The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Art v 1

Sequence 27818334

Full FASTA alignment

Sequence name:
Query sequence:
MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Art v 1.0101AF493943Go!132157.79.6e-41
2Art ar 1.0101ANC85008Go!132155.64.1e-40
3Art la 1.0101ANC85013Go!132155.64.1e-40
4Art si 1.0102ANC85016Go!132154.68.5e-40
5Art ar 1.0102ANC85009Go!132154.11.2e-39
6Art la 1.0102ANC85014Go!132154.11.2e-39
7Art si 1.0101ANC85015Go!132153.71.6e-39
8Art gm 1.0101ANC85011Go!132153.51.8e-39
9Art ca 1.0101ANC85010Go!132153.12.4e-39
10Art an 1.0102ANC85006Go!132152.92.7e-39
11Art l 1.0101AHF71025Go!108131.94.5e-33
12Art c 1.0101AHF71023Go!108131.08.4e-33
13Art ab 1.0101AHF71021Go!108130.71.0e-32
14Art t 1.0101AHF71026Go!108130.31.4e-32
15Art f 1.0101AHF71024Go!108130.31.4e-32
16Par h 1.0101A0A0X9C7K4Go!15680.71.7e-17
17Amb a 4.0101CBK52317Go!16479.93.3e-17
18Api g 7.0101QUJ17885Go!9348.35.8e-08
19Aes h 1.0101Q7M1F3Go!5044.83.7e-07
20Ara h 12XP_015936675Go!7130.78.7e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Art v 1.0101, Sequence: AF493943
Sequence identity: 100.00 (132/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Sequence 2 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH



Alignment 2
Sequence 1:
Sequence 2: Allergen Art ar 1.0101, Sequence: ANC85008
Sequence identity: 97.73 (129/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           PSPPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 3
Sequence 1:
Sequence 2: Allergen Art la 1.0101, Sequence: ANC85013
Sequence identity: 97.73 (129/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           PSPPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 4
Sequence 1:
Sequence 2: Allergen Art si 1.0102, Sequence: ANC85016
Sequence identity: 96.21 (127/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIF--AIGE-EAAGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           PSPPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 5
Sequence 1:
Sequence 2: Allergen Art ar 1.0102, Sequence: ANC85009
Sequence identity: 96.21 (127/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGA-PPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 6
Sequence 1:
Sequence 2: Allergen Art la 1.0102, Sequence: ANC85014
Sequence identity: 96.21 (127/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGA-PPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 7
Sequence 1:
Sequence 2: Allergen Art si 1.0101, Sequence: ANC85015
Sequence identity: 96.21 (127/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           PSPPADGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PSPPADGGSPPPPADGGSPPADGGSPPPPSGH



Alignment 8
Sequence 1:
Sequence 2: Allergen Art gm 1.0101, Sequence: ANC85011
Sequence identity: 95.45 (126/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIF--AIGE-EAAGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFLLAIGEIEAAGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPA-GGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPATGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 9
Sequence 1:
Sequence 2: Allergen Art ca 1.0101, Sequence: ANC85010
Sequence identity: 95.45 (126/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIFI-AIGE-EAAGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFILAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 10
Sequence 1:
Sequence 2: Allergen Art an 1.0102, Sequence: ANC85006
Sequence identity: 94.70 (125/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           MAKCSYVFCAVLLIF--AIGE-EAAGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 MAKCSYVFCAVLLIFVLAIGEIEAAGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 11
Sequence 1:
Sequence 2: Allergen Art l 1.0101, Sequence: AHF71025
Sequence identity: 79.55 (105/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKTYSGKCDNKKCDKKC
Sequence 2 ------------------------AGSKLCEKTSKTYSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PP-DGGSPPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PPPPTDGGSPPPPADGGSPPADGGSPPPPSTH



Alignment 12
Sequence 1:
Sequence 2: Allergen Art c 1.0101, Sequence: AHF71023
Sequence identity: 78.79 (104/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PPPPADGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 13
Sequence 1:
Sequence 2: Allergen Art ab 1.0101, Sequence: AHF71021
Sequence identity: 78.03 (103/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGA-PPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGASPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PPADGG-PPPPADGGSPP-DGGSPPPPSTH
Sequence 2 PPPPADGGTPPPPADGGSPPADGGSPPPPSTH



Alignment 14
Sequence 1:
Sequence 2: Allergen Art t 1.0101, Sequence: AHF71026
Sequence identity: 78.03 (103/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PP-DGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 15
Sequence 1:
Sequence 2: Allergen Art f 1.0101, Sequence: AHF71024
Sequence identity: 78.03 (103/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNKKCDKKC
           ------------------------AGSKLCEKTSKT-SGKCDNKKCDKKC
Sequence 2 ------------------------AGSKLCEKTSKTWSGKCDNKKCDKKC

Sequence 1 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
           IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS
Sequence 2 IEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGS

Sequence 1 PSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           P-PP-DGGSPPPPADGGSPP-DGGSPPPPS-H
Sequence 2 PPPPTDGGSPPPPADGGSPPADGGSPPPPSAH



