------------W--E-K---Y------
Sequence 2 HDKCRNT-AKYPVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNTGITK

Sequence 1 QG-KMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYENQ
           Q-----GHYT--VW--T---GCG---------------C-Y-P-GNY--Q
Sequence 2 QNFAKIGHYTQMVWGKTKEIGCGSLKYIENKMQNHYLICNYGPAGNYLGQ

Sequence 1 KPY---
           -PY---
Sequence 2 LPYTKK



Alignment 12
Sequence 1:
Sequence 2: Allergen Vesp m 5, Sequence: P81657
Sequence identity: 35.29 (54/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-------IL--HN-
Sequence 2 NNYCKIKCRSGIHTLCKFGISTKPNCGKNVVKASGLTKAEKLEILKQHNE

Sequence 1 FRAKEHV-----------PP------LTWNTTLAKFSQDYA-ESKLKKD-
           FR-K--------------PP------L-WN--LA---Q--A-------D-
Sequence 2 FRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDV

Sequence 1 CKMVHSDSPYGENLMF-GSGAISWKTT---VDTWSDEKKSYHYGSNTCDQ
           C------S--G-N----GS-A-S-------V--W-DE-K-Y-YGS-T---
Sequence 2 CRNTAKYS-VGQNIAENGSTAASFASVSNMVQMWADEVKNYQYGS-TKNK

Sequence 1 GKMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQKP
           ----GHYT--VW--T---GCG---------------C-Y-P-GN--N---
Sequence 2 LIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGNEPI

Sequence 1 Y---
           Y---
Sequence 2 YERK



Alignment 13
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35782
Sequence identity: 33.99 (52/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-------IL--HN-
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNE

Sequence 1 FRAKEHV-----------PP------LTWNTTLAKFSQDYAE--SKLKKD
           FR-K--------------PP------L-WN--LA---Q--A---------
Sequence 2 FRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDN

Sequence 1 CKMVHSDSPYGENLMFGSGA----ISWKTTVDTWSDEKKSYHYGSNTCDQ
           C------S--G-N---GS------------V--W-DE-K-Y-YGS-----
Sequence 2 CRNSAKYS-VGQNIAEGSTSADNFVNVSNMVKMWEDEVKDYQYGSPKNKL

Sequence 1 GKMCGHYTAVVWKDTTSVGCGR--VLCDDKKDTMIMCSYWPPGNYENQKP
           -K--GHYT--VW--T---GCG------D--------C-Y-P-GN--N---
Sequence 2 NKV-GHYTQMVWAKTKEIGCGSEDYIEDGWHRHYLVCNYGPAGNVGNEPI

Sequence 1 Y---
           Y---
Sequence 2 YERK



Alignment 14
Sequence 1:
Sequence 2: Allergen Pol f 5, Sequence: P35780
Sequence identity: 30.72 (47/153)
Sequence 1 -------------------------STQLPSDEPLNGLNDKAIQDILNEH
           ------------------------------------G--------I-NEH
Sequence 2 VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEH

Sequence 1 NMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK--LK
           N-FR-K----------------------L-WN--LA---Q--A-----L-
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILV

Sequence 1 KD-CKMVHSDSPYGENLMFGSGA--ISWKTTVDTWSDEKKSYHYGSNTCD
           -D-C---------G-N-----G------------W--E-K---Y------
Sequence 2 HDKCRNT-AKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITK

Sequence 1 Q--GKMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYEN
           Q--GK--GHYT---W--T---GCG---------------C-Y-P-GNY--
Sequence 2 QNFGKV-GHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLG

Sequence 1 QKPY---
           Q-PY---
Sequence 2 QLPYTKK



Alignment 15
Sequence 1:
Sequence 2: Allergen Dol a 5, Sequence: Q05108
Sequence identity: 33.99 (52/153)
Sequence 1 ----------------------STQLPSDEPLNGLNDKAIQDILNEHNMF
           ---------------------------------G--------I---HN-F
Sequence 2 NNYCKICPKGTHTLCKYGTSMKPNCGGKIVKSYGVTNDEKNEIVKRHNEF

