The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pla a 3

Sequence 110224778

Full FASTA alignment

Sequence name:
Query sequence:
MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
GVNLPYKISPTIDCSKVK

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pla a 3.0101CAL07989Go!118166.81.4e-43
2Pla or 3.0101ABY21307Go!118166.02.5e-43
3Pun g 1.0101A0A059STC4Go!120106.02.9e-25
4Pru av 3Q9M5X8Go!117104.48.7e-25
5Pyr c 3Q9M5X6Go!115103.12.0e-24
6Len c 3.0101A0AT29Go!118101.56.2e-24
7Mal d 3Q9M5X7Go!11599.72.2e-23
8Art an 3.0102ANC85018Go!11797.97.7e-23
9Art gm 3.0102ANC85023Go!11797.78.8e-23
10Lup an 3.0101XP_019446786Go!11697.31.2e-22
11Art gm 3.0101ANC85022Go!11797.11.3e-22
12Pun g 1.0201A0A059SSZ0Go!12096.91.6e-22
13Art ca 3.0101ANC85021Go!11796.71.8e-22
14Art an 3.0101ANC85017Go!11796.71.8e-22
15Fra a 3.0202Q4PLT6Go!11795.73.6e-22
16Cor a 8AAK28533Go!11595.54.1e-22
17Fra a 3.0101Q8VX12Go!11795.15.4e-22
18Fra a 3.0201Q4PLU0Go!11794.96.3e-22
19Art ca 3.0102QIN55516Go!11794.77.2e-22
20Pun g 1.0301A0A059ST23Go!12094.58.4e-22
21Rub i 3.0101Q0Z8V0Go!11794.11.1e-21
22Pis s 3.0101A0A161AT60Go!12093.91.3e-21
23Lyc e 3AAB42069Go!11493.41.7e-21
24Sola l 3.0101P93224Go!11493.41.7e-21
25Art v 3.0202ACE07187Go!11692.82.5e-21
26Art ar 3.0102ANC85020Go!11692.82.5e-21
27Art si 3.0102ANC85027Go!11692.82.5e-21
28Pru du 3.0101ACN11576Go!12392.92.6e-21
29Art la 3.0102ANC85025Go!11592.43.3e-21
30Art v 3.0301EU564847Go!11792.23.9e-21
31Fra a 3.0102Q4PLT9Go!11792.04.5e-21
32Pru p 3CAB96876Go!9191.45.4e-21
33Mor n 3.0101P85894Go!9191.45.4e-21
34Pru ar 3P81651Go!9191.26.2e-21
35Pru p 3P81402Go!9191.26.2e-21
36Pha v 3.0101ADC80502Go!11591.46.7e-21
37Hev b 12AAL25839Go!11691.46.8e-21
38Pha v 3.0201ADC80503Go!11891.27.8e-21
39Ara h 9.0101ABX56711Go!11690.01.8e-20
40Art v 3.0201EU564845Go!11489.03.6e-20
41Art ar 3.0101ANC85019Go!11689.03.6e-20
42Art la 3.0101ANC85024Go!11689.03.6e-20
43Api g 2ACV04796Go!11889.03.6e-20
44Can s 3.0101W0U0V5Go!9188.25.1e-20
45Pru d 3P82534Go!9188.25.1e-20
46Art si 3.0101ANC85026Go!11687.69.7e-20
47Zea m 14.0101P19656-1Go!12086.22.6e-19
48Zea m 14.0102P19656-2Go!12885.35.4e-19
49Hor v 1AAA32970Go!11784.01.2e-18
50Hor v 1CAA42832Go!13483.32.2e-18
51Ara h 9.0201ABX75045Go!9281.16.8e-18
52Ara h 17.0101A0A510A9S3Go!9380.97.9e-18
53Tri tu 14.0101CAH69206Go!11578.55.2e-17
54Hel a 3.0101P82007Go!11671.47.1e-15
55Tri a 14.010119846220Go!9070.88.6e-15
56Sin a 3.0101ABU95411Go!9269.42.3e-14
57Sola l 7.0101NP_001316123Go!11568.65.0e-14
58Par j 2O04403Go!13356.62.3e-10
59Par j 2P55958Go!13354.88.3e-10
60Par j 1Q40905Go!13852.83.4e-09
61Amb a 6O04004Go!11851.95.6e-09
62Par j 1O04404Go!17651.01.5e-08
63Par j 1P43217Go!13950.22.1e-08
64Par j 1.0103CAI94601Go!13949.43.7e-08
65Par j 1.0101CAA54587Go!13343.91.6e-06
66Art v 3.0101P0C088Go!3737.43.9e-05
67Cas s 810998016Go!3631.71.9e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 100.00 (118/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVNLPYKISPTIDCSKVK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 2
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 99.15 (117/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLT-LRSGGAV
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVNLPYKISPTIDCSKVK
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 3
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 61.02 (72/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHA-EAAITCGTVVTRLTPCLTFLRS-GG
           M--S---KLAC---A-----AP-A-EAA-TCG-V---L-PC----RS-GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 AVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           AV-PACC-G-K-L---A-TTPDRQA-C-CLK-ASTSISGI--G--ASL--
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 KCGVNLPYKISPTIDCSKVK
           KCGVN-PYKISP--DC--VK
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 4
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 55.93 (66/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S---KLA-----CMV---P-A-A--TCG-V---L-PC----R-GGAV
Sequence 2 MACSAMTKLALVVALCMVVSVPIAQA-LTCGQVSSNLAPCIAYVRGGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----NN-AKTT-DRQ-AC-CLK--S-S--G----NAA-L-GKC
Sequence 2 PPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKISP---C--VK
Sequence 2 GVNVPYKISPSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 57.63 (68/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S-V-KLA-----CM-----HA---ITC--V---L-PC----RSGGAV
Sequence 2 MASSAVIKLALVVALCMAVSVAHA---ITCSQVSANLAPCINYVRSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG-K--N--AKTTPDRQAAC-CLK----S-SG---GNA-SL-GKC
Sequence 2 PPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--VK
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 56.78 (67/118)
Sequence 1 MAFSRVAKLACLLLA-CMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA
           ----R--KLAC--L--CMV--AP-AE-AI-CG-V---L-PCLT-L--G--
Sequence 2 --MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPG

