The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Ana o 2

Sequence 25991543

Full FASTA alignment

Sequence name:
Query sequence:
LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
CPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEG
NSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLF
SGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSE
RGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG
QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR
AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS
HHMRDDA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Ana o 2AAN76862Go!457531.43.6e-152
2Pis v 5.0101EU410073Go!473383.41.4e-107
3Pis v 2.0101DQ631676Go!496265.25.4e-72
4Pis v 2.0201DQ631677Go!472253.32.0e-68
5Ses i 7.0101Q9AUD2Go!497251.38.4e-68
6Cuc ma 4.0101P13744Go!480250.61.3e-67
7Ber e 2AAO38859Go!465238.08.1e-64
8Zan b 2.03QYS16039Go!389232.53.1e-62
9Zan b 2.02QYU76044Go!383225.24.6e-60
10Zan b 2.0101QYU76045Go!389222.23.7e-59
11Zan b 2.0102QYU76046Go!388221.08.4e-59
12Sin a 2.0101Q2TLW0Go!510198.38.0e-52
13Cor a 9AAL73404Go!515176.43.0e-45
14Fag e 1BAA21760Go!504166.23.6e-42
15Car i 4.0101ABW86978Go!505165.75.1e-42
16Jug r 4.0101Q2TPW5Go!507165.75.1e-42
17Jug n 4.0101A0A1L6K371Go!510165.27.2e-42
18Pru du 63EHK_AGo!531154.81.0e-38
19Pru du 6.0101ADN39440Go!551154.31.4e-38
20Ses i 6.0101Q9XHP0Go!459154.01.5e-38
21Gly m 6.0201P04405Go!485143.72.1e-35
22Gly m glycinin G2CAA68460Go!485143.72.1e-35
23Gly m 6.0301P11828Go!481143.52.3e-35
24Fag e 1Q9XFM4Go!538140.71.8e-34
25Gly m glycinin G1AAA33966Go!495140.02.7e-34
26Gly m 6.0101P04776Go!495140.02.7e-34
27Fag e 1BAA21758Go!565139.64.1e-34
28Pru du 6.0201ADN39441Go!504131.69.2e-32
29Ara h 3O82580Go!507122.93.9e-29
30Ara h 3AAC63045Go!510122.93.9e-29
31Gly m 6.0401Q9SB11Go!563114.21.7e-26
32Ara h 4AAD47382Go!530113.33.0e-26
33Gly m 6.0501Q7GC77Go!517110.03.1e-25
34Coc n 1.0101A0A0S3B0K0Go!49042.37.0e-05
35Jug r 2AAF18269Go!59339.07.8e-04

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 100.00 (457/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
Sequence 2 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
Sequence 2 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG

Sequence 1 CPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEG
           CPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEG
Sequence 2 CPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNEG

Sequence 1 NSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLF
           NSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLF
Sequence 2 NSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSRGRNLF

Sequence 1 SGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSE
           SGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSE
Sequence 2 SGFDTELLAEAFQVDERLIKQLKSEDNRGGIVKVKDDELRVIRPSRSQSE

Sequence 1 RGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
           RGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG
Sequence 2 RGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADIYTPEVG

Sequence 1 RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG
           RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG
Sequence 2 RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG

Sequence 1 QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR
           QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR
Sequence 2 QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR

Sequence 1 AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS
           AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS
Sequence 2 AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS

Sequence 1 HHMRDDA
           HHMRDDA
Sequence 2 HHMRDDA



Alignment 2
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 80.53 (368/457)
Sequence 1 --------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYE
           --------LSVC-LILFHGCLASRQ--QQQ-ECQID-LDALEPDNRVEYE
Sequence 2 MANPSLLSLSVCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEYE

Sequence 1 AGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEG
           AG-VE-WDPNHEQFRCAGVA--RHTIQPNGL-LP-YSNAP-L-Y-V-GEG
Sequence 2 AGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGEG

Sequence 1 MTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGV
           MTG---PGCPETYQAPQQG-Q-GQS-RFQD-HQKI-RFR-GDIIA-PAGV
Sequence 2 MTGTLIPGCPETYQAPQQGQQHGQSSRFQDKHQKIQRFRKGDIIALPAGV

Sequence 1 AHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQH
           A-WCYNEGNSPVVTVTLLDVSNSQNQLD--PRKF-LAGNP-D-FQQQQQ-
Sequence 2 ANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEFQQQQQQ

Sequence 1 QSRGR---------NLFSGFDTELLAEAFQVDERLIKQLKSE-DNRGGIV
           QSRGR---------N-F-GFDT--LAE-FQV---L-KQL--E-DNRG-IV
Sequence 2 QSRGRRQSQQKSCNNIFCGFDTKILAEVFQVEQSLVKQLQNEKDNRGAIV

Sequence 1 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRL
           KVK-D-L-VIRP-R-QSERG-ESEEESE-E--R-G-RDNG-EETICTM-L
Sequence 2 KVKGD-LQVIRPPRRQSERGFESEEESEYERGRRG-RDNGLEETICTMKL

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           KENI-DP-R-DIYTPEVGR-T-LNSLNLPILKWLQLS-E-GVL--NAL--
Sequence 2 KENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMV

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           PHWN-N-HSI-YGCKG--QVQVVDNFGN-VFDGEV-EGQ--VVPQNFAVV
Sequence 2 PHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVV

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           KRAR--RFEWISFKTNDRAM-SPLAG-TSVL--MPEEVLANAFQISREDA
Sequence 2 KRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDA

Sequence 1 RKIKFNNQQTTLTSGESSHHMRDDA
           RKIKFNN-Q-TL-SG-SS--MRDDA
Sequence 2 RKIKFNNEQPTLSSGQSSQQMRDDA



Alignment 3
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 53.17 (243/457)
Sequence 1 --------LSVCFLILFHGCLA-------SRQEWQQQ---DECQIDRLDA
           ---------S--FL-LFH---A-------S-Q--QQQ-----CQI--L-A
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 LEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAP
           LEP--R-E-EAG--E-WD-N-EQ--CA-VA--RHTIQ--GLL-P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNAP

Sequence 1 QLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQ-SGRFQDRHQKIRRFR
           -L-YVVQG-G--G---PGCPET-Q---Q-R-----S------HQK-R---
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSRSRSERSQQSGEQHQKVRPIQ

Sequence 1 RGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGN
           -GD-IA-PAGVAHW-YN-G-S--V-V-L-DV-NS-NQLD---RKF-L-G-
Sequence 2 EGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFVLGGS

Sequence 1 PKDVFQ--------QQQQHQSRGR------NLFSGFDTELLAEAFQVDER
           P----Q---------Q-Q---RG-------N--S-FD-E-LA--F--D--
Sequence 2 PQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNILSAFDEEILAQSFNIDTQ

Sequence 1 LIKQLKSED-NRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRW
           L---L--E---RG-IV-V--D-L-V--P-R---E---E-EEE-E---RR-
Sequence 2 LARRLQKEKRQRGIIVRVQED-LEVLSPHRQEQEQ--EYEEERE---RR-

Sequence 1 GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL
           -QR-NG-EET-CTM-LK-NINDP-RAD-Y-P--GR----N-LNLPIL--L
Sequence 2 -QR-NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSVNALNLPILRFL

Sequence 1 QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGE
           QLS--KGVL---A---PHWN-N-HSI-Y---G-G--Q-V---G--VFD-E
Sequence 2 QLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDEE

Sequence 1 VREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGM
           -REGQ--VVPQNFAVVKRA----FEW-SFKTN----TS-LAGR-SV----
Sequence 2 IREGQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRAL

Sequence 1 PEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA---------
           P--V--N-F-ISREDAR--K-----TT-----SS----------------
Sequence 2 PLDVIKNSFDISREDARRLKESRSETTIFAPGSSSQRKSQSERERQRERE

Sequence 1 -----
           -----
Sequence 2 EREIH



Alignment 4
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 53.17 (243/457)
Sequence 1 --------LSVCFLILFHGCLA-------SRQEWQQQ---DECQIDRLDA
           ---------S--FL-LFH---A-------S-Q--QQQ-----CQI--L-A
Sequence 2 MGYSSLLSFSLGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNA

Sequence 1 LEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAP
           LEP--R-E-EAG--E-WD-N-EQ--CA-VA--RHTIQ--GLL-P-Y-NAP
Sequence 2 LEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNAP

Sequence 1 QLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQ------DRHQK
           -L-YVVQG-G--G---PGCPET-Q---Q-----Q--R----------HQK
Sequence 2 ELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQK

Sequence 1 IRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKF
           -R--R-GDIIA-PAGVAHW-YN-G-S--V-V-L-DV-NS-NQLD---RKF
Sequence 2 VRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKF

Sequence 1 HLAGNPKDVFQQQQQHQSRGR---------NLFSGFDTELLAEAFQVDER
           -L-G-P----Q---Q--S--R---------N--S-FD-E-LA--F--D--
Sequence 2 VLGGSPQQEIQGGGQSWSQSRSSRKGQQSNNILSAFDEEILAQSFNIDTQ

Sequence 1 LIKQLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRW
           L-K-L--E---RG-IV-VK-D-L-V--P-R---E----------------
Sequence 2 LVKKLQREEKQRGIIVRVKED-LQVLSPQRQEKEYS--------------

Sequence 1 GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL
           ---DNG-EET-CTM-LK-NINDP-RAD-Y-P--GR-T--N-LNLPIL--L
Sequence 2 ---DNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFL

Sequence 1 QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGE
           QLSVEKGVLY-NA---PHWN-N-HSI-Y---G-G--Q-V---G--VFD-E
Sequence 2 QLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEE

Sequence 1 VREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGM
           -REGQ--VVPQNFAVVKRA----FEW-SFKTN--A--S-LAGR-SV--G-
Sequence 2 IREGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGL

Sequence 1 PEEVLANAFQISREDARKIKFN-NQQTTLTSGESSHHMRDDA
           P--V--N-F-ISREDA---K------T----G--S---R---
Sequence 2 PLDVIQNSFDISREDAWNLKESRSEMTIFAPGSRSQRQRN--