Alignment 16
Sequence 1:
Sequence 2: Allergen Par h 1.0101, Sequence: A0A0X9C7K4
Sequence identity: 50.00 (66/132)
Sequence 1 MAKCSYVFCA-VLLIFIVAIGEMEAAGSKLCEKTSKTYSGKC-DNKKCDK
           MAK-S-------LL---VAI-E------K-CEK-SKT--G-C-D--KCDK
Sequence 2 MAKSSTSYLVFLLLVLVVAISEIASVNGKVCEKPSKTWFGNCKDTEKCDK

Sequence 1 KCIEWEKAQHGACHKREAGKESCFCYFDC----SKSPPGATPAPPGAAPP
           -C-EWE-A-HGACH-RE--K--CFCYFDC-------PP---P--PG--P-
Sequence 2 RCMEWEGAKHGACHQRES-KYMCFCYFDCDPKKNPGPPPGAPGTPGTPPA

Sequence 1 PAAGGSPSPPADGGSPPPPA--DGGSPPVDGGSPPPPSTH----------
           P--GG----P--GG-PPP-----GG-----GG--PPP-------------
Sequence 2 PPGGGEGDAPPGGGAPPPAGGEGGGGGGEGGGGAPPPAGGEGGGGGGDGG

Sequence 1 -------
           -------
Sequence 2 GGAPPAA



Alignment 17
Sequence 1:
Sequence 2: Allergen Amb a 4.0101, Sequence: CBK52317
Sequence identity: 51.52 (68/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKCDNK---KCD
           ---------A-LL-F--AI-E------KLCEK-S-T-SGKC--K---KCD
Sequence 2 -------MAAGLLVFVLAISEIASVKGKLCEKPSVTWSGKCKVKQTDKCD

Sequence 1 KKCIEWEKAQHGACHKREAGKESCFCYFDCSKSP-PGATP-APPGAAP--
           K-CIEWE-A-HGACHKR---K--CFCYFDC-----PG--P-AP-G-AP--
Sequence 2 KRCIEWEGAKHGACHKRDS-KATCFCYFDCDPTKNPGPPPGAPKGKAPAP

Sequence 1 -PPAAGGSPSPPA-DGGSPPPPADGGSPPVDGGSPPPPSTH---------
           -PP--GG-P-P----GG--PPP--GG----DGG-----------------
Sequence 2 SPPSGGGAPPPSGGEGGDGPPPPEGGEGGGDGGGEGGGEGGGDGGGEGGG

Sequence 1 ----------------------
           ----------------------
Sequence 2 EGGGDGGGDGGGEGGGEGGGER



Alignment 18
Sequence 1:
Sequence 2: Allergen Api g 7.0101, Sequence: QUJ17885
Sequence identity: 31.82 (42/132)
Sequence 1 --MAKCSYVFCAVLLIFIVA---IGEMEAAGSK----------LCEKTSK
           ------S----A--L-F-VA----G----A-------------LCEK-S-
Sequence 2 MAPKASSLTLSAIFLLFLVASYSVGVAQGARAATEGEVVYPEALCEKPSQ

Sequence 1 TYSGKCDN-KKCDKKCIEWEKAQHGACHKREAGKESCFCYFD-CSKSPPG
           T--GKC-N-K-CD--CI-WE-A-HGACHKR--GK--CFCYFD-C------
Sequence 2 TWTGKCGNTKNCDNQCIQWETARHGACHKR-GGKWMCFCYFDRC------

Sequence 1 ATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           -------------------------------------------------
Sequence 2 -------------------------------------------------



Alignment 19
Sequence 1:
Sequence 2: Allergen Aes h 1.0101, Sequence: Q7M1F3
Sequence identity: 23.48 (31/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLC-EKTSKTYSGKCDNK-KCDK
           ----------------------------LC-E--S-T-SG-C-N---CDK
Sequence 2 ----------------------------LCNERPSQTWSGNCGNTAHCDK

Sequence 1 KCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAG
           -C--WEKA-HGACHKRE-----CFCYF-C---------------------
Sequence 2 QCQDWEKASHGACHKRE-NHWKCFCYFNC---------------------

Sequence 1 GSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           ----------------------------------
Sequence 2 ----------------------------------



Alignment 20
Sequence 1:
Sequence 2: Allergen Ara h 12, Sequence: XP_015936675
Sequence identity: 17.42 (23/132)
Sequence 1 MAKCSYVFCAVLLIFIVAIGEMEAAGSKLCEKTSKTYSGKC-DNKKCDKK
           --K----FC---L----A---------KLC-----TY-G-C--N--CD--
Sequence 2 --KTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDH

Sequence 1 CIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGG
           C---E----G-C-K-------C-C---C----------------------
Sequence 2 CKNKEHFVSGTCMKM-----ACWCAHNC----------------------

Sequence 1 SPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
           ---------------------------------
Sequence 2 ---------------------------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.