Sequence 1 VAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK
           --P-CC-GVK-L---A-TTPDRQAAC-CLK-A--SI------NAA-L-GK
Sequence 2 PSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGK

Sequence 1 CGVNLPYKISPTIDCSKVK-
           CGVN-PYKIS-T--C--VK-
Sequence 2 CGVNIPYKISTTTNCNTVKF



Alignment 7
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 55.08 (65/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S-V-KLA-----CM-----HA---ITCG-V---L-PC----RSGGAV
Sequence 2 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----N--A-TT-DRQ-AC-CLK----SISG----NAA-L-GKC
Sequence 2 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--VK
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 52.54 (62/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-T---AEAA-TC--V-----PC--FL--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQAAC-CLKT---S-------NAA-L--KC
Sequence 2 PVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V-----PCL-FL--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S-------NA--L--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 51.69 (61/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------KLAC--L-CMV--------AITCG-V---L--CL--LRSGGAV
Sequence 2 --MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCNG-K---N-AKTTPDR--AC-CLK-A-----G----NA-SL-GKC
Sequence 2 PAPCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C---K
Sequence 2 GVNIPYKISTSTNCASIK



Alignment 11
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V-----PC--FL--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S-------NAA-L--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 55.93 (66/118)
Sequence 1 MAFSR-VAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA
           MA--R----L---L--CMV--A---E-A-TCG-V---LTPC----R-G--
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYAR-GVV

Sequence 1 VAP--ACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLA
           -AP--ACC-GV--LNN-AKTTPDRQ-AC-CLK----SI-GI--G----L-
Sequence 2 AAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALP

Sequence 1 GKCGVNLPYKISPTIDCSKVK
           GKCGV--PYKISP--DCS-VK
Sequence 2 GKCGVSIPYKISPSTDCSRVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V-----PC--FL--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQAAC-CLKT---S-------NA--L--KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V-----PC--FL--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQAAC-CLKT---S-------NA--L--KC
Sequence 2 SADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 52.54 (62/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S---KL----L-C-V---P-A-A-ITCG-V-----PC-----SGGAV
Sequence 2 MAISTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACCNG---LN--AKTT-DRQ--C-CLK-AS--I-G-----AA-L-GKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--VK
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 47.46 (56/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------KL-C--L-CM---AP-A-A--TC------LTPC---L--GG--
Sequence 2 ---MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVL

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -P-CC-GV-A-N----TT-DRQ-AC-CLK-----I-G-----AA-L-GKC
Sequence 2 PPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKISP---C--VK
Sequence 2 GVNIPYKISPSTNCNNVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 54.24 (64/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S---KL----L-C-V---P-A-A-ITCG-V-----PCLT---SGGAV
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCLTYVKSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACC-G---LN--AKTT-DRQAAC-CLK-A---I-G-----AA-L-GKC
Sequence 2 PAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS-T--C--VK
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 52.54 (62/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S---KL----L-C-V---P-A-A-ITCG-V-----PC-----SGGAV
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASSISPCVNYVKSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACCNG---LN--AKTT-DRQA-C-CLK-AS--I-G-----AA-L-GKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS----C--VK
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 50.00 (59/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V----TPCL-FL--GG-V
Sequence 2 -MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKT-PDRQ-AC-CLKT---S-------NA--L--KC
Sequence 2 PADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC--VK
Sequence 2 GVNIPYKISLETDCNTVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 53.39 (63/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA-
           MA-S----LA---L-CM------AEA-ITCG-V---L--C----R--GA-
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 -VAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -V--ACCNG---LN--AKTTPDRQAAC-CLK----SISGI--G--A---G
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNLPYKISPTIDCSKVK
           KCGV--PYKI-P---C--VK
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 53.39 (63/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S-V-KLA---L-C-V---P-A-A-ITCG-V-----PC------GGAV
Sequence 2 MACSAVMKLALVALLCIVVAVPVAQA-ITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACCNGV--LN--AKTT-DRQ--C-CLK-A--SI-G-----AA-L-GKC
Sequence 2 PAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS----C--VK
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 52.54 (62/118)
Sequence 1 MAFSRVAKLACL-LLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA
           ----R--KLAC--L--CMV--AP-AEAA--CGTV-----PC-T-L-----
Sequence 2 --MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNN

Sequence 1 VAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLA
           --P---CC-GVK-L---A-TTPDRQAAC-CLK-A--SI------NAA-L-
Sequence 2 ASPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALP

Sequence 1 GKCGVNLPYKISPTIDCSKVK-
           GKCGV--PYKIS----C--V--
Sequence 2 GKCGVSIPYKISTSTNCNTVRF



Alignment 23
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K-AC----CMV--APHAE----CG-V---L-PCL--L---G--
Sequence 2 --MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-L---AKT--DR--AC-CLK-A--SI-GI--G-AA-L-G-C
Sequence 2 G-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKISP--DCS-V-
Sequence 2 GVNIPYKISPSTDCSTVQ



Alignment 24
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K-AC----CMV--APHAE----CG-V---L-PCL--L---G--
Sequence 2 --MEMFGKIACFVVFCMVVVAPHAES-LSCGEVTSGLAPCLPYLEGRGPL

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-L---AKT--DR--AC-CLK-A--SI-GI--G-AA-L-G-C
Sequence 2 G-GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKISP--DCS-V-
Sequence 2 GVNIPYKISPSTDCSTVQ