Alignment 5
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 50.98 (233/457)
Sequence 1 ----------------------LSVCFLILFHGCLASRQE--WQQQDECQ
           ----------------------------------L-S-Q----Q----C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 IDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLP
           --RL-A-EP--R-E-EAG--E-WD-N--QF-CAGVA-VR--IQP-GLLLP
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 QYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQK
           -Y-NAPQL-YVV-G-G--G---PGC-ET-----Q-RQ-----RF-DRHQK
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRRR-RFMDRHQK

Sequence 1 IRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKF
           -R-FR-GDI-A-PAG---W-YN-G--P--TV-LLD--N--NQLD-T-R-F
Sequence 2 VRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQTFRHF

Sequence 1 HLAGNPKDVFQ------QQQQHQSRGRNLFSGFDTELLAEAFQVDERLIK
           -LAGNP----Q------Q----Q----N-F-GFD-E-LA-AF-VD-----
Sequence 2 FLAGNPQGGRQSYFGRPQTEKQQGETKNIFNGFDDEILADAFGVDVQTAR

Sequence 1 QLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQR
           -LK--D--RG-IV------L----P---------------E-E--RW--R
Sequence 2 RLKGQDDLRGRIVRA--ERLDIVLPG--------------EEEEERW-ER

Sequence 1 D-----NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILK
           D-----NG-EET-CT--L-EN---PARAD-Y-P--GR---LNSL-LP-L-
Sequence 2 DPYSGANGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLS

Sequence 1 WLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFD
           WL-LS-EKGVLY-N-LV-PHWNLN-HSIIY---G-G--QVV---G--VFD
Sequence 2 WLRLSAEKGVLYRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFD

Sequence 1 GEVREGQMLVVPQNFAVVKRA-REERFEWISFKTNDRAMTSPLAGRTSVL
           G-VREGQ---VPQN--V-KRA---E--EWISFKTND-AMTS-LAGR-S--
Sequence 2 GVVREGQLIIVPQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAI

Sequence 1 GGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA------
           --MPEEV---A-Q-SR--AR--K-N-------S--S--------------
Sequence 2 RAMPEEVVMTAYQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYM

Sequence 1 ---------------
           ---------------
Sequence 2 PKPFEYVLDVIKSMM



Alignment 6
Sequence 1:
Sequence 2: Allergen Cuc ma 4.0101, Sequence: P13744
Sequence identity: 48.36 (221/457)
Sequence 1 -------LSVCFLILFHGCLASRQE-----------WQQQ-----DECQI
           ----------C------GCL----------------WQQ--------C--
Sequence 2 MARSSLFTFLCLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRL

Sequence 1 DRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQ
           --L-A--P--R-E-EA---E-WD-----F-CAGV---RHTI-P-GLLLP-
Sequence 2 ENLRAQDPVRRAEAEAIFTEVWDQDNDEFQCAGVNMIRHTIRPKGLLLPG

Sequence 1 YSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKI
           -SNAP-LI-V-QG-G--GI--PGC-ETYQ-----R-Q-----F-D-HQKI
Sequence 2 FSNAPKLIFVAQGFGIRGIAIPGCAETYQTDLR-RSQSAGSAFKDQHQKI

Sequence 1 RRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFH
           R-FR-GD----PAGV-HW-YN-G-S--V-----D--N--NQ-D---RKF-
Sequence 2 RPFREGDLLVVPAGVSHWMYNRGQSDLVLIVFADTRNVANQIDPYLRKFY

Sequence 1 LAGNPKDV------FQQQQQHQSRGR---NLFSGFDTELLAEAFQVDERL
           LAG-P--V--------------S-G----N-FSGF--E-L-EAFQ-D--L
Sequence 2 LAGRPEQVERGVEEWERSSRKGSSGEKSGNIFSGFADEFLEEAFQIDGGL

Sequence 1 IKQLKSEDN-RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWG
           ---LK-ED--R--IV-V-D----V--P-----ER------ESE-E-----
Sequence 2 VRKLKGEDDERDRIVQV-DEDFEVLLPEKDEEERSRGRYIESESES----

Sequence 1 QRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQ
           ---NG-EETICT-RLK-NI----RAD---P--GR--T-N---LPIL----
Sequence 2 --ENGLEETICTLRLKQNIGRSVRADVFNPRGGRISTANYHTLPILRQVR

Sequence 1 LSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEV
           LS-E-GVLY-NA-V-PH---NSHS--Y---G---VQVVDNFG--VFDGEV
Sequence 2 LSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQSVFDGEV

Sequence 1 REGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMP
           REGQ-L--PQNF-V-KRA----FEWI-FKTND-A-T--LAGR-S-----P
Sequence 2 REGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLP

Sequence 1 EEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           --VL-N---ISRE-A---K---Q-----S---S---R---
Sequence 2 LGVLSNMYRISREEAQRLKYGQQEMRVLSPGRSQGRRE--



Alignment 7
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 50.33 (230/457)
Sequence 1 ------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAG
           ------LS-----LFH-CLA---E-----EC-I-RL-A-EP--R-E-EAG
Sequence 2 MAKLFLLSLGIFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEAEAG

Sequence 1 TVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMT
           --E-WD----QFRCAGVA--R-TI-P-GLLLP-Y-NAP-L-YV-QG-G--
Sequence 2 VSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGRGIL

Sequence 1 GISYPGCPETYQAPQ--QG--RQQGQSGRFQDRHQKIRRFRRGDIIAIPA
           G---PGCPET-Q-----QG---Q----GRFQD-HQK------GDIIAIPA
Sequence 2 GVLMPGCPETFQSMSQFQGSREQEEERGRFQDQHQKVHHLKKGDIIAIPA

Sequence 1 GVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGN-PKDVFQQQ
           GVA-WCYN-G----VTV---------NQLD--PR-F-LAGN------Q--
Sequence 2 GVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGNIQRSQKQRG

Sequence 1 QQHQSRG------RNLFSGFDTELLAE--AFQVDERLIKQLKSEDN-RGG
           -----RG-------N-F-GF--E-LA----F--D---------ED--RG-
Sequence 2 ERYGLRGGQQILADNVFKGFNMEALADVLGFGMDTETARKVRGEDDQRGH

Sequence 1 IVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTM
           IV-V----L-VIRP-R----------EE-E------G---NG-EETIC--
Sequence 2 IVRVEQG-LKVIRPPRIR--------EELEQQE---GGGYNGLEETICSA

Sequence 1 RLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNAL
           ----NI--PA-AD-Y-P--GRLTT-NSL--PIL--LQLS--KGVLY-NA-
Sequence 2 TFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAM

Sequence 1 VLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFA
           --P-W-LN--S--Y---G---VQ-VD--G--VFD---REGQM-VVPQNF-
Sequence 2 MAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFV

Sequence 1 VVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISRE
           VVK-A----FEW--F-TND-A--S--AGRTS-L-G-P--VLANA---S-E
Sequence 2 VVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQE

Sequence 1 DARKIKFNNQQTTLTSGESSHHMRDDA
           -AR-IK-N-----L----S----R--A
Sequence 2 EARRIKLNRDEAVLFQPGSRSRGRASA



Alignment 8
Sequence 1:
Sequence 2: Allergen Zan b 2.03, Sequence: QYS16039
Sequence identity: 48.14 (220/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           -----------------------------------------EAG--E-WD
Sequence 2 -----------------------------------------EAGVTEFWD

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           -N--Q--CA-VA--RH-IQ-NGLL-P-Y-N-P-L-YVVQG-G--G---PG
Sequence 2 QNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPG

Sequence 1 CPETYQAPQQGRQQ----GQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWC
           CPETYQ--QQ--Q---------R-QD-HQK-R--R-GDIIA-P-G-AHW-
Sequence 2 CPETYQDEQQQQQSFSYPSEGSRSQDQHQKVRQIREGDIIALPTGSAHWI

Sequence 1 YNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQS--
           YN-G-S--V-V-L-DV-NS-NQLD---RKF-L-GNP----Q---Q-Q---
Sequence 2 YNNGQSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPQLQGTSQSQGGR

Sequence 1 ------------RGRNLFSGFDTELLAEAFQVDERLIKQL-KSEDNRGGI
           ------------R--N-F-GFD--LLAEAF-V---LI--L------RG-I
Sequence 2 YQERLGGGDSSRRSANIFNGFDERLLAEAFNVNPELIRRLQRPQMQRGII

Sequence 1 VKVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMR
           --V---E-RV--P------RG-ES-E---------G-R-NG-EET-CTMR
Sequence 2 IRV-EEEFRVLTP-----QRGQESYESDP-----YG-RYNGVEETLCTMR

Sequence 1 LKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALV
           L--NINDP-RAD-Y-P--GR-TT-N-LNLP-L-WLQLS-EKG-LYKNAL-
Sequence 2 LRHNINDPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALT

Sequence 1 LPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAV
           -PHWNLN-HSI-Y---G-G-VQ-V---GN-VFDGE-REGQ--VVPQ-FAV
Sequence 2 APHWNLNAHSIVYITRGNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAV

Sequence 1 VKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISRED
           VKRA-----EWISFKTND-AMT--LAGR-SVL---P--V--N--------
Sequence 2 VKRASNRGLEWISFKTNDYAMTNQLAGRVSVLRALPLDVIQN--------

Sequence 1 ARKIKFNNQQTTLTSGESSHHMRDDA
           --------------------------
Sequence 2 --------------------------



Alignment 9
Sequence 1:
Sequence 2: Allergen Zan b 2.02, Sequence: QYU76044
Sequence identity: 46.17 (211/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           -----------------------------------------EAG--E-WD
Sequence 2 -----------------------------------------EAGVTEFWD

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           -N--Q--CA-VA--RH-IQ-NGLL-P-Y-N---L-YVVQG-G--G---PG
Sequence 2 QNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPG

Sequence 1 CPETYQAPQQGRQ-QGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNE
           CPETYQ--QQ----Q-Q--R-QD-HQK-R--R-GDIIA-P-G-AHW-YN-
Sequence 2 CPETYQDQQQQQSYQSQGSRSQDQHQKVRQIREGDIIALPTGAAHWIYNN

