The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Der f 2

Sequence 217304

Full FASTA alignment

Sequence name:
Query sequence:
SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Der f 2BAA01239Go!138214.48.8e-58
2Der f 2Q00855Go!146213.61.7e-57
3Der f 2BAA01241Go!138210.21.7e-56
4Der p 2.0114CAK22338Go!146197.51.2e-52
5Der f 2.0109ABA39438Go!129195.73.7e-52
6Der p 2P49278Go!146194.11.2e-51
7Der f 2AAK30133Go!170190.12.2e-50
8Der p 2.0115CAQ68249Go!129187.21.3e-49
9Der p 2.0109ABA39437Go!129187.21.3e-49
10Eur m 2Q9TZZ2Go!145186.52.3e-49
11Eur m 2.0102AAC82350Go!135183.41.9e-48
12Lep d 2P80384Go!14199.05.1e-23
13Lep d 2.0102CAD32313Go!14197.91.1e-22
14Tyr p 2O02380Go!14197.71.3e-22
15Gly d 2.0201CAB76459Go!12597.41.3e-22
16Der f 35.0101BAX34757Go!14397.41.5e-22
17Lep d 2.0202CAD32314Go!14197.02.0e-22
18Blo t 2.0104A6XEN8Go!14297.02.0e-22
19Blo t 2.0104A6XEN9Go!14297.02.0e-22
20Lep d 2.0201CAA58755Go!14195.94.4e-22
21Blo t 2.0104A6XEP1Go!14295.46.1e-22
22Blo t 2.0104A6XEP2Go!14295.46.1e-22
23Blo t 2.0104A6XEP6Go!14295.46.1e-22
24Blo t 2.0104A6XEP3Go!14295.27.1e-22
25Blo t 2.0104A6XEP5Go!14294.51.1e-21
26Blo t 2.0104A6XEP4Go!14293.91.8e-21
27Blo t 2.0104A6XEP0Go!14293.22.8e-21
28Blo t 2.0102AAQ73482Go!14292.35.3e-21
29Blo t 2.0101AAQ73483Go!14492.16.2e-21
30Gly d 2.0101CAB59976Go!12889.63.1e-20
31Blo t 2.0103AAQ73481Go!14184.71.0e-18
32Lep d 2.0101CAA57160Go!9877.51.1e-16
33Der f 22.0101ABG76195Go!15567.81.4e-13
34Can f 7.0101Q28895Go!14947.02.4e-07

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Der f 2, Sequence: BAA01239
Sequence identity: 100.00 (138/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
Sequence 2 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
Sequence 2 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sequence 2 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD



Alignment 2
Sequence 1:
Sequence 2: Allergen Der f 2, Sequence: Q00855
Sequence identity: 99.28 (137/138)
Sequence 1 --------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK
           --------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK
Sequence 2 MISKILCLSLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK

Sequence 1 PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKG
           PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHF-KCPLVKG
Sequence 2 PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKG

Sequence 1 QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Sequence 2 QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD



Alignment 3
Sequence 1:
Sequence 2: Allergen Der f 2, Sequence: BAA01241
Sequence identity: 97.10 (134/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
Sequence 2 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHF-KCPLVKGQQYD-KYT
Sequence 2 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDAKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVPKIAPKSENVVVTVKL-GDNGVLACAIATH-KIRD
Sequence 2 WNVPKIAPKSENVVVTVKLVGDNGVLACAIATHAKIRD



Alignment 4
Sequence 1:
Sequence 2: Allergen Der p 2.0114, Sequence: CAK22338
Sequence identity: 89.13 (123/138)
Sequence 1 --------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK
           --------SLLVAAV-ADQVDVKDCAN-EIKKV-V-GCHGS-PCIIHRGK
Sequence 2 MMYKILCLSLLVAAVAADQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGK

Sequence 1 PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKG
           PF-LEALF-ANQNTK-AKIEIKAS-DGLE-DVPGID-NACH-VKCPLVKG
Sequence 2 PFQLEALFEANQNTKNAKIEIKASIDGLEVDVPGIDPNACHYVKCPLVKG

Sequence 1 QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           QQYDIKYTWNVPKIAPKSENVVVTVK--GDNGVLACAIATH-KIRD
Sequence 2 QQYDIKYTWNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIRD



Alignment 5
Sequence 1:
Sequence 2: Allergen Der f 2.0109, Sequence: ABA39438
Sequence identity: 89.13 (123/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           ---------DQVDVKDCANNEIKKVMVDG-HGSDPCIIHRGKPFTLEALF
Sequence 2 ---------DQVDVKDCANNEIKKVMVDGRHGSDPCIIHRGKPFTLEALF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           DANQNTKTAKIEIKA---GLE-DVPGIDTNACHFVKCPLVKGQQYDIKYT
Sequence 2 DANQNTKTAKIEIKANINGLEVDVPGIDTNACHFVKCPLVKGQQYDIKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVPKIAPKSENVVVTVKLIGDNGVLACAIATH-KIRD
Sequence 2 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHAKIRD



Alignment 6
Sequence 1:
Sequence 2: Allergen Der p 2, Sequence: P49278
Sequence identity: 86.96 (120/138)
Sequence 1 --------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK
           --------SLLVAAV--DQVDVKDCAN-EIKKV-V-GCHGS-PCIIHRGK
Sequence 2 MMYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGK

Sequence 1 PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKG
           PF-LEA-F-ANQNTKTAKIEIKAS-DGLE-DVPGID-NACH--KCPLVKG
Sequence 2 PFQLEAVFEANQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKG

Sequence 1 QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           QQYDIKYTWNVPKIAPKSENVVVTVK--GD-GVLACAIATH-KIRD
Sequence 2 QQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACAIATHAKIRD



Alignment 7
Sequence 1:
Sequence 2: Allergen Der f 2, Sequence: AAK30133
Sequence identity: 99.28 (137/138)
Sequence 1 ---SLLVAAVVADQVDVKDC-----------------------------A
           ---SLLVAAVVADQVDVKDC-----------------------------A
Sequence 2 LCLSLLVAAVVADQVDVKDCGKFVCVIHFFSFHLFNTKHNFLFLVYIHIA

Sequence 1 NNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLD
           NNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLD
Sequence 2 NNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLD

Sequence 1 GLEIDVPGIDTNACHFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK
           GLEIDVPGIDTNACHF-KCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK
Sequence 2 GLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVK

Sequence 1 LIGDNGVLACAIATHGKIRD
           LIGDNGVLACAIATHGKIRD
Sequence 2 LIGDNGVLACAIATHGKIRD



Alignment 8
Sequence 1:
Sequence 2: Allergen Der p 2.0115, Sequence: CAQ68249
Sequence identity: 81.88 (113/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           ---------DQVDVKDCAN-EIKKV-V-GCHGS-PCIIHRGKPF-LEA-F
Sequence 2 ---------DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           -ANQN-KTAKIEIKAS-DGLE-DVPGID-NACH--KCPLVKGQQYDIKYT
Sequence 2 EANQNSKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVPKIAPKSENVVVTVK--GDNGVLACAIATH-KIRD
Sequence 2 WNVPKIAPKSENVVVTVKVMGDNGVLACAIATHAKIRD



Alignment 9
Sequence 1:
Sequence 2: Allergen Der p 2.0109, Sequence: ABA39437
Sequence identity: 81.88 (113/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           ---------DQVDVKDCAN-EIKKV-V-GCHGS-PCIIHRGKPF-LEA-F
Sequence 2 ---------DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           -ANQN-KTAKIEIKAS-DGLE-DVPGID-NACH--KCPLVKGQQYDIKYT
Sequence 2 EANQNSKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVPKIAPKSENVVVTVK--GDNGVLACAIATH-KIRD
Sequence 2 WNVPKIAPKSENVVVTVKVLGDNGVLACAIATHAKIRD



Alignment 10
Sequence 1:
Sequence 2: Allergen Eur m 2, Sequence: Q9TZZ2
Sequence identity: 82.61 (114/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           -------SLLVAAV-ADQVD-KDCAN-EIKKVMV-GC-GS-PC-IHRG--
Sequence 2 MYKILCLSLLVAAVAADQVDIKDCANHEIKKVMVPGCKGSEPCVIHRGTA

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           F-LEA-FDANQN---AKIEIKA--DG-EIDVPGID-N-CHF-KCPLVKGQ
Sequence 2 FQLEAVFDANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -YDIKYTWNVP-IAPKSENVVVTVKL-GDNGVLACAIATH-KIRD
Sequence 2 EYDIKYTWNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD



Alignment 11
Sequence 1:
Sequence 2: Allergen Eur m 2.0102, Sequence: AAC82350
Sequence identity: 81.16 (112/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           ---VAAV-ADQVDVKDCAN-EIKKVMV-GC-GS-PC-IHRG--F-LEA-F
Sequence 2 ---VAAVAADQVDVKDCANHEIKKVMVPGCKGSEPCVIHRGTAFQLEAVF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           DANQN---AKIEIKA--DG-EIDVPGID-N-CHF-KCPLVKGQ-YDIKYT
Sequence 2 DANQNSNAAKIEIKATIDGVEIDVPGIDNNLCHFMKCPLVKGQEYDIKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           WNVP-IAPKSENVVVTVKL-GDNGVLACAIATH-KIRD
Sequence 2 WNVPRIAPKSENVVVTVKLLGDNGVLACAIATHAKIRD



Alignment 12
Sequence 1:
Sequence 2: Allergen Lep d 2, Sequence: P80384
Sequence identity: 42.75 (59/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           ---------LVA---A-----KDC---E-------GC-G-D-C-IHRG--
Sequence 2 MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEK

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           -TLEA-F-ANQ-T----I---A---G--I-VPG--T--C-F-KCP--KG-
Sequence 2 MTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGE

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           --D--Y----P-I-PK-----VT--LIGD-GV-AC----HG----
Sequence 2 ALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQVE-



Alignment 13
Sequence 1:
Sequence 2: Allergen Lep d 2.0102, Sequence: CAD32313
Sequence identity: 42.03 (58/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           ---------LVA---A-----KDC---E-------GC-G-D-C-IHRG--
Sequence 2 MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSG-DTCVIHRGEK

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           -TLEA-F-ANQ-T----I-------G--I-VPG--T--C-F-KCP--KG-
Sequence 2 MTLEAKFAANQDTAKVTIKVLTKVAGTTIQVPGLETDGCKFIKCPVKKGE

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           --D--Y----P-I-PK-----