Sequence 1 RAKEHV-----------PP------LTWNTTLAKFSQDYA-ESKLKKD-C
           R-K--------------PP------L-WN--LAK--Q--A-------D-C
Sequence 2 RQKVAQGLETRGNPGPQPPAKNMNLLVWNDELAKIAQTWANQCNFGHDQC

Sequence 1 KMVHSDSPYGENLMFGSGA-ISWKTT---VDTWSDEKKSYHYGSNTCDQG
           -------P-G-N----S----S--T-------W-DE-K-Y----------
Sequence 2 RNT-AKYPVGQNVAIASTTGNSYQTMSYLIKMWEDEVKDYNPHKDLMHNN

Sequence 1 -KMCGHYTAVVWKDTTSVGCGRV-LCDDKKDT-MIMCSYWPPGNYENQKP
           ----GHYT--VW--T---GCG-V-----K--T----C-Y-P-GNY-NQ--
Sequence 2 FSKVGHYTQMVWGKTKEIGCGSVKYIENKWHTHYLVCNYGPAGNYMNQPV

Sequence 1 Y---
           Y---
Sequence 2 YERK



Alignment 16
Sequence 1:
Sequence 2: Allergen Pol e 5.0101, Sequence: AAT95009
Sequence identity: 29.41 (45/153)
Sequence 1 ----------------------------------------------STQL
           --------------------------------------------------
Sequence 2 MEIGGLVYLVIVVAIIHSSQGVDYCKIRCPSGIHTVCQYGESTKPSKNCA

Sequence 1 PSDEPLNGLNDKAIQDILNEHNMFRAK-----------------EHVPPL
           -------G--------I--EHN-FR-K----------------------L
Sequence 2 GKVIKSVGPTEEEKKLIVSEHNRFRQKVAQGLETRGNPGPQPAASDMNDL

Sequence 1 TWNTTLAKFSQDYAESK--LKKD-CKMVHSDSPYGENLMFGSGAI--SWK
           -WN--LA---Q--A-----L--D-C-------P-G-N-----G-------
Sequence 2 VWNDELAHIAQVWASQCQFLVHDKCRNT-AKYPVGQNIAYAGGSKLPDVV

Sequence 1 TTVDTWSDEKKSYHYGSNTCDQG-KMCGHYTAVVWKDTTSVGCG--RVLC
           -----W--E-K---Y------Q-----GHYT--VW--T---GCG------
Sequence 2 SLIKLWENEVKDFNYNTGITKQNFAKIGHYTQMVWGKTKEIGCGSLKYME

Sequence 1 DDKKDTMIMCSYWPPGNYENQKPY---
           ---------C-Y-P-GNY--Q-P----
Sequence 2 NKMQNHYLICNYGPAGNYLGQLPNTKK



Alignment 17
Sequence 1:
Sequence 2: Allergen Vesp c 5, Sequence: P35781
Sequence identity: 34.64 (53/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-------IL--HN-
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKPNCGKNVVKASGLTKQENLEILKQHNE

Sequence 1 FRAKEHV-----------PP------LTWNTTLAKFSQDYAE--SKLKKD
           FR-K--------------PP------L-WN--LA---Q--A---------
Sequence 2 FRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWANQCNYGHDN

Sequence 1 CKMVHSDSPYGENLMFGS------GAISWKTTVDTWSDEKKSYHYGSNTC
           C------S--G-N---GS------G--S----V--W-DE-K-Y-YGS---
Sequence 2 CRNSAKYS-VGQNIAEGSTTADNFGSVS--NMVKMWEDEVKDYQYGSPKN

Sequence 1 DQGKMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQ
           ---K--GHYT--VW--T---GCG---------------C-Y-P-GN--N-
Sequence 2 KLNKV-GHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNVGNE

Sequence 1 KPY---
           --Y---
Sequence 2 PIYERK



Alignment 18
Sequence 1:
Sequence 2: Allergen Vesp v 5.0101, Sequence: P0DMB9
Sequence identity: 33.99 (52/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------S-----GL-------IL--HN-
Sequence 2 NNYCKIKCRSGIHTLCKYGTSTKPNCGRSVVKASGLTKAEKLEILKQHNE