Sequence 1 GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ------
           G-S--V-V-L-DV-NS-NQLD---RKF-L-GNP----Q---Q-Q------
Sequence 2 GGSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPELQGTSQRQQGGGYQ

Sequence 1 --------SRGRNLFSGFDTELLAEAFQVDERLIKQL-KSEDNRGGIVKV
           --------SR--N-F-GFD--LLA-AF-V---LI--L------RG-IV-V
Sequence 2 GSQGGGGGSRRGNMFNGFDERLLADAFNVNPELIRRLQRPQMQRGIIVRV

Sequence 1 KDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKE
           ---E-RV--P------RG-E-E-E-E---------DNG-EET-CTM-L--
Sequence 2 -EEEFRVLSP-----QRGQEQEQEQEQDC------DNGVEETFCTMKLRH

Sequence 1 NINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPH
           NINDP-RAD-Y-P--GR-TT-N--NLP-L-WLQLS-EKG-LY-NAL--PH
Sequence 2 NINDPSRADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTSPH

Sequence 1 WNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKR
           WNLN-HSI-Y---G-G--Q-V---GN-VF-GE-REGQ--V-PQ-FAVVK-
Sequence 2 WNLNCHSIVYITRGSGRMQIVSENGNDVFNGEIREGQLIVIPQGFAVVKK

Sequence 1 AREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARK
           A-----EWI-FKTND-AMT--LAGR-SV----P--V--------------
Sequence 2 ASNRGLEWIAFKTNDNAMTNQLAGRVSVMRALPLDV--------------

Sequence 1 IKFNNQQTTLTSGESSHHMRDDA
           -----------------------
Sequence 2 -----------------------



Alignment 10
Sequence 1:
Sequence 2: Allergen Zan b 2.0101, Sequence: QYU76045
Sequence identity: 45.73 (209/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           -----------------------------------------EAG--E-WD
Sequence 2 -----------------------------------------EAGVTEFWD

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           -N-EQ--CA-VA--RH-IQ--GLL-P-Y-N---L-YVVQG-G--G---PG
Sequence 2 QNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPG

Sequence 1 CPETYQAPQQGR-QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNE
           CPETYQ--QQ----Q----R-QD-HQK-R--R-GDI-A-P-G-AHW-YN-
Sequence 2 CPETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAVPTGSAHWIYNN

Sequence 1 GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ------
           G-S--V-V-L-DV-NS-NQLD---RKF---GNP----Q---Q-Q------
Sequence 2 GQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQ

Sequence 1 ----------SRGRNLFSGFDTELLAEAFQVDERLIKQL-KSEDNRGGIV
           ----------S-G-N-F-GFD--LLA-AF-V----I--L-K----RG-IV
Sequence 2 GSQGEGSSRRSSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIV

Sequence 1 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRL
           -V---EL-V-RP-R-Q-------E-E-E-E-R--G-RDNG-EET-CT--L
Sequence 2 RV-EEELEVLRPQRGQ-------EQEQEQEFR--G-RDNGLEETYCTIKL

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           K-NIN-P--AD-Y-P--GR--T-NS-NLP-L-W-QLS-EKG-LY-NA---
Sequence 2 KHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLA

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           PHWNLNSHS--Y---G-G-VQ-V---GN-V-DG---EGQ--VVPQ--AV-
Sequence 2 PHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVL

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           KRA-----EWISFKTND-A-TS-LAGR-SV----P--V--N---------
Sequence 2 KRASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN---------

Sequence 1 RKIKFNNQQTTLTSGESSHHMRDDA
           -------------------------
Sequence 2 -------------------------



Alignment 11
Sequence 1:
Sequence 2: Allergen Zan b 2.0102, Sequence: QYU76046
Sequence identity: 45.30 (207/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           -----------------------------------------EAG--E-WD
Sequence 2 -----------------------------------------EAGVTEFWD

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           -N-EQ--CA-VA--RH-IQ--GLL-P-Y-N---L-YVVQG-G--G---PG
Sequence 2 QNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPG

Sequence 1 CPETYQAPQQGR-QQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHWCYNE
           CPETYQ--QQ----Q----R-QD-HQK-R--R-GDI-A-P-G-AHW-YN-
Sequence 2 CPETYQDQQQQQSHQSEGSRSQDQHQKVRQLREGDIVAMPTGSAHWIYNN

Sequence 1 GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQ------
           G-S--V-V-L-DV-NS-NQLD---RKF---GNP----Q---Q-Q------
Sequence 2 GQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQ

Sequence 1 ----------SRGRNLFSGFDTELLAEAFQVDERLIKQL-KSEDNRGGIV
           ----------S-G-N-F-GFD--LLA-AF-V----I--L-K----RG-IV
Sequence 2 GSQGEGGSRRSSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIV

Sequence 1 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRL
           -V---EL-V-RP-R---------E-E-E-E-R--G-RDNG-EET-CT--L
Sequence 2 RV-EEELEVLRPQRG--------EQEQEQEFR--G-RDNGLEETYCTIKL

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           K-NIN-P--AD-Y-P--GR--T-NS-NLP-L-W-QLS-EKG-LY-NA---
Sequence 2 KHNINNPSDADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLA

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           PHWNLNSHS--Y---G-G-VQ-V---GN-V-DG---EGQ--VVPQ--AV-
Sequence 2 PHWNLNSHSVVYVTRGSGRVQIVSENGNNVYDGQIKEGQLIVVPQGYAVL

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           K-A-----EWISFKTND-A-TS-LAGR-SV----P--V--N---------
Sequence 2 KKASNQGLEWISFKTNDNAETSQLAGRNSVIRALPLDVIQN---------

Sequence 1 RKIKFNNQQTTLTSGESSHHMRDDA
           -------------------------
Sequence 2 -------------------------



Alignment 12
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 48.80 (223/457)
Sequence 1 ---------LSVCFLILFHGCLASRQEW----QQQDECQIDRLDALEPDN
           -----------V--L----GCLA-RQ------Q--D-C--D-LD-L-P--
Sequence 2 MVKLAHLLVATVGVLLVLNGCLA-RQSLGVPPQVKDACNLDNLDVLQPTE

Sequence 1 RVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYV
           ----EAG-VE-WD-NH-Q-RCAGV---R--IQ--GL-LP-----P---YV
Sequence 2 VIKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYV

Sequence 1 VQGEGMTGISYPGCPETY--QAP---QQGRQQGQSGR-------------
           VQG-G--G---PGC-ET-----P---QQG-QQGQ-G--------------
Sequence 2 VQGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQ

Sequence 1 ------------------------FQDRHQKIRRFRRGDIIAIPAGVAHW
           ------------------------F-D-HQK----R-GD-IA---G-A-W
Sequence 2 GQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMTPGSAQW

Sequence 1 CYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQHQSR
           -YN-G--P---V-L-D--N-QNQLDR-PR-F-LAGN------QQQQ-Q--
Sequence 2 IYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNNQQGSSQQQQQQQQ

Sequence 1 GRNLFSGFDTELLAEAFQVDERLIKQLKSE-DNRGGIVKVKDDELRVIRP
           --N--SGFD---LA-A---D-RL---L----D-RG-IV-VK-----V-RP
Sequence 2 --NILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGP-FQVVRP

Sequence 1 SRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENINDPARADI
           ---Q-----ESE-------------DNG-EETIC-MR--ENI-DPARADI
Sequence 2 PLRQAY---ESEQWRHPRGPPQSPQDNGLEETICSMRTHENIDDPARADI

Sequence 1 YTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIY
           Y-P--GR-T--NS--LPIL----LS---G-L---A-VLP--N-N---I-Y
Sequence 2 YKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILY

Sequence 1 GCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWIS
           ---G----QVV---G--V-D--V--GQ--V-PQ-FA-V-------FEWIS
Sequence 2 CTQGQARIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQNN-FEWIS

Sequence 1 FKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTL
           FKTN--AM-S-LAGRTS-L---P-EV--NA-QIS-E-ARKIKFN---TTL
Sequence 2 FKTNANAMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLETTL

Sequence 1 TSGESSHHMRDDA-----
           T-----------------
Sequence 2 TRARGGQQPQLIEEIVEV



Alignment 13
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 60.39 (276/457)
Sequence 1 --------LSVCFLILFHGCLA-----SRQEWQQQDECQIDRLDALEPDN
           ---------S-C-L-LF-GCL-------RQ------EC--DRL-ALEP-N
Sequence 2 MAKLILVSFSLCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPTN

Sequence 1 RVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYV
           R-E-EA---E-WD-N--QF-CAGVA--R-TI-PNGLLLPQYSNAP-LIY-
Sequence 2 RIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIYI

Sequence 1 VQGEGMTGISYPGCPETYQAPQQGRQQGQ------SGRF-QDRHQKIRRF
           --G-G-TG---PGCPET---PQQ--QQGQ------S-R--QDRHQKIR-F
Sequence 2 ERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRHF

Sequence 1 RRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAG
           R-GDIIA-PAGVAHWCYN-G-SPVVTV-LL---N--NQLD--PR-F-LAG
Sequence 2 REGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLAG

Sequence 1 NPKDVFQQQ-----------QQH----------QSRGRNLFSGFDTELLA
           NP-D--Q-Q-----------QQH----------Q--G-N-FSGFD-E-LA
Sequence 2 NPDDEHQRQGQQQFGQRRRQQQHSHGEQGEQEQQGEGNNVFSGFDAEFLA

Sequence 1 EAFQVDERLIKQLKS-EDNRGGIVKVKDDELRVIRPSRSQS--ERGSESE
           -AF-VD------L-S--D-R--IVKV----L-V-RP-RS----ER----E
Sequence 2 DAFNVDVDTARRLQSNQDKRRNIVKV-EGRLQVVRPERSRQEWERQERQE

Sequence 1 EESEDEK---RRWGQRD---NGIEETICTMRLKENINDPARADIYTPEVG
           -ESE-E----RR-G-R----NG-EETIC--RL-ENI----RADIYT--VG
Sequence 2 RESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYTEQVG

Sequence 1 RLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKG
           R--T-NS--LP-L-WLQLS-E-G-L----L--PHWNLN-HS--Y---G--
Sequence 2 RINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRA

Sequence 1 QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDR
           -VQVVD--GN-VFD-E-R-GQ-L--PQNFAV-KRA--E-FEW--FKTND-
Sequence 2 RVQVVDDNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDN

Sequence 1 AMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESS
           A--SPLAGRTS-----P--VLANAFQISRE-AR--K-N-Q-TTL-----S
Sequence 2 AQISPLAGRTSAIRALPDDVLANAFQISREEARRLKYNRQETTLVRSSRS

Sequence 1 HHMRDDA---------
           ---R------------
Sequence 2 SSERKRRSESEGRAEA



Alignment 14
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 45.30 (207/457)
Sequence 1 ---------------------LSVCFLILFHGCLASRQEWQQQDECQIDR
           ---------------------L--------------RQ--Q-Q--C-I-R
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS
           L-A-EP--RV--EAG--E-WD-----FRC-G---VR--IQP-GLLLP-YS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPQLIYVVQGEGMTGISYPGCPETYQA------P--QQGRQQGQSGRFQ
           NAP----V-QG-G--G---PGCPET-Q-------P--Q-GR---QS----
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE

Sequence 1 -----DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQ
           -----D-HQKI-R-R-GD-I--PAGV--W--N-GN-----VTLLD-----
Sequence 2 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH

Sequence 1 NQLDRTPRKFHLAG-NPKDVFQQQQQHQSR---------GRNLFSGFDTE
           -QLD---R-F-LAG-------------QSR---------G-N--SGF--E
Sequence 2 KQLDENVRSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDE

Sequence 1 LLAEAFQ-VDERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE
           -L-E-F--VD---I--L--E-D-RG-IV---D--LRV--P-----E----
Sequence 2 ILHELFRDVDRETISKLRGENDQRGFIVQAQDLKLRV--PQDFEEEY---

Sequence 1 SEEESEDEKRRWGQ--RDNGIEETICTMRLKENINDPARADIYTPEVGRL
           -E-E--D--R--G---R-NG-E---C------N-N-P-------P--GR-
Sequence 2 -ERERGDRRRGQGGSGRSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRI

Sequence 1 TTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQV
           -T-NS--LPIL--LQLS----VLYKNA---P-WNLN-HS--Y---G-G-V
Sequence 2 NTVNSNSLPILEFLQLSAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRV

Sequence 1 QVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAM
           QVV---G--VFD--V--GQ-LVVPQ-FAVV--A--E--EW---K----A-
Sequence 2 QVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGREGLEWVELKNSGNAI

Sequence 1 TSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHH
           TSP--GRTSVL---P-EVLAN---IS---A-K-K---Q---------S--
Sequence 2 TSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRD

Sequence 1 MRDDA-----
           ----------
Sequence 2 EKERERFSIV



Alignment 15
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 63.46 (290/457)
Sequence 1 --------LSVCFLI--LFHGCLASRQEWQQQ--DECQIDRLDALEPDNR
           -----------C--I--LF-GCLA-----QQ-----CQ--RLDALEP-NR
Sequence 2 MAKPILLSIYLCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTNR

Sequence 1 VEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVV
           -E-EAG--E-WDPNH-Q--CAGVA-VR-TI-PNGLLLP-YSNAPQL-Y--
Sequence 2 IEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIA

Sequence 1 QGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQ-DRHQKIRRFRRGDIIA
           -G-G-TG---PGCPET----Q---QQGQ---FQ-DRHQKIR-FR-GDIIA
Sequence 2 RGRGITGVLFPGCPETFEESQRQSQQGQRREFQQDRHQKIRHFREGDIIA

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF-
           -PAGVAHWCYN-G-SPVV---LLD--N--NQLD--PR-F-LAGNP-D-F-
Sequence 2 FPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPDDEFR

Sequence 1 ---QQ-------QQQHQSR-----------GRNLFSGFDTELLAEAFQVD
           ---QQ-------QQQHQ-R-----------G-N-FSGFD-E-LA-AF-VD
Sequence 2 PQGQQEYEQHRRQQQHQQRRGEHGEQQRDLGNNVFSGFDAEFLADAFNVD

Sequence 1 ERLIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSE----RGSESEEE
           ------L-SE-D-RG-IV-V----L-VIRP--SR---E-------E-E-E
Sequence 2 TETARRLQSENDHRGSIVRVEGRQLQVIRPRWSREEQEHEERKERERERE

Sequence 1 SEDEK---RRWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTL
           SE-E----RR-G--DNG-EETICT--L-ENI-DP-RADIYT-E-GR--T-
Sequence 2 SESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYTEEAGRISTV

Sequence 1 NSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVV
           NS-NLPIL-WLQLS-E-G-LY--AL--PHWNLN-HS--Y---G---VQVV
Sequence 2 NSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVV

Sequence 1 DNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSP
           DNFG--VFD-E-REGQ-L--PQNFAVVKRAR-E-FEW-SFKTN--AM-SP
Sequence 2 DNFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSP

Sequence 1 LAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRD
           LAGRTS-----PEEVL-NAFQI-REDAR--KFN-Q--TL----S------
Sequence 2 LAGRTSAIRALPEEVLVNAFQIPREDARRLKFNRQESTLVRSRSRSSRSE

Sequence 1 DA---
           -----
Sequence 2 RRAEV



Alignment 16
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 63.24 (289/457)
Sequence 1 -------LSVCFLI--LFHGCLASRQEWQQQD--ECQIDRLDALEPDNRV
           -----------FLI--LF-GCLA-----QQQ----CQ--RLDALEP-NR-
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRI

Sequence 1 EYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQ
           E-EAG--E-WDPN--QF-CAGVA-VR-TI-PNGLLLPQYSNAPQL-Y---
Sequence 2 EAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIAR

Sequence 1 GEGMTGISYPGCPETYQAPQQGRQQGQSGRFQ-DRHQKIRRFRRGDIIAI
           G-G-TG---PGCPET----Q---QQGQS--FQ-DRHQKIR-FR-GDIIA-
Sequence 2 GRGITGVLFPGCPETFEESQRQSQQGQSREFQQDRHQKIRHFREGDIIAF

Sequence 1 PAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF--
           PAGVAHW-YN-G--PVV---LLD--N--NQLD--PR-F-LAGNP-D-F--
Sequence 2 PAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDDEFRP

Sequence 1 --QQ-------QQQHQSR-----------GRNLFSGFDTELLAEAFQVDE
           --QQ-------QQQ-Q-R-----------G-N-FSGFD---LA-AF-VD-
Sequence 2 QGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDADFLADAFNVDT

Sequence 1 RLIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSERG----SESEEES
           -----L-SE-D-R--IV-V----L-VIRP--SR---ER------E-E-ES
Sequence 2 ETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERERES

Sequence 1 EDEKR---RWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLN
           E-E-R---R-G--DNG-EETICT-RL-ENI-DP-RADIYT-E-GR--T-N
Sequence 2 ESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTVN

Sequence 1 SLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVD
           S--LP-L-WLQLS-E-G-LY--AL--PHWNLN-HS--Y---G---VQVVD
Sequence 2 SHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVD

Sequence 1 NFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPL
           NFG--VFD-E-REGQ-L--PQNFAVVKRAR-E-FEW-SFKTN--AM-SPL
Sequence 2 NFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPL

Sequence 1 AGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDD
           AGRTS-----PEEVLA-AFQI-REDAR--KFN-Q--TL-----S------
Sequence 2 AGRTSAIRALPEEVLATAFQIPREDARRLKFNRQESTLVRSRPSRSRSSR

Sequence 1 A------
           -------
Sequence 2 SERRAEV



Alignment 17
Sequence 1:
Sequence 2: Allergen Jug n 4.0101, Sequence: A0A1L6K371
Sequence identity: 62.58 (286/457)
Sequence 1 --------LSVCFLILFHGCLASRQEWQQQ--DECQIDRLDALEPDNRVE
           ---------S-C---L--GCLA-----QQ----EC---RL-ALEP-NR-E
Sequence 2 MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIE

Sequence 1 YEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQG
           -EAG--E-WDPN--QF-CAGVA-VR-TI-PNGLLLPQYSNAPQL-Y-V-G
Sequence 2 AEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKG

Sequence 1 EGMTGISYPGCPETYQAPQQG----RQQGQSGRFQ-DRHQKIRRFRRGDI
           -G-TG---PGCPET----QQG----R----S--FQ-DRHQKIR-FR-GD-
Sequence 2 RGITGVLFPGCPETFEESQQGQSRIRPSLRSASFQRDRHQKIRHFREGDV

Sequence 1 IAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDV
           IA-PAGVAHWCYN-G--PVV-V-L-D--N--NQLD--PR-F-LAGNP-D-
Sequence 2 IAFPAGVAHWCYNDGDTPVVAVALMDTTNNANQLDQNPRNFYLAGNPDDE

Sequence 1 F----QQ-------QQQHQSR-----------GRNLFSGFDTELLAEAFQ
           F----QQ-------QQQHQ-R-----------G-N-FSGFD---LA-AF-
Sequence 2 FRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGFDADFLADAFN

Sequence 1 VDERLIKQLKSE-DNRGGIVKVKDDELRVIRP--SRSQSERGS----ESE
           VD------L-SE-D-R--IV-V----L-VIRP--SR---ER------E-E
Sequence 2 VDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERE

Sequence 1 EESEDEKR---RWGQRDNGIEETICTMRLKENINDPARADIYTPEVGRLT
           -ESE-E-R---R-G--DNG-EETICT-RL-ENI-DP-RADIYT-E-GR--
Sequence 2 RESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRIS

Sequence 1 TLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQ
           T-NS--LP-L-WLQLS-E-G-LY--AL--PHWNLN-HS--Y---G---VQ
Sequence 2 TANSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQ

Sequence 1 VVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMT
           VVDNFG--VFD-E-REGQ-L--PQNFAVVKRAR-E-FEW-SFKTN--AM-
Sequence 2 VVDNFGQTVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMV

Sequence 1 SPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHM
           SPLAGRTS-----PEEVLANA-QI-REDAR--KFN-Q--TL-----S---
Sequence 2 SPLAGRTSAIRALPEEVLANALQIPREDARRLKFNRQESTLVRSRPSSSR