Alignment 25
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA--TC--V----TPCL--L--GG-V
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA--TC--V----TPCL--L--GG-V
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 50.85 (60/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA--TC--V----TPCL--L--GG-V
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEA-LTCSDVSNKITPCLNYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 51.69 (61/118)
Sequence 1 MAFS-RVAKLACL--LLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSG
           MA-S----KL-CL-----CM----P-A-AA--CG-VV--LTPC------G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GAVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSI--SGIQLGNAAS
           GA--P-CC-GV--L---A-TT-DRQ--C-CLK-A---I-------G-AA-
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LAGKCGVNLPYKISPTIDCSKVK
           L-GKCGVN-PYKISP--DC---K
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 29
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 47.46 (56/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEAA-TC--V-T---PCL--L--GG-V
Sequence 2 ---MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN---KTTPDRQ-AC-CLK----S--------A--L--KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           G-NLPYK-S---DC-KVK
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 46.61 (55/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AE-A-TC--V-T---PCL--L--GG-V
Sequence 2 -MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN---KTTPDRQ-AC-CLK----S--------A--L--KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           G-NLPYK-S---DC-KVK
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 51.69 (61/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA-S---KL----L-C-V---P-A-A-ITCG-V-----PC-T---SGGAV
Sequence 2 MASSTAMKLSLVALLCIVVALPIAQA-ITCGQVASNISPCVTYVKSGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-G---LN--AKTT-DRQA-C-CLK-A---I-G-----AA-L-GKC
Sequence 2 PAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS-T--C--VK
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 45.76 (54/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PC----R-GGAV
Sequence 2 ---------------------------ITCGQVSSSLAPCIPYVRGGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----NN-A-TTPDRQAAC-CLK--S-S--G----NAA-L-GKC
Sequence 2 PPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS----C--VK
Sequence 2 GVSIPYKISASTNCATVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 48.31 (57/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PC---LR-GG-V
Sequence 2 ---------------------------ITCGQVSSSLAPCINYLRAGGVV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCNGV--LNN-AKTT-DRQAAC-CLK-A--SI-G--L--AA-L-GKC
Sequence 2 PANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKISP--DC--VK
Sequence 2 GVSVPYKISPSTDCKSVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 46.61 (55/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PC----R-GGAV
Sequence 2 ---------------------------ITCGQVSSSLAPCIGYVRGGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----NN-A-TTPDR--AC-CLK--S-SISG----NAA-L-GKC
Sequence 2 PPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--VK
Sequence 2 GVNIPYKISASTNCATVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 45.76 (54/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PC----R-GGAV
Sequence 2 ---------------------------ITCGQVSSALAPCIPYVRGGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----NN-A-TTPDRQAAC-CLK--S-S--G----NAA-L-GKC
Sequence 2 PPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKIS----C--VK
Sequence 2 GVHIPYKISASTNCATVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 44.07 (52/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K-AC----CMV----H-----TCG-V---L-PC-TFL--GG-V
Sequence 2 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCNGV----N-A--T-DR---C-CLKTA-----G----NA--L-GKC
Sequence 2 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C----
Sequence 2 GVNIPYKISTSTNCASIN



Alignment 37
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 48.31 (57/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K----L--CM---AP----AITCG-V---L-PCL--L---G--
Sequence 2 ---MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPT

Sequence 1 APA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGK
           -PA-CCNGV---NN-AKTT-DR--AC-CLK-A--S--G------A-L-GK
Sequence 2 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK

Sequence 1 CGVNLPYKISPTIDCSKVK
           CGVN-PYKIS----C--VK
Sequence 2 CGVNIPYKISLSTNCATVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 49.15 (58/118)
Sequence 1 MAFSRVAKLACLL-LACMVA-TAPHAEAAITCGTVVTRLTPCLTFLRSGG
           ---------AC-----C-V--TAP-A-AAI-CG-V---L--C--FL--GG
Sequence 2 ---MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGG

Sequence 1 AVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -V---CC-GV--LN--AKTTPDRQA-C-CLK-A---I-G----NA--L-G
Sequence 2 PVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPG

Sequence 1 KCGVNLPYKISPTIDCSKVK-
           KCGV--PYKIS----C---K-
Sequence 2 KCGVSIPYKISTSTNCATIKF