Sequence 1 FRAKEHV-----------PP------LTWNTTLAKFSQDYAESKLKKDCK
           FR-K--------------PP------L-WN--LA---Q--A-------CK
Sequence 2 FRQKVARGLETRGNPGPQPPAKSMNTLVWNDELAQIAQVWA-----SQCK

Sequence 1 MVHSDSPYGENLMFGSGAISWKTT----------VDTWSDEKKSYHYGSN
           --H-----------G-------TT----------V--WSDE-K-Y-YGS-
Sequence 2 YGHDNCRNTAKYLVGQNIAEQSTTAASFEPVSNMVKMWSDEVKDYQYGSS

Sequence 1 TCDQGKMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYE
           --------GHYT--VW--T---GCG---------------C-Y-P-GN--
Sequence 2 KNKLNDV-GHYTQMVWAKTKEIGCGNIKYIENGWHHHYLVCNYGPAGNIG

Sequence 1 NQKPY---
           N---Y---
Sequence 2 NEPIYEKK



Alignment 19
Sequence 1:
Sequence 2: Allergen Pol d 5, Sequence: P81656
Sequence identity: 25.49 (39/153)
Sequence 1 ------------------------------------------STQLPSDE
           --------------------------------------------------
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKLIKSVGPTEEEKKLIVEEH

Sequence 1 PLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAES--KLK
           ---------------------A------L-WN--LAK--Q--A-----L-
Sequence 2 NRFRQKVAKGLETRGNPGPQPAASNMNNLVWNDELAKIAQVWASQCQILV

Sequence 1 KD-CKMVHSDSPYGENLMFGSGAISWKTT---VDTWSDEKKSYHYGSNTC
           -D-C---------G-N-------------------W--E-K---Y-----
Sequence 2 HDKCRNTEKYQ-VGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT

Sequence 1 DQ--GKMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYE
           ----GK--GHYT--VW--T--VGCG---------------C-Y-P-GNY-
Sequence 2 NKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMQIHYLICNYGPAGNYL

Sequence 1 NQKPY---
           -Q--Y---
Sequence 2 GQPIYTKK



Alignment 20
Sequence 1:
Sequence 2: Allergen Ves g 5, Sequence: P35784
Sequence identity: 35.29 (54/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-----QDIL-EHN-
Sequence 2 NNYCKIKCLKGGVHTACKYESLKPNCANKKVVAYGLTKQEKQDILKEHND

Sequence 1 FRAK-----------EHVPP------LTWNTTLAKFSQDYA-ESKLKKD-
           FR-K--------------PP------L-W---LA---Q--A-------D-
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDT

Sequence 1 CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQ
           C--V----P-G-N----GS-A------V-----W-DE-K-Y---------
Sequence 2 CRDV-AKYPVGQNVALTGSTAAKYDNPVKLVKMWEDEVKDYNPKKKFSEN

Sequence 1 GKM-CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQK
           -----GHYT--VW--T--VGCG------D--------C-Y-P-GN--N--
Sequence 2 NFLKIGHYTQMVWANTKEVGCGSIKYIQDKWHKHYLVCNYGPSGNFGNEE

Sequence 1 PY---
           -Y---
Sequence 2 LYQTK



Alignment 21
Sequence 1:
Sequence 2: Allergen Pol g 5, Sequence: P83377
Sequence identity: 25.49 (39/153)
Sequence 1 ------------------------------------------STQLPSDE
           --------------------------------------------------
Sequence 2 NDYCKIKCSSGVHTVCQYGESTKPSKNCAGKVIKSVGPTEEEKKLIVEEH

Sequence 1 PLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAES--KLK
           ---------------------A------L-WN---AK--Q--A-----L-
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASNMNNLVWNDEQAKIAQVWASQCQILV

Sequence 1 KD-CKMVHSDSPYGENLMFGSGAISWKTT---VDTWSDEKKSYHYGSNTC
           -D-C---------G-N-------------------W--E-K---Y-----
Sequence 2 HDKCRNTEKYQ-VGQNIAYAGSSNHFPSVTKLIQLWENEVKDFNYNTGIT