Sequence 1 RDDA------
           ----------
Sequence 2 SSRSERRAEV



Alignment 18
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 50.77 (232/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           -------------A-------Q--CQ---L-A-EPDNR---EAG--E-W-
Sequence 2 -------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWN

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           -N---F-CAGVA--R-TIQ-NGL-LP-YSNAPQLIY-VQG-G--G----G
Sequence 2 FNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSG

Sequence 1 CPETY----QAPQQGRQQ--------------------------------
           CPET-----Q--QQGRQQ--------------------------------
Sequence 2 CPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQERQGRQQ

Sequence 1 ---------------GQSGRFQ--------DRHQKIRRFRRGDIIAIPAG
           ---------------GQ-GR-Q--------DRHQK-RR-R-GD--AIPAG
Sequence 2 GRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGDVVAIPAG

Sequence 1 VAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQ
           VA-W-YN-G----V-V-L--VS---NQLD--PRKF-LAGNP---F-QQ-Q
Sequence 2 VAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQ

Sequence 1 HQSR--------------------------GRNLFSGFDTELLAEAFQVD
           -Q-R--------------------------G-N-FSGF-T-LLA-A--V-
Sequence 2 SQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVN

Sequence 1 ERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE--SEEESEDE
           E-----L----DNR--I--V----L----P-R---ER--E----E----E
Sequence 2 EETARNLQGQNDNRNQIIQVRGN-LDFVQPPRGRQEREHEERQQEQLQQE

Sequence 1 KRRWGQR--DNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNL
           ----G-----NG-EET-C--RLKENI--P-RADI--P--GR--TLNS-NL
Sequence 2 RQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNL

Sequence 1 PILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGN
           PIL--L-LS-E-G--Y-N----PHWN-N-HS--Y---G---VQVV---G-
Sequence 2 PILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGD

Sequence 1 RVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRT
           ---D-EV--GQ---VPQN--V---A----FE---FKT---A----LAGRT
Sequence 2 AILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRT

Sequence 1 SVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           S-L---P-EVLANA-QISRE-AR--K-N-Q-T---S--SS---R---
Sequence 2 SFLRALPDEVLANAYQISREQARQLKYNRQETIALS--SSQQRRAVV



Alignment 19
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 52.95 (242/457)
Sequence 1 ------LSVCFLILFHGCLASRQ-EWQQQDECQIDRLDALEPDNRVEYEA
           -------S-C-L--F-GCLA-RQ-----Q--CQ---L-A-EPDNR---EA
Sequence 2 MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGM
           G--E-W--N-E-F-CAGVA--R-TIQ-NGL-LP-YSNAPQLIY-VQG-G-
Sequence 2 GQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 TGISYPGCPETY----QAPQQGRQQ-------------------------
           -G----GCPET-----Q--QQGRQQ-------------------------
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 ----------------------GQSGRFQ--------DRHQKIRRFRRGD
           ----------------------GQ-GR-Q--------DRHQK-RR-R-GD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIREGD

Sequence 1 IIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKD
           --AIPAGVA-W-YN-G----V-V-L--VS---NQLD--PRKF-LAGNP--
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 VFQQQQQHQSR--------------------------GRNLFSGFDTELL
           -F-QQ-Q-Q-R--------------------------G-N-FSGF-T-LL
Sequence 2 EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLL

Sequence 1 AEAFQVDERLIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSE--S
           A-A--V-E-----L----DNR--I--V----L----P-R---ER--E---
Sequence 2 AQALNVNEETARNLQGQNDNRNQIIRVRGN-LDFVQPPRGRQEREHEERQ

Sequence 1 EEESEDEKRRWGQR--DNGIEETICTMRLKENINDPARADIYTPEVGRLT
           -E----E----G-----NG-EET-C--RLKENI--P-RADI--P--GR--
Sequence 2 QEQLQQERQQQGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIS

Sequence 1 TLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQ
           TLNS-NLPIL--L-LS-E-G--Y-N----PHWN-N-HS--Y---G---VQ
Sequence 2 TLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQ

Sequence 1 VVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMT
           VV---G----D-EV--GQ---VPQN--V---A----FE---FKT---A--
Sequence 2 VVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFI

Sequence 1 SPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHM
           --LAGRTS-L---P-EVLANA-QISRE-AR--K-N-Q-T---S--SS---
Sequence 2 NTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALS--SSQQR

Sequence 1 RDDA
           R---
Sequence 2 RAVV



Alignment 20
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 41.58 (190/457)
Sequence 1 -------LSVCFLILFHGCLASRQE--WQQQDECQIDRLDALEPDNRVEY
           -------L------L-----A---E----Q---C---R-----P--R---
Sequence 2 MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQS

Sequence 1 EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGE
           E-GT-E-WD---EQF-CAG----R-TI-PNGL-LP-Y---P-L-Y---G-
Sequence 2 EGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQ

Sequence 1 GMTGISYPGCPETYQAPQQGR--------QQGQSGRFQDRHQKIRRFRRG
           G---I--PGC-ETYQ-----R---------Q---G---D-HQK--R-R-G
Sequence 2 GLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQG

Sequence 1 DIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGN-P
           DI-AIP-G-AHWCYN-G----V-V---DV----NQLD---R-F-LAG--P
Sequence 2 DIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVP

Sequence 1 KDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSEDNRGGIV
           ----Q-QQ--Q----N-F--FD-ELL-EAF-V----I----SE----G--
Sequence 2 RSGEQEQQARQTF-HNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLI

Sequence 1 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRL
           ----------RP-----------EEE-E-E-R---Q-DNG-EET-CTM--
Sequence 2 VMARERMTFVRPD----------EEEGEQEHRGR-QLDNGLEETFCTMKF

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           --N------ADI-----GR--------LPILK---LS-EKG-LY-NALV-
Sequence 2 RTNVESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVS

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           P-W----H-I-Y---G--QVQVVD--G-------V--G-M-VVPQ-----
Sequence 2 PDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTST

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           -RA----FEW--FKT----M-SPLAG-TSV---MP--V--N--QIS---A
Sequence 2 ARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQA

Sequence 1 RKIKFN--NQQTTLTSGESSHHMRDDA
           ---K-N---Q---L--G----------
Sequence 2 QALKMNRGSQSFLLSPGGRRS------



Alignment 21
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 49.89 (228/457)
Sequence 1 -----LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGT
           -----LS-CFL-LF-GC-A-R-E--QQ-ECQI--L-AL-PDNR-E-E-G-
Sequence 2 MAKLVLSLCFL-LFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGF

Sequence 1 VEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTG
           -E-W-PN---F-CAGVAL-R-T---N-L--P-Y-N-PQ-IY--QG-G--G
Sequence 2 IETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFG

Sequence 1 ISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHW
           ---PGCP-TYQ-PQ---Q-G-S-R-QDRHQK--RFR-GD-IA-P-GVA-W
Sequence 2 MIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWW

Sequence 1 CYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF---QQQQQ-
           -YN----PVV-V---D-----NQLD--PR-F-LAGN----F---QQQQQ-
Sequence 2 MYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG

Sequence 1 -----------HQSRGRNLFSGFDTELLAEAFQVDERLIKQLKS---EDN
           ---------------G-N--SGF--E-L-EAF-V-------L-----E--
Sequence 2 GSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEEED

Sequence 1 RGGIVKVKDDELRVIRPS--RSQSERGSESEEES----EDEK--RRWGQR
           -G-IV-VK---LRV--P-----Q-E-----EEE-----E--K---R---R
Sequence 2 SGAIVTVKGG-LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKR

Sequence 1 D-NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQL
           --NGI-ETICTMRL--NI------DIY-P--G--TT--SL--P-L--L-L
Sequence 2 SRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKL

Sequence 1 SVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVR
           S---G-L-KNA---PH--LN--SIIY---G---VQVV---G-RVFDGE--
Sequence 2 SAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQ

Sequence 1 EGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPE
           EG--L-VPQNFAV--------FE--SFKTNDR-----LAG--S-L---PE
Sequence 2 EGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPE

Sequence 1 EVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           EV----F------AR--K-NN----L-----S-------
Sequence 2 EVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA-



Alignment 22
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 49.89 (228/457)
Sequence 1 -----LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGT
           -----LS-CFL-LF-GC-A-R-E--QQ-ECQI--L-AL-PDNR-E-E-G-
Sequence 2 MAKLVLSLCFL-LFSGCFALR-EQAQQNECQIQKLNALKPDNRIESEGGF

Sequence 1 VEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTG
           -E-W-PN---F-CAGVAL-R-T---N-L--P-Y-N-PQ-IY--QG-G--G
Sequence 2 IETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFG

Sequence 1 ISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVAHW
           ---PGCP-TYQ-PQ---Q-G-S-R-QDRHQK--RFR-GD-IA-P-GVA-W
Sequence 2 MIFPGCPSTYQEPQESQQRGRSQRPQDRHQKVHRFREGDLIAVPTGVAWW

Sequence 1 CYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF---QQQQQ-
           -YN----PVV-V---D-----NQLD--PR-F-LAGN----F---QQQQQ-
Sequence 2 MYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQG

Sequence 1 -----------HQSRGRNLFSGFDTELLAEAFQVDERLIKQLKS---EDN
           ---------------G-N--SGF--E-L-EAF-V-------L-----E--
Sequence 2 GSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIVRNLQGENEEED

Sequence 1 RGGIVKVKDDELRVIRPS--RSQSERGSESEEES----EDEK--RRWGQR
           -G-IV-VK---LRV--P-----Q-E-----EEE-----E--K---R---R
Sequence 2 SGAIVTVKGG-LRVTAPAMRKPQQEEDDDDEEEQPQCVETDKGCQRQSKR

Sequence 1 D-NGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQL
           --NGI-ETICTMRL--NI------DIY-P--G--TT--SL--P-L--L-L
Sequence 2 SRNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDFPALWLLKL

Sequence 1 SVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVR
           S---G-L-KNA---PH--LN--SIIY---G---VQVV---G-RVFDGE--
Sequence 2 SAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQ

Sequence 1 EGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPE
           EG--L-VPQNFAV--------FE--SFKTNDR-----LAG--S-L---PE
Sequence 2 EGGVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPE

Sequence 1 EVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           EV----F------AR--K-NN----L-----S-------
Sequence 2 EVIQHTFNLKSQQARQVKNNNPFSFLVPPQESQRRAVA-



Alignment 23
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 49.67 (227/457)
Sequence 1 -----LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEA
           -----LS-CFL-LF-GC--A-S--E--QQ-ECQI-RL-AL-PDNR-E-E-
Sequence 2 MAKLVLSLCFL-LFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEG

Sequence 1 GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGM
           G--E-W-PN---F-CAGVAL-R-T---N-L--P-Y-NAPQ-IY--QG-G-
Sequence 2 GFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQGSGI

Sequence 1 TGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVA
           -G---PGCP-T---PQQ----GQS-R-QDRHQKI--FR-GD-IA-P-G-A
Sequence 2 FGMIFPGCPSTFEEPQQ---KGQSSRPQDRHQKIYHFREGDLIAVPTGFA

Sequence 1 HWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQ-----
           -W-YN----PVV-V-L-D----QNQLD--PR-F-LAGN----F-Q-----
Sequence 2 YWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQK

Sequence 1 ------------QQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLKSED
           ------------QQ-----G----SGF--E-L--AF-VD------L--E-
Sequence 2 QQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVDRQIVRKLQGEN

Sequence 1 N---RGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRR--WGQRDN
           -----G-IV-VK--------P---Q--R--E-E----DEK------Q--N
Sequence 2 EEEEKGAIVTVKGGLSVISPPTEEQQQRPEEEEKPDCDEKDKHCQSQSRN

Sequence 1 GIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVE
           GI-ETICTMRL--NI------DI--P--G--TT--SL--P-L-WL-LS--
Sequence 2 GIDETICTMRLRHNIGQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQ

Sequence 1 KGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQ
           -G-L-KNA---PH-NLN--SIIY---G---VQVV---G-RVFDGE--EGQ
Sequence 2 FGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGELQEGQ

Sequence 1 MLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVL
           -L-VPQNFAV--R-----FE--SFKTNDR-----LAG--S-L---PEEV-
Sequence 2 VLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVI

Sequence 1 ANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           ---F---R--AR--K-NN----L-----S-------
Sequence 2 QQTFNLRRQQARQVKNNNPFSFLVPPKESQRRVVA-



Alignment 24
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 47.26 (216/457)
Sequence 1 --------LSVCFLILFHGCLASRQEWQQ-------------QDECQIDR
           ---------S-C---L---C-A----WQ--------------Q--C-I-R
Sequence 2 MSTKLILSFSLCLMVL--SCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQR

Sequence 1 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS
           L-A-EP--RV--EAG--E-WD-----FRCAG---VR--IQP-GLLLP-YS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPQLIYVVQGEGMTGISYPGCPETYQA------PQQGRQQ-------GQ
           NAP----V-QG-G--G---PGCPET-Q-------P---R-Q-------G-
Sequence 2 NAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGE

Sequence 1 SGR---------------------------FQ--DRHQKIRRFRRGDIIA
           S-R---------------------------F---D-HQKI-R-R-GD-I-
Sequence 2 SSRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIP

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK----
           -PAGV--W--N-G-------TL-D----QNQLD---R-F-LAG--K----
Sequence 2 SPAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSRE

Sequence 1 DVFQQQQ------QHQSRGR---------NLFSGFDTELLAEAFQ-VDER
           D---Q-Q--------QSR-----------N--SGF--E-L-E-F--VD--
Sequence 2 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE

Sequence 1 LIKQLKSE-DNRGGIVKVKDDELRVIRPSRSQSERGSESEEESEDEKRRW
           -I--L--E-D-RG-IV---D--LRV--P-----E---E---E--D-KR--
Sequence 2 TISKLRGENDQRGFIVQARDLKLRV--PE----EYEEELQRERGDRKRGG

Sequence 1 GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL
           --R-NG-E---C------N-N-P-RAD---P--GR--T--S-NLPIL---
Sequence 2 SGRSNGLEQAFCNLKFRQNVNRPSRADVFNPRAGRINTVDSNNLPILEFI

Sequence 1 QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGE
           QLS----VLYKNA---P-WNLN-HS--Y---G-G-VQVV---G--VFD--
Sequence 2 QLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDN

Sequence 1 VREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGM
           V--GQ-LVVPQ-FAVV--A--E--EW---K--D-A-TSP-AG-TSVL---
Sequence 2 VQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRAI

Sequence 1 PEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA-----
           P-EVLAN---IS---A---K---Q---------S------------
Sequence 2 PVEVLANSYDISTKEAFRLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 25
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 51.42 (235/457)
Sequence 1 -----LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEA
           ------S-CFL-LF-GC--A-S--E--QQ-ECQI--L-AL-PDNR-E-E-
Sequence 2 MAKLVFSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEG

Sequence 1 GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGM
           G--E-W-PN---F-CAGVAL-R-T---N-L--P-Y-N-PQ-IY--QG-G-
Sequence 2 GLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGI

Sequence 1 TGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVA
           -G--YPGCP-T---PQQ--Q-GQS-R-QDRHQKI--FR-GD-IA-P-GVA
Sequence 2 FGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVA

Sequence 1 HWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQ--
           -W-YN----PVV-V---D-----NQLD--PR-F-LAGN----F---QQ--
Sequence 2 WWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ

Sequence 1 --HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLKSED--
           --HQS------------G----SGF--E-L--AF-VD----K-L--E---
Sequence 2 GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEG

Sequence 1 -NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------
           ---G-IV-VK---L-VI-P----Q--R--E-EEE-EDEK-----------
Sequence 2 EDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQ

Sequence 1 RRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLN
           R--G-----R-NGI-ETICTMRL--NI------DIY-P--G--TT--SL-
Sequence 2 RPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD

Sequence 1 LPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFG
           -P-L-WL-LS-E-G-L-KNA---PH-NLN--SIIY---G----QVV---G
Sequence 2 FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG

Sequence 1 NRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGR
           -RVFDGE--EG--L-VPQNF-V--R-----FE--SFKTND--M---LAG-
Sequence 2 ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGA

Sequence 1 TSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           -S-L---PEEV----F------AR-IK-NN----L-----S-------
Sequence 2 NSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA-



Alignment 26
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 51.42 (235/457)
Sequence 1 -----LSVCFLILFHGC-LA-SRQEWQQQDECQIDRLDALEPDNRVEYEA
           ------S-CFL-LF-GC--A-S--E--QQ-ECQI--L-AL-PDNR-E-E-
Sequence 2 MAKLVFSLCFL-LFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIESEG

Sequence 1 GTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGM
           G--E-W-PN---F-CAGVAL-R-T---N-L--P-Y-N-PQ-IY--QG-G-
Sequence 2 GLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGI

Sequence 1 TGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIAIPAGVA
           -G--YPGCP-T---PQQ--Q-GQS-R-QDRHQKI--FR-GD-IA-P-GVA
Sequence 2 FGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVA

Sequence 1 HWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVFQQQQQ--
           -W-YN----PVV-V---D-----NQLD--PR-F-LAGN----F---QQ--
Sequence 2 WWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQ

Sequence 1 --HQSR-----------GRNLFSGFDTELLAEAFQVDERLIKQLKSED--
           --HQS------------G----SGF--E-L--AF-VD----K-L--E---
Sequence 2 GGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEG

Sequence 1 -NRGGIVKVKDDELRVIRP-SRSQSERGSESEEESEDEK-----------
           ---G-IV-VK---L-VI-P----Q--R--E-EEE-EDEK-----------
Sequence 2 EDKGAIVTVKGG-LSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQ

Sequence 1 RRWGQ----RDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLN
           R--G-----R-NGI-ETICTMRL--NI------DIY-P--G--TT--SL-
Sequence 2 RPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLD

Sequence 1 LPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFG
           -P-L-WL-LS-E-G-L-KNA---PH-NLN--SIIY---G----QVV---G
Sequence 2 FPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNG

Sequence 1 NRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGR
           -RVFDGE--EG--L-VPQNF-V--R-----FE--SFKTND--M---LAG-
Sequence 2 ERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGA

Sequence 1 TSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           -S-L---PEEV----F------AR-IK-NN----L-----S-------
Sequence 2 NSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVA-



Alignment 27
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 46.83 (214/457)
Sequence 1 --------LSVCFLILFHGCLASRQEWQ-----------QQ--DECQIDR
           ---------S-C---L---C-A----W------------QQ----C---R
Sequence 2 MSTKLILSFSLCLMVL--SCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQR

Sequence 1 LDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYS
           L-A-EP--RV--EAG--E-WD-----FRCAG---VR--IQP-GLLLP-YS
Sequence 2 LTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYS

Sequence 1 NAPQLIYVVQGEGMTGISYPGCPETYQA------PQQGR-----------
           NAP----V-QG-G--G---PGCPET-Q-------PQ--R-----------
Sequence 2 NAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 SSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGD

Sequence 1 ---QQGQSGRFQ--DRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTV
           ----Q--S--F---D-HQKI-R-R-GD-I--PAGV--W--N-G-------
Sequence 2 QRTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISI

Sequence 1 TLLDVSNSQNQLDRTPRKFHLAGNPK----DVFQQQQ------QHQSRGR
           TL-D----QNQLD---R-F-LAG--K----D---Q-Q--------QSR--
Sequence 2 TLYDANSFQNQLDGNVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRES

Sequence 1 ---------NLFSGFDTELLAEAFQ-VDERLIKQLKSE-DNRGGIVKVKD
           ---------N---GF--E-L-E-F--VD---I--L----D-RG-IV---D
Sequence 2 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQARD

Sequence 1 DELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKENI
           --LRV--P-----E---E---E--D-KR----R-NG-E---C----K-N-
Sequence 2 LKLRV--PE----EYEEELQRERGDRKRGGSGRSNGLEQAFCNLKFKQNV

Sequence 1 NDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWN
           N-P-RAD---P--GR--T-NS-NLPIL---QLS----VLYKNA---P-WN
Sequence 2 NRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVLYKNAILGPRWN

Sequence 1 LNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAR
           LN-HS--Y---G-G-VQVV---G--VFD--V--GQ-LVVPQ-FAVV--A-
Sequence 2 LNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAG

Sequence 1 EERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIK
           -E--EW---K--D-A-TSP-AG-TSVL---P-EVLAN---IS---A---K
Sequence 2 REGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLK

Sequence 1 FNNQQTTLTSGESSHHMRDDA--
           ---Q---------S---------
Sequence 2 NGRQEVEVFLPFQSRDEKERERF



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 53.39 (244/457)
Sequence 1 LSVCFLILFHGCLASRQE-WQQQDECQIDRLDALEPDNRVEYEAGTVEAW
           ---C-L-LF-GCLASRQ----Q--E-Q---L-A-EPDN----EAG--E-W
Sequence 2 ---CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESW

Sequence 1 DPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYP
           -P---QF--AGVA-VR-TI-PNGL-LP-Y-NAPQLIY-V-G-G--G---P
Sequence 2 NPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFP

Sequence 1 GCPETYQ--APQQGRQQGQSGRF-------------------QDRHQKIR
           GC-ET-----PQQ--QQ-Q---F-------------------QDRHQKIR
Sequence 2 GCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIR

Sequence 1 RFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHL
           --R-GDIIA-PAGVA-W-YN-G--P-V-V-LLD--N-QNQLD--PR-F-L
Sequence 2 HIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYL

Sequence 1 AGNPKDVF-------QQQQQHQSR---GRNLFSGFDTELLAEAFQVDERL
           AGNP-D-F-------QQQQQ-Q-----G-N-FSGFDT-LLA-A--V----
Sequence 2 AGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQALNVNPET

Sequence 1 IKQLKSED-NRGGIVKVKDDELRVIRP-SRSQSERGSE--------SEEE
           ---L---D-NR--IV-V----L----P-SRS---RG----------S--E
Sequence 2 ARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGRGDQERQQEEQQSQRE

Sequence 1 SEDEKRRW-----GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLT
           -E---R-------G--DNG-EET-C--RL--NI-DP-RAD-Y-P--GR--
Sequence 2 REEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRIS

Sequence 1 TLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQ
           --N---LPIL--L-LS-EKGVLY-NA---PHW--N-----Y---G---VQ
Sequence 2 VVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQ

Sequence 1 VVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFEWISFKTNDRAMT
           VV---G----D-EVREGQ----PQN-AV---A--E-FE-ISF-T-----T
Sequence 2 VVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFT

Sequence 1 SPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHM
           --LAGRTSVL---P-EVL-NAF-ISR--AR--K-N-Q---L-S--S----
Sequence 2 NTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRG

Sequence 1 RDDA----
           R-------
Sequence 2 RLMSILGY



Alignment 29
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 47.70 (218/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           ---------------RQ-------CQ--RL-A--PDNR-E-E-G--E-W-
Sequence 2 ---------------RQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWN

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           PN---F-CAGVAL-R-----N-L--P-YSNAPQ-I---QG-G--G---PG
Sequence 2 PNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPG

Sequence 1 CPETYQAPQ-QGRQ----------QG--QSGRFQDRHQKIRRFRRGDIIA
           CP--Y--P--QGR-----------QG--QS----D-HQK--RF--GD-IA
Sequence 2 CPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIA

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF-
           -P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-F-LAGN----F-
Sequence 2 VPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFL

Sequence 1 -QQQQQHQSR----------------------------------------
           --QQQ--QSR----------------------------------------
Sequence 2 RYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEEN

Sequence 1 -GRNLFSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELR
           -G-N-FSGF--E-L--AFQVD-R-----L--E------G-IV-V----LR
Sequence 2 EGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LR

Sequence 1 VIRPSRS----QSERGSESEEESEDEKRRWGQ----RDNGIEETICTMRL
           ---P-R-------E---E-E-E---E-RR-G-----R-NGIEETICT---
Sequence 2 ILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASA

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           K-NI------DIY-P--G-L-T-N-LNL-IL-WL--S-E-G-LY-NAL--
Sequence 2 KKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFV

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           -H-N-N-HSIIY---G---VQVVD--GNRV-D-E--EG--LVVPQNFAV-
Sequence 2 AHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVA

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           -----E-FE---FKT--R-----LAG--SV----PEEV-AN-----RE-A
Sequence 2 GKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQA

Sequence 1 RKIKFNNQQTTLTSGESSHHMRDDA
           R--K-NN------------------
Sequence 2 RQLKNNNPFKFFVPPSQQSPRAVA-



Alignment 30
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 47.70 (218/457)
Sequence 1 LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAGTVEAWD
           ---------------RQ-------CQ--RL-A--PDNR-E-E-G--E-W-
Sequence 2 ------------ISFRQQ-PEENACQFQRLNAQRPDNRIESEGGYIETWN

Sequence 1 PNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPG
           PN---F-CAGVAL-R-----N-L--P-YSNAPQ-I---QG-G--G---PG
Sequence 2 PNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPG

Sequence 1 CPETYQAPQ-QGRQ----------QG--QSGRFQDRHQKIRRFRRGDIIA
           CP--Y--P--QGR-----------QG--QS----D-HQK--RF--GD-IA
Sequence 2 CPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRFDEGDLIA

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF-
           -P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-F-LAGN----F-
Sequence 2 VPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQEFL

Sequence 1 -QQQQQHQSR----------------------------------------
           --QQQ--QSR----------------------------------------
Sequence 2 RYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEEN

Sequence 1 -GRNLFSGFDTELLAEAFQVDER-LIKQLKSE---DNRGGIVKVKDDELR
           -G-N-FSGF--E-L--AFQVD-R-----L--E------G-IV-V----LR
Sequence 2 EGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGG-LR

Sequence 1 VIRPSRS----QSERGSESEEESEDEKRRWGQ----RDNGIEETICTMRL
           ---P-R-------E---E-E-E---E-RR-G-----R-NGIEETICT---
Sequence 2 ILSPDRKRRADEEEEYDEDEYEYDEEDRRRGRGSRGRGNGIEETICTASA

Sequence 1 KENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVL
           K-NI------DIY-P--G-L-T-N-LNL-IL-WL--S-E-G-LY-NAL--
Sequence 2 KKNIGRNRSPDIYNPQAGSLKTANDLNLLILRWLGPSAEYGNLYRNALFV

Sequence 1 PHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVV
           -H-N-N-HSIIY---G---VQVVD--GNRV-D-E--EG--LVVPQNFAV-
Sequence 2 AHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVA

Sequence 1 KRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDA
           -----E-FE---FKT--R-----LAG--SV----PEEV-AN-----RE-A
Sequence 2 GKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANSYGLQREQA

Sequence 1 RKIKFNNQQTTLTSGESSHHMRDDA
           R--K-NN------------------
Sequence 2 RQLKNNNPFKFFVPPSQQSPRAVA-



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 47.92 (219/457)
Sequence 1 ---------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEY
           ----------S-C-L-L---C-A---------ECQ---L-ALEPD-RVE-
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISS--SKLNECQLNNLNALEPDHRVES

Sequence 1 EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGE
           E-G----W---H----CAGV-----T---NGL-LP-YS--P--I---QG-
Sequence 2 EGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGK

Sequence 1 GMTGISYPGCPETYQAPQ-QGRQQG---QSGRFQDRHQKIRRFRRGDIIA
           G--G---PGCPET---PQ-Q----G---Q----QD-HQKIR-F--GD---
Sequence 2 GALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLV

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK----
           IP-GV--W-YN-G--PVV---LLD-SN--NQLD-TPR-F-LAGNP-----
Sequence 2 IPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYP

Sequence 1 DVFQQQQQHQSRG-R--------------NLFSGFDTELLAEAFQVDERL
           ---QQQQQ--S-G-R-----------------SGF----LA--F---E--
Sequence 2 ETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDI

Sequence 1 IKQLKS-EDNRGGIVKVK----------------------DDELRVI---
           ---L-S--D-R--IV-V-----------------------DDE---I---
Sequence 2 AEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSH

Sequence 1 -----------------------RPSR-SQSER-----GSESEEESEDEK
           -----------------------RPSR-SQ--R-------E-E-E-ED--
Sequence 2 PPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQP

Sequence 1 RR---WGQRD-------------------NGIEETICTMRLKENINDPAR
           R----W-----------------------NG-EE-ICT--L-ENI--P-R
Sequence 2 RKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSR

Sequence 1 ADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHS
           AD-Y-P--GR--TLNSL-LP-L---QLS----VLYKN----PHWNLN--S
Sequence 2 ADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANS

Sequence 1 IIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFE
           -IY---G-G-V-VV---GN-VFDGE-R-GQ-LVVPQNF-V---A-E--FE
Sequence 2 VIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFE

Sequence 1 WISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ
           -I-FKT---A-TS-L-----V----P-EVLA-------------K-----
Sequence 2 YIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEGNW

Sequence 1 TTLTSGESSHHMRDDA--
           --L---ES----------
Sequence 2 GPLVNPESQQGSPRVKVA



Alignment 32
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 46.83 (214/457)
Sequence 1 --------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYE
           -----------CFL-L-------RQ-------CQ--RL-A--PDNR-E-E
Sequence 2 MAKLLELSFCFCFLVLGASSISFRQQ-PEENACQFQRLNAQRPDNRIESE

Sequence 1 AGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGEG
           -G--E-W-PN---F-CAGVAL-R-----N-L--P-YSNAPQ-I---QG-G
Sequence 2 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG

Sequence 1 MTGISYPGCPETYQAP-QQGR------------QQGQSGRFQDRHQKIRR
           --G---PGCP-TY--P-QQGR---------------QS---QD-HQK--R
Sequence 2 YFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR

Sequence 1 FRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLA
           F--GD-IA-P-GVA-W-YN-----VV-V-L-D--N--NQLD--PR-F-LA
Sequence 2 FNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA

Sequence 1 GNPKDVF--QQQQQHQSR--------------------------------
           GN----F---QQQ--QSR--------------------------------
Sequence 2 GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRE

Sequence 1 ---------GRNLFSGFDTELLAEAFQVDER-LIKQLKSED---NRGGIV
           ---------G-N-FSGF--E-L--AFQVD-R-----L--E------G-IV
Sequence 2 RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV

Sequence 1 KVKDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRD-----------N
           -V----LR---P------RG---EEE-----------D-----------N
Sequence 2 TVRGG-LRILSPDGT---RGADEEEEYDEDQYEYHEQDGRRGRGSRGGGN

Sequence 1 GIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVE
           GIEETICT---K-NI-------IY-P----------LNL-IL-WL-LS-E
Sequence 2 GIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAE

Sequence 1 KGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQ
           -G-LY-NAL--PH-N-N-HSIIY---G---VQVVD--GNRV-D-E--EG-
Sequence 2 YGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVDSNGNRVYDEELQEGH

Sequence 1 MLVVPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVL
           -LVVPQNFAV------E-FE---FKT--R------AG--S-----PEEV-
Sequence 2 VLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANFAGENSFIDNLPEEVV

Sequence 1 ANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           AN-----RE-AR--K-NN------------------
Sequence 2 ANSYGLPREQARQLKNNNPFKFFVPPFQQSPRAVA-



Alignment 33
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 46.17 (211/457)
Sequence 1 ----------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVE
           -----------S-C-L-L---C-A---------ECQ---L-ALEPD-RVE
Sequence 2 MGKPFFTLSLSSLCLLLLSSACFAITS--SKFNECQLNNLNALEPDHRVE

Sequence 1 YEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQG
           -E-G--E-W---H----CAGV-----T---NGL-LP-YS--PQ-I-VVQG
Sequence 2 SEGGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQG

Sequence 1 EGMTGISYPGCPETYQAPQQ--GRQQGQSGR-FQDRHQKIRRFRRGDIIA
           -G--G---PGCPET---PQQ---R----S----QD-HQKIR-F--GD---
Sequence 2 KGAIGFAFPGCPETFEKPQQQSSRRGSRSQQQLQDSHQKIRHFNEGDVLV

Sequence 1 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK----
           IP-GV--W-YN-G--PVV---LLD-SN--NQLD--PR-F-LAGNP-----
Sequence 2 IPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHP

Sequence 1 DVFQQQQQHQSRGR--------------NLFSGFDTELLAEAFQVDERLI
           ---QQQQQ--S-G------------------SGF----LA--F---E---
Sequence 2 ETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQSFNTNEDTA

Sequence 1 KQLKS-EDNRGGIVKVK--------------------DDELRVI------
           --L-S--D-R--IV-V---------------------D-E----------
Sequence 2 EKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPR

Sequence 1 RPSRSQSERGSESEEESEDEKR------------------RWGQRDNGIE
           RPS----E---E-E-E-ED--R------------------R--Q--NG-E
Sequence 2 RPSHGKHE-DDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVE

Sequence 1 ETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGV
           E-ICTM-L-ENI--P-RAD-Y-P--GR--TLNSL-LP-L----LS----V
Sequence 2 ENICTMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVV

Sequence 1 LYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLV
           LY-N----PHWNLN--S-IY---GKG-V-VV---GN-VFDGE-R-GQ-LV
Sequence 2 LYRNGIYSPHWNLNANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLV

Sequence 1 VPQNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANA
           VPQNF-V-----E---E---FKT---A--S-------V----P-EVL-N-
Sequence 2 VPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK---DVFRAIPSEVLSNS

Sequence 1 FQISREDARKIKFNNQQTTLTSGESSHHMRDDA
           --------R--K-------L-------------
Sequence 2 YNLGQSQVRQLKYQGNSGPLVNP----------



Alignment 34
Sequence 1:
Sequence 2: Allergen Coc n 1.0101, Sequence: A0A0S3B0K0
Sequence identity: 22.54 (103/457)
Sequence 1 --------------------------LSVCFLILFHGCLASRQEWQQQDE
           ------------------------------------G------E------
Sequence 2 MVSAMGDRTASAILALLLLSSWSLMVVMAYQGRGMEGREKRVEEKAPRSP

Sequence 1 CQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLL
           ------------------AG-V--------------------T--PN-L-
Sequence 2 EDRGLFILRRSKEVLKTDAGEVRLMMGYRYRGNHSPMHIGFITMEPNTLY

Sequence 1 LPQYSNAPQLIYVVQGEGMTGISYPGCPETYQAPQQGRQQGQSGRFQDRH
           -PQY--A-----V--GE---G--Y--------------------------
Sequence 2 IPQYIDASLILFVRRGEAKVGYIY------------------KNKLVEK-

Sequence 1 QKIRRFRRGDIIAIPAGVAHWCYNEGNSPVV-TVTLLDVSNSQNQLDRTP
           ----R---G---AIPAG------N---S---------D---S-------P
Sequence 2 ----RLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYP

Sequence 1 RKFHLAGNPKDVFQQQQQHQSRGRNLFSGFDTELLAEAFQVDERLIKQLK
           --F---G----V-----------R---SGFD---L--AF-V---------
Sequence 2 QSFYVGGG---VLP---------RSVLSGFDASTLSAAFNVSSDQLEMIL

Sequence 1 SEDNRGGIVKV------KDDELRVIRPSR----SQSERGSESEEESEDEK
           -----G-I-----------D-L--I-----------E--S----E-E-E-
Sequence 2 NSQRGGPIIRLNGEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEE

Sequence 1 RR-WGQR---DNGIEETICTMRLKENI-NDPARADIYTPE------VGRL
           ---W--R-----------C----K------P-----Y--E-------G--
Sequence 2 DDVWTWRCLLKSLLGKGDCRVQRKHKLAHSPGSYNLYDTEPSYQNDYGYS

Sequence 1 TTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHSIIYGC--KGKG
           ----------LK---L-V----L---A---PH---N-----YG----G-G
Sequence 2 IAIDGHDYSALKHSNLGVYLVNLKAGAMLSPH--VNPTATEYGIILRGSG

Sequence 1 QVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRARE-ERFEWISFKTND
           --QVV---G-------V-EG-----P--F-----A------E---F-T--
Sequence 2 TIQVVFPNGTAAMNAKVSEGDVFWIPRYFPFCQIASDGAPLEFFGFTTSA

Sequence 1 RAMTSP--LAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSG
           R----P--L-G--S-L--M----LA-AF--S-E----I----Q-------
Sequence 2 RK-NRPQFLVGKSSLLHSMRGPELAAAFGVSEEQLERI-VKAQREAVILP

Sequence 1 ESSHHMRDDA-------------------
           -S-H-------------------------
Sequence 2 TSPHREMEEINGKKWKGEEVLVMKRGLFA



Alignment 35
Sequence 1:
Sequence 2: Allergen Jug r 2, Sequence: AAF18269
Sequence identity: 20.79 (95/457)
Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RGRDDDDEENPRDPREQYRQCQEYCRRQGQGQRQQQQCQIRCEERLEEDQ

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 RSQEERERRRGRDVDDQNPRDPEQRYEQCQQQCERQRRGQEQTLCRRRCE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QRRQQEERERQRGRDRQDPQQQYHRCQRRCQIQEQSPERQRQCQQRCERQ

Sequence 1 ------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEYEAG
           ---------------------R-E-QQ----------------R-E-E-G
Sequence 2 YKEQQGRERGPEASPRRESRGREEEQQRHNPYYFHSQSIR--SRHESEEG

Sequence 1 TV---EAWDPNHEQFRCAGVALVRHTI---QPNGLLLPQYSNAPQLIYVV
           -V---E------E--R--G----R--I----PN---LP----A-----V-
Sequence 2 EVKYLERFTERTELLR--GIENYRVVILDANPNTSMLPHHKDAESVAVVT

Sequence 1 QGEG-MTGISYPGCPETYQAPQQGRQQGQSGRFQDRHQKIRRFRRGDIIA
           -G----T--S-----------Q--R-------F------------GD-I-
Sequence 2 RGRATLTLVS-----------QETRES-----FN--------LECGDVIR

Sequence 1 IPAGVAHWCYNE-GNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPKDVF
           -PAG------N---N-----V-LL---N---Q-----R----AG------
Sequence 2 VPAGATVYVINQDSNERLEMVKLLQPVNNPGQF----REYYAAGA-----

Sequence 1 QQQQQHQSRGRNLFSGFDTELLAEAFQVD-ERLIKQLKSEDNRGG-IVKV
           ------QS--R-----F----L--A------RL---------R-G-I---
Sequence 2 --KSPDQSYLRV----FSNDILVAALNTPRDRLERFFDQQEQREGVIIRA

Sequence 1 KDDELRVIRPSRSQSERGSESEEESEDEKRRWGQRDNGIEETICTMRLKE
           ----LR--------------S--------R-WG-R--G---------LK-
Sequence 2 SQEKLRAL------------SQHAMSAGQRPWGRRSSG-----GPISLKS

Sequence 1 NINDPARADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPH
           ----P-----Y----G------------L------V--------A---PH
Sequence 2 E--SPS----YSNQFGQFFEACPEEHRQLQEMDVLVNYAEIKRGAMMVPH

Sequence 1 WNLNSHSIIYGCKGKGQVQVV-DNFGNRVFDGEVRE--------------
           -N-------Y---G-G---------------G--R---------------
Sequence 2 YNSKATVVVYVVEGTGRYEMACPHVSSQSYEGQGRREQEEEESTGRFQKV

Sequence 1 ------GQMLVVPQNFAV-VKRAREERFEWISFKTN-DRAMTSPLAGRTS
           ------G---V-P------------E------F--N--------LAG---
Sequence 2 TARLARGDIFVIPAGHPIAITASQNENLRLLGFDINGENNQRDFLAGQNN

Sequence 1 VLGGMPEEVLANAFQISREDARKIKFNNQQTTLTSGESSHHMRDDA----
           -------E-----F---RE----I-F--Q-------------R-------
Sequence 2 IINQLEREAKELSFNMPREEIEEI-FESQMESYFVPTERQSRRGQGRDHP

Sequence 1 ----------
           ----------
Sequence 2 LASILDFAFF


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.