Alignment 39
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 46.61 (55/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K-A---L-CM---------AI-CG-V---L-PC--FL--GGA-
Sequence 2 ---MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACC-GV--L-----TT-DRQAAC-CLK-A--S--G---GNAA-L-G-C
Sequence 2 PPACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRC

Sequence 1 GVNLPYKISPTIDCSKVK-
           GV--PYKIS----C---K-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 40
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 48.31 (57/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA---C--V------CL--L--GG-V
Sequence 2 ---MKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 48.31 (57/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA---C--V------CL--L--GG-V
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 48.31 (57/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA---C--V------CL--L--GG-V
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSYAEA-LKCSDVSNKISACLSYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLKT---S--------AASL--KC
Sequence 2 PADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS---DC-KVK
Sequence 2 GVNIPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 47.46 (56/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           M--S-VA------L---V---P------TCG-V---L--CL--L--GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACC-GVK-LN--AKT--DR--AC-CLKT---S--GI--G-A--L-GKC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           G---PY-ISP--DCS-V-
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 44
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 44.92 (53/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PCL--L--GGAV
Sequence 2 ---------------------------ITCGQVASSLAPCLSYLKVGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCN--K-L---AKT--DRQAAC-CLK-A--SI-G-----A--L-GKC
Sequence 2 PDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYKISP--DCS-VK
Sequence 2 GVSIPYKISPSTDCSSVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 44.92 (53/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITCG-V---L-PC------GGAV
Sequence 2 ---------------------------ITCGQVSSNLAPCINYVKGGGAV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           -PACCNG----NN-A-TT-DR-AAC-CLK--S-SI-G----NAA-L-GKC
Sequence 2 PPACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--VK
Sequence 2 GVNVPYKISASTNCATVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 44.92 (53/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -------K--C----CMV-----AEA--TC--V-----PCL--L--GG-V
Sequence 2 -MAMKMMKVFCVMVVCMVVSSSYAEA-LTCSDVSNKISPCLNYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--AKTTPDRQ-AC-CLK-------------A--L--KC
Sequence 2 PANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GV--PYK-S---DC-KVK
Sequence 2 GVTIPYKLSMETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 45.76 (54/118)
Sequence 1 -MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA
           -------A--A----A-----A---EAAI-CG-V-----PC----R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VAPA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           ---A-CC-GV--LNN-A-TT-DR-AAC-CLK-A----SG---GNAAS---
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNLPYKISPTIDCSKVK
           KCGV--PY-IS---DCS-V-
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 48
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 44.92 (53/118)
Sequence 1 -MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGA
           -------A--A----A-----A---EAAI-CG-V-----PC----R--G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VAPA-CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           ---A-CC-GV--LNN-A-TT-DR-AAC-CLK-A----SG---GNAAS---
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNLPYKISPTIDCSKVK--------
           KCGV--PY-IS---DCS-----------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 49
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 44.07 (52/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA---V---A--L---M---AP-A--A--CG-V-----PCLT----G---
Sequence 2 MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCNGV--L-N-A----DRQ--C-CLK-----I----L-NAAS---KC
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           -VN-PY-ISP-IDCS---
Sequence 2 NVNVPYTISPDIDCSRIY



Alignment 50
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 44.07 (52/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           MA---V---A--L---M---AP-A--A--CG-V-----PCLT----G---
Sequence 2 MARAQVLLMAAALVL-MLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CCNGV--L-N-A----DRQ--C-CLK-----I----L-NAAS---KC
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 GVNLPYKISPTIDCSKVK-----------------
           -VN-PY-ISP-IDCS--------------------
Sequence 2 NVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 51
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 40.68 (48/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           -----------------------------CG-V---L-PC-TFL--GG--
Sequence 2 ---------------------------LSCGQVNSALAPCITFLTKGGVP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GV--L---AKTT-DRQAAC-CLK-A--S--G---GNAA-L-G-C
Sequence 2 SGPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRC

Sequence 1 GVNLPYKISPTIDCSKVK-
           GV--PYKIS----C---K-
Sequence 2 GVSIPYKISTSTNCATIKF