Sequence 1 DQ--GKMCGHYTAVVWKDTTSVGCG--RVLCDDKKDTMIMCSYWPPGNYE
           ----GK--GHYT--VW--T--VGCG---------K-----C-Y-P-GNY-
Sequence 2 NKNFGKV-GHYTQMVWGNTKEVGCGSLKYVEKNMKIHYLICNYGPAGNYL

Sequence 1 NQKPY---
           -Q--Y---
Sequence 2 GQPIYTKK



Alignment 22
Sequence 1:
Sequence 2: Allergen Ves p 5, Sequence: P35785
Sequence identity: 34.64 (53/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-----QDIL-EHN-
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKIVVSYGLTKEEKQDILKEHND

Sequence 1 FRAK-----------EHVPP------LTWNTTLAKFSQDYA-ESKLKKD-
           FR-K--------------PP------L-WN--LA---Q--A-------D-
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDT

Sequence 1 CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQ
           C--V----P-G-N----GS-A------V-----W-DE-K-Y---------
Sequence 2 CRDV-AKYPVGQNVALTGSTADKYDNPVKLVKMWEDEVKDYNPKKKFSEN

Sequence 1 G-KMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQK
           -----GHYT--VW--T---GCG---------------C-Y-P-GN--N--
Sequence 2 NFNKIGHYTQMVWANTKEIGCGSIKYIQNEWHKHYLVCNYGPSGNFGNEE

Sequence 1 PY---
           -Y---
Sequence 2 LYQTK



Alignment 23
Sequence 1:
Sequence 2: Allergen Poly p 5.0101, Sequence: C0HJV9
Sequence identity: 30.72 (47/153)
Sequence 1 -------------------------STQLPSDEPLNGLNDKAIQDILNEH
           -------------------------S----------G--------I--EH
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEH

Sequence 1 NMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK---L
           N-FR-K----------------------L-WN--LA---Q--A-------
Sequence 2 NRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFV

Sequence 1 KKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-T
           ---C---------G-N-------------V-----W--E-K---Y----T
Sequence 2 HDKCRNT-AQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGIT

Sequence 1 CDQGKMCGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYEN
           -------GHYT-VVW--T--VGCG------K--K-----C-Y-P-GNY--
Sequence 2 KENFSKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYMG

Sequence 1 QKPY---
           Q--Y---
Sequence 2 QPIYTKK



Alignment 24
Sequence 1:
Sequence 2: Allergen Poly s 5.0101, Sequence: Q7Z156
Sequence identity: 30.07 (46/153)
Sequence 1 --------------------------STQLPSDEPLNGLNDKAIQDILNE
           -------------------------------------G--------I--E
Sequence 2 NKYCNIKCSKVAHTVCQYGESTKPSSKNCNKVSITSVGVTEEEKKLIVDE

Sequence 1 HNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK---
           HN-FR-K----------------------L-WN--LA---Q--A------
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWANQCQFF

Sequence 1 LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-
           ----C---------G-N-------------V-----W--E-K---Y----
Sequence 2 VHDKCRNT-AQYQVGQNIAYSASTAAYPGIVSLIVLWENEVKDFNYSQGI

Sequence 1 TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYE
           T-------GHYT-VVW--T--VGCG------K--K-----C-Y-P-GNY-
Sequence 2 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNYM

Sequence 1 NQKPY---
           -Q--Y---
Sequence 2 GQPIYTKK



Alignment 25
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: AAA28302
Sequence identity: 30.07 (46/153)
Sequence 1 ---------------------------------STQLPSDEPLNGLNDKA
           --------------------------------------------G-----
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDE

Sequence 1 IQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDY
           ---I-N-HN-FR-K--------------PP------L-WN--LAK--Q--
Sequence 2 KNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTW

Sequence 1 A-ESKLKKD-CKMVHSDSPYGENLMF----GSGAISWKTTVDTWSDEKKS
           A-------D-C---------G-N-------G------------W--E-K-
Sequence 2 ANQCSFGHDQCRNTEKYQ-VGQNVAIASTTGNSYATMSKLIEMWENEVKD

Sequence 1 YHYGSNTCDQGKM--CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCS
           ------T---------GHYT--VW--T---GCG-V-------------C-
Sequence 2 FNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLVCN

Sequence 1 YWPPGNYENQKPY
           Y-P-GNY--Q--Y
Sequence 2 YGPAGNYMDQPIY



Alignment 26
Sequence 1:
Sequence 2: Allergen Dol m 5.02, Sequence: P10737
Sequence identity: 30.07 (46/153)
Sequence 1 ---------------------------------STQLPSDEPLNGLNDKA
           --------------------------------------------G-----
Sequence 2 PIINLSFGEANNYCKIKCSRGIHTLCKFGTSMKPNCGSKLVKVHGVSNDE

Sequence 1 IQDILNEHNMFRAKEHV-----------PP------LTWNTTLAKFSQDY
           ---I-N-HN-FR-K--------------PP------L-WN--LAK--Q--
Sequence 2 KNEIVNRHNQFRQKVAKGLETRGNPGPQPPAKNMNVLVWNDELAKIAQTW

Sequence 1 A-ESKLKKD-CKMVHSDSPYGENLMF----GSGAISWKTTVDTWSDEKKS
           A-------D-C---------G-N-------G------------W--E-K-
Sequence 2 ANQCSFGHDQCRNTEKYQ-VGQNVAIASTTGNSYATMSKLIEMWENEVKD

Sequence 1 YHYGSNTCDQGKM--CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCS
           ------T---------GHYT--VW--T---GCG-V-------------C-
Sequence 2 FNPKKGTMGDNNFSKVGHYTQMVWGKTKEIGCGSVKYIENNWHTHYLVCN

Sequence 1 YWPPGNYENQKPY---
           Y-P-GNY--Q--Y---
Sequence 2 YGPAGNYMDQPIYERK



Alignment 27
Sequence 1:
Sequence 2: Allergen Ves f 5, Sequence: P35783
Sequence identity: 34.64 (53/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-----QDIL-EHN-
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHND

Sequence 1 FRAK-----------EHVPP------LTWNTTLAKFSQDYA-ESKLKKD-
           FR-K--------------PP------L-WN--LA---Q--A-------D-
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDT

Sequence 1 CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQ
           C---------G-N----GS-A------V-----W-DE-K-Y---------
Sequence 2 CRDI-AKYQVGQNVALTGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGN

Sequence 1 GKM-CGHYTAVVWKDTTSVGCGRVLCDDKK--DTMIMCSYWPPGNYENQK
           -----GHYT--VW--T--VGCG-------K-------C-Y-P-GN--N--
Sequence 2 NFLKTGHYTQMVWANTKEVGCGSIKFIQEKWHKHYLVCNYGPSGNFQNEE

Sequence 1 PY---
           -Y---
Sequence 2 LYQTK



Alignment 28
Sequence 1:
Sequence 2: Allergen Dol m 5.0101, Sequence: P10736
Sequence identity: 31.37 (48/153)
Sequence 1 ----------------------------------------------STQL
           --------------------------------------------------
Sequence 2 MEIGGLVYLILIITIINLSFGETNNYCKIKCRKGIHTLCKFGTSMKPNCG

Sequence 1 PSDEPLNGLNDKAIQDILNEHNMFR---AKE--------HVPP------L
           -------GL-------IL--HN-FR---AK-----------PP------L
Sequence 2 RNVVKAYGLTNDEKNEILKRHNDFRQNVAKGLETRGKPGPQPPAKNMNVL

Sequence 1 TWNTTLAKFSQDYAESK--LKKDCKMVHSDSPYGENLMFGSGAISW----
           -WN--LAK--Q--A--------DC---------G-N----S---------
Sequence 2 VWNDELAKIAQTWANQCDFNHDDCRNT-AKYQVGQNIAISSTTATQFDRP

Sequence 1 KTTVDTWSDEKKSYHYGSNTCDQG-KMCGHYTAVVWKDTTSVGCGRV--L
           ------W-DE-----Y------------GHYT--VW--T---GCG-----
Sequence 2 SKLIKQWEDEVTEFNYKVGLQNSNFRKVGHYTQMVWGKTKEIGCGSIKYI