Alignment 52
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 42.37 (50/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           --------------------------AI-C--V-----PC---L-SGG-V
Sequence 2 --------------------------AIQCSFVTKSIAPCFGYLKSGGTV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSI-SGIQLGNAASLAGK
           ---CC-G----N--AKTT-DRQA-C-CLK-A--S--S-I---NAASL-GK
Sequence 2 SGPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGK

Sequence 1 CGVNLPYKISPTIDCSKVK
           CGV--PYKIS--I-CS--K
Sequence 2 CGVSIPYKISTSINCSSIK



Alignment 53
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 44.07 (52/118)
Sequence 1 MAFSRVAK--LACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGG
           MA-S-VA---L-----A---A-----EAA--CG-V---L-PC----R--G
Sequence 2 MARSAVAQVVLVAVVAAMLLAVT---EAAVSCGQVSSALSPCISYARGNG

Sequence 1 AV-APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLA
           A----ACC-GV--L---A--T-D-QAAC-C-K-A-----G---G-AA---
Sequence 2 ASPSAACCSGVRSLASSARSTADKQAACKCIKSAA---AGLNAGKAAGIP

Sequence 1 GKCGVNLPYKISPTIDCSKVK
           -KCGV--PY-IS---DCSK--
Sequence 2 TKCGVSVPYAISSSVDCSKIR



Alignment 54
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 39.83 (47/118)
Sequence 1 --MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGG
           -------VA-LA----A-------H---AITC--V---LTPCL--LRSGG
Sequence 2 MKGTSMGVAILAMIVMAQLMV---HPSVAITCNDVTGNLTPCLPYLRSGG

Sequence 1 AVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           ---PACC-G-K-L-----T--DR--AC-C-KTA-----------A-SL-G
Sequence 2 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG

Sequence 1 KCGVNLPYKISPTIDCSKVK
           KCG------I-P---C----
Sequence 2 KCGISTSIPINPNVNCNTIP



Alignment 55
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 36.44 (43/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------I-CG-V-----PCL-----G---
Sequence 2 ---------------------------IDCGHVDSLVRPCLSYVQGGPGP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-L-N-A----DRQ-AC-CLK-----I------NA-S---KC
Sequence 2 SGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVNLPY-IS--IDCS-V-
Sequence 2 GVNLPYTISLNIDCSRV-



Alignment 56
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 35.59 (42/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           --------------------------A--CGTV---L--C---L------
Sequence 2 --------------------------ALSCGTVNSNLAACIGYLTQNAPL

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GV--LNN-A-TTPDRQ-AC-CL--A--S--------AA-L---C
Sequence 2 PKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKAC

Sequence 1 GVNLPYKISPTIDCSKVK
           GVN-PYKIS----C--V-
Sequence 2 GVNIPYKISKSTNCNSVR



Alignment 57
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 37.29 (44/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ------A-L----LA-----A--A--AITCG-V---L-PC--FL--GG--
Sequence 2 --MKAIAILVLVVLA-VFQLAMVARGAITCGQVDANLAPCVPFLTQGGEP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACC-GV--LN-------DR--AC-C-K-A-----------A-SL--KC
Sequence 2 GAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPSKC

Sequence 1 GVNLPYKISPTIDCSKVK
           G--L---IS-T--C----
Sequence 2 GISLTVPISRTVNCDTIS



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 36.44 (43/118)
Sequence 1 ------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFL
           -------A----A-----------A-AP-A-----CG-VV----PCL-F-
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAP-APGEGPCGKVVHHIMPCLKFV

Sequence 1 RSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGN
           --G----P---CC-G-K-L----KTT-----AC-C---A---ISGI----
Sequence 2 K-GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNEL

Sequence 1 AASLAGKCGV--NLPYKISPTIDCSKVK--------
           -A----KCG----LP--I----DCSK----------
Sequence 2 VAEVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 35.59 (42/118)
Sequence 1 --------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLT
           --------------A-----------A-AP--EA---CG-VV----PCL-
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEA---CGKVVQDIMPCLH