Sequence 1 CDDKKDTMIMCSYWPPGNYENQKPY---
           -D--------C-Y-P-GN--NQ--Y---
Sequence 2 EDNWYTHYLVCNYGPGGNDFNQPIYERK



Alignment 29
Sequence 1:
Sequence 2: Allergen Ves m 5, Sequence: P35760
Sequence identity: 33.99 (52/153)
Sequence 1 -----------------------STQLPSDEPLNGLNDKAIQDILNEHNM
           ----------------------------------GL-----QDIL-EHN-
Sequence 2 NNYCKIKCLKGGVHTACKYGSLKPNCGNKKVVSYGLTKQEKQDILKEHND

Sequence 1 FRAK-----------EHVPP------LTWNTTLAKFSQDYA-ESKLKKD-
           FR-K--------------PP------L-W---LA---Q--A-------D-
Sequence 2 FRQKIARGLETRGNPGPQPPAKNMKNLVWSDELAYIAQVWANQCQYGHDT

Sequence 1 CKMVHSDSPYGENL-MFGSGAISWKTTVDT---WSDEKKSYHYGSNTCDQ
           C--V------G-N----GS-A------V-----W-DE-K-Y---------
Sequence 2 CRDV-AKYQVGQNVALTGSTAAVYNDPVKLVKMWEDEVKDYNPKKKFSEN

Sequence 1 GKM-CGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYENQK
           -----GHYT--VW--T--VGCG---------------C-Y-P-GN--N--
Sequence 2 NFLKIGHYTQMVWANTKEVGCGSIKYIQENWHKHYLVCNYGPSGNFQNEE

Sequence 1 PY---
           -Y---
Sequence 2 LYQTK



Alignment 30
Sequence 1:
Sequence 2: Allergen Ves vi 5, Sequence: P35787
Sequence identity: 34.64 (53/153)
Sequence 1 -------------------------STQLPSDEPLNGLNDKAIQDILNEH
           ------------------------------------GL-----Q-IL--H
Sequence 2 KVNYCKIKCLKGGVHTACKYGTSTKPNCGKMVVKAYGLTEAEKQEILKVH

Sequence 1 NMFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ESKLKK
           N-FR-K--------------PP------L-WN--LA---Q--A-------
Sequence 2 NDFRQKVAKGLETRGNPGPQPPAKNMNNLVWNDELANIAQVWASQCNYGH

Sequence 1 D-CKMVHSDSPYGENLMFGS--GAI--SWKTTVDTWSDEKKSYHYGSN-T
           D-CK------P-G-N----S---A---S----V--W--E-K---------
Sequence 2 DTCKDTEK-YPVGQNIAKRSTTAALFDSPGKLVKMWENEVKDFNPNIEWS

Sequence 1 CDQGKMCGHYTAVVWKDTTSVGCGRV--LCDDKKDTMIMCSYWPPGNYEN
           ----K--GHYT--VW--T---GCG-V----D--------C-Y-P-GN--N
Sequence 2 KNNLKKTGHYTQMVWAKTKEIGCGSVKYVKDEWYTHYLVCNYGPSGNFRN

Sequence 1 QKPY---
           -K-Y---
Sequence 2 EKLYEKK



Alignment 31
Sequence 1:
Sequence 2: Allergen Ves s 5, Sequence: P35786
Sequence identity: 33.99 (52/153)
Sequence 1 ------------------------STQLPSDEPLNGLNDKAIQDILNEHN
           -----------------------------------G------Q-IL--HN
Sequence 2 VDYCKIKCLKGGVHTACKYGTSTKPNCGNMVVKSYGVTQAEKQEILKIHN

Sequence 1 MFRAKEHV-----------PP------LTWNTTLAKFSQDYA-ESKLKKD
           -FR-K--------------PP------L-WN--LA---Q--A---K---D
Sequence 2 DFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGHD

Sequence 1 -CKMVHSDSPYGENLMFGSG-AISWKTT---VDTWSDEKKSYHYG-SNTC
           -CK--------G-N----S--A---------V--W--E-K------S---
Sequence 2 TCKDT-TKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKDFNPTISWEQ

Sequence 1 DQGKMCGHYTAVVWKDTTSVGCGRV-LCDDKKDT-MIMCSYWPPGNYENQ
           ---K--GHYT--VW--T---GCG-----D----T----C-Y-P-GN--NQ
Sequence 2 NEFKKIGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNYGPAGNFGNQ

Sequence 1 KPY---
           --Y---
Sequence 2 EVYERK



Alignment 32
Sequence 1:
Sequence 2: Allergen Ves v 5, Sequence: Q05110
Sequence identity: 34.64 (53/153)
Sequence 1 ----------------------------------------------STQL
           --------------------------------------------------
Sequence 2 MEISGLVYLIIIVTIIDLPYGKANNYCKIKCLKGGVHTACKYGSLKPNCG

Sequence 1 PSDEPLNGLNDKAIQDILNEHNMFRAK-----------EHVPP------L
           -------GL-----QDIL-EHN-FR-K--------------PP------L
Sequence 2 NKVVVSYGLTKQEKQDILKEHNDFRQKIARGLETRGNPGPQPPAKNMKNL

Sequence 1 TWNTTLAKFSQDYA-ESKLKKD-CKMVHSDSPYGENL-MFGSGAISWKTT
           -WN--LA---Q--A-------D-C--V------G-N----GS-A------
Sequence 2 VWNDELAYVAQVWANQCQYGHDTCRDV-AKYQVGQNVALTGSTAAKYDDP

Sequence 1 VDT---WSDEKKSYHYGSNTCDQGKM-CGHYTAVVWKDTTSVGCGRV--L
           V-----W-DE-K-Y--------------GHYT--VW--T--VGCG-----
Sequence 2 VKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKYI

Sequence 1 CDDKKDTMIMCSYWPPGNYENQKPY---
           ----------C-Y-P-GN--N---Y---
Sequence 2 QEKWHKHYLVCNYGPSGNFMNEELYQTK



Alignment 33
Sequence 1:
Sequence 2: Allergen Poly p 5.0102, Sequence: P86686
Sequence identity: 28.76 (44/153)
Sequence 1 --------------------------STQLPSDEPLNGLNDKAIQDILNE
           -------------------------------------G--------I--E
Sequence 2 NKYCNIKCSKVAHTVCQTGESTKPSSKNCAKVSITSVGVTEEEKKLIVDE

Sequence 1 HNMFRAK-----------------EHVPPLTWNTTLAKFSQDYAESK---
           HN-FR-K----------------------L-WN--LA---Q--A------
Sequence 2 HNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFF

Sequence 1 LKKDCKMVHSDSPYGENLMFGSGAISWKTTVDT---WSDEKKSYHYGSN-
           ----C---------G-N-------------V-----W--E-K---Y----
Sequence 2 VHDKCRNT-AQYQVGQNIAYSASTAAYPGVVKLIVLWENEVKDFNYNTGI

Sequence 1 TCDQGKMCGHYTAVVWKDTTSVGCGRVLCDDK--KDTMIMCSYWPPGNYE
           T-------GHYT-VVW--T--VGCG------K--K-----C-Y-P-GN--
Sequence 2 TKENFAKVGHYTQVVWAKTKEVGCGSIKYIEKGMKSHYLVCNYGPAGNVL

Sequence 1 NQKPY---
           ----Y---
Sequence 2 GAQIYEIK



Alignment 34
Sequence 1:
Sequence 2: Allergen Sol g 3.0101, Sequence: AAY32926
Sequence identity: 12.42 (19/153)
Sequence 1 STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDY
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 AESKLKKDCKMVHSDSPYGENLMFGSGAISWKTTVDTWSDEKKSYHYGSN
           --------------------------------------------------
Sequence 2 ----------------------------------------DNRWISSFPS

Sequence 1 TCDQGKMCGHYTAVVWKDTTSVGCGRVLC---DDKKDTMIMCSYWPPGNY
           --------GHYT--VW--T---GCGR------D--------C-Y-P-GN-
Sequence 2 DPNILMKIGHYTQIVWAKTVKIGCGRIMFKEPDNWTKHYLVCNYGPAGNV

Sequence 1 ENQKPY----
           ---K-Y----
Sequence 2 LGAKIYEIKK



Alignment 35
Sequence 1:
Sequence 2: Allergen Sol r 3, Sequence: P35779
Sequence identity: 31.37 (48/153)
Sequence 1 -------------------------STQLPSDEPLNGLNDKAIQDILNEH
           ------------------------------------G--D-----I-N-H
Sequence 2 TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKH

Sequence 1 NMFR-----AKE------------HVPPLTWNTTLAKFSQDYA-ESKLKK
           N--R------KE--------------P-LTW---LA---Q--A-------
Sequence 2 NELRQRVASGKEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEH

Sequence 1 D-CKMVHSDSPYGENLMFGSGAISWKTTVDT----WSDEKKSY--HYGSN
           D-C--V------G-N----S-----K-T-------W--E-K-------S-
Sequence 2 DACRNVERFA-VGQNIAATSSSGKNKSTLSDMILLWYNEVKDFDNRWISS

Sequence 1 TCDQGKM---CGHYTAVVWKDTTSVGCGRVLC--DDKKDTMIMCSYWPPG
           ----G------GHYT--VW--T---GCGR-----D--------C-Y-P-G
Sequence 2 FPSDGNILMHVGHYTQIVWAKTKKIGCGRIMFKEDNWNKHYLVCNYGPAG

Sequence 1 NYENQKPY----
           N------Y----
Sequence 2 NVLGAQIYEIKK



Alignment 36
Sequence 1:
Sequence 2: Allergen Sol i 3, Sequence: P35778
Sequence identity: 32.03 (49/153)
Sequence 1 -----------------------------------------------STQ
           --------------------------------------------------
Sequence 2 MELIVSILWLAITAENLANTLATNYCNLQSCKRNNAIHTMCQYTSPTPGP

Sequence 1 LPSDEPLNGLNDKAIQDILNEHNMFR-----AKE------------HVPP
           --------G--D-----I-N-HN--R------KE--------------P-
Sequence 2 MCLEYSNVGFTDAEKDAIVNKHNELRQRVASGKEMRGTNGPQPPAVKMPN

Sequence 1 LTWNTTLAKFSQDYA-ESKLKKD-CKMVHSDSPYGENLMFGSGAISWKTT
           LTW---LA---Q--A-------D-C--V------G-N----S-----K-T
Sequence 2 LTWDPELATIAQRWANQCTFEHDACRNVERFA-VGQNIAATSSSGKNKST

Sequence 1 ----VDTWSDEKKSYH---YGSNTCDQGKM--CGHYTAVVWKDTTSVGCG
           -------W--E-K--------S---D-------GHYT--VW--TT--GCG
Sequence 2 PNEMILLWYNEVKDFDNRWISSFPSDDNILMKVGHYTQIVWAKTTKIGCG

Sequence 1 RVLC---DDKKDTMIMCSYWPPGNYENQKPY----
           R------D--------C-Y-P-GN------Y----
Sequence 2 RIMFKEPDNWTKHYLVCNYGPAGNVLGAPIYEIKK



Alignment 37
Sequence 1:
Sequence 2: Allergen Pac c 3.0101, Sequence: C0ITL3
Sequence identity: 30.07 (46/153)
Sequence 1 ---------------------------------STQLPSDEPLNGLNDKA
           ------------------------------------------------KA
Sequence 2 TEGGAVHTMCQYTSPQPSPNCGTYSNAHITAADKETILKVHNDERQKVKA

Sequence 1 IQDILNEHNMFRAKEHVPPLTWNTTLAKFSQDYA-ESKLKKD-CKMVHSD
           -Q----------A----P-LTW---LA---Q------K---D-C--V---
Sequence 2 GQETRGNPGPQPAASNMPDLTWDNELAAIAQRWVNQCKIGHDGCRNVERY

Sequence 1 SPYGENL-MFGS---GAISWKTTVDTWSDEKKSYHYG--SNTCDQGKM--
           ---G-N--M-GS---G-------V--W--E---------S-----G----
Sequence 2 Q-VGQNIAMSGSTAKGPCNMNNLVQMWINEVNALNAADVSSMPSDGNYFM

Sequence 1 -CGHYTAVVWKDTTSVGCGRVLCDDKK--DTMIMCSYWPPGNYENQKPY-
           --GHYT--VW--TT-VGCG-----D-K-------C-Y-P-GN------Y-
Sequence 2 KIGHYTQLVWGKTTKVGCGIIQFLDGKFYKCYLACNYGPAGNMFGAPIYQ


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.