Sequence 1 FLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQL
           F---G----P---CC-G-K-L----KTT-----AC-C---A---ISGI--
Sequence 2 FVK-GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKN

Sequence 1 GNAASLAGKCGVN--LPYKISPTIDCSKVK--------
           ---A----KC-----LP--I----DCSK----------
Sequence 2 ELVAEVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 35.59 (42/118)
Sequence 1 ----------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPC
           ---------------VA----------VA-AP------TCGTVV--L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGI
           L-F---G----P---CC-G-K-L----KT-P-R--AC-C--TA----S-I
Sequence 2 LPFVQ-GKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDI

Sequence 1 QLGNAASLAGKCGV---NLPYKISPTIDCSKVK-------
           -----------CG-----LP--I----DC-----------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 61
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 34.75 (41/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           M---R--------L-----------A--TC-TV---L-PC--FL--G---
Sequence 2 MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-TGQEP

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           --ACC-GV--LNN--KT--DR-A-C-C-K----SI----------L--KC
Sequence 2 SKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIA-YDPKRMPLLSTKC

Sequence 1 GVNLPYK-ISPTIDCSKVK-
           GV-----------DCSK---
Sequence 2 GVKPDFPAVDKNLDCSKLPV



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 35.59 (42/118)
Sequence 1 -----------MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTP
           -----------------A-LA---LA-----AP------TCGTVV--L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLTFLRSGGAVAPA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISG
           CL-F---G----P---CC-G-K-L----KT---R--AC-C--TA----S-
Sequence 2 CLPFVQ-GKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSD

Sequence 1 IQLGNAASLAGKCGV---NLPYKISPTIDCSKVK----------------
           I-----------CG-----LP--I----DC--------------------
Sequence 2 IDGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGP

Sequence 1 ----------------------------
           ----------------------------
Sequence 2 VTGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 30.51 (36/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ----------------------------TCGT-V--L-PCL-F---G---
Sequence 2 --------------------------QETCGTMVRALMPCLPFVQ-GKEK

Sequence 1 APA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -P---CC-G-K-L----KT-P-R--AC-C--TA----S-I----------
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---NLPYKISPTIDCSKVK---------------------------
           -CG-----LP--I----DC--V----------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 29.66 (35/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ----------------------------TCGT-V--L-PCL-F---G---
Sequence 2 --------------------------QETCGTMVRALMPCLPFVQ-GKEK

Sequence 1 APA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -P---CC-G-K-L----KT-P-R--AC-C--TA----S-I----------
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---NLPYKISPTIDCSKVK---------------------------
           -CG-----LP--I----DC-------------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 27.12 (32/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------------V--L-PCL-F---G---
Sequence 2 --------------------------------MVRALMPCLPFVQ-GKEK

Sequence 1 APA--CCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -P---CC-G-K-L----KT-P-R--AC-C--TA----S-I----------
Sequence 2 EPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPK

Sequence 1 KCGV---NLPYKISPTIDCSKVK---------------------------
           -CG-----LP--I----DC--V----------------------------
Sequence 2 HCGIVDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKA

Sequence 1 -----------------
           -----------------
Sequence 2 RLERPQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 15.25 (18/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           --------------------------A-TC--V-----PCL--L--GG-V
Sequence 2 --------------------------ALTCSDVSNKISPCLSYLKQGGEV

Sequence 1 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC
           ---CC-GVK-LN--------------------------------------
Sequence 2 PADCCAGVKGLND-------------------------------------

Sequence 1 GVNLPYKISPTIDCSKVK
           ------------------
Sequence 2 ------------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 15.25 (18/118)
Sequence 1 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV
           ---------------------------ITC--V---L-PCLT-L-S-G--
Sequence 2 --------------------------SITCTQVSKSLMPCLTYLKSNGGS

Sequence 1 AP--ACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG
           -P---CC-GVK---------------------------------------
Sequence 2 PPPGTCCQGVKL--------------------------------------

Sequence 1 KCGVNLPYKISPTIDCSKVK
           --------------------
Sequence 2 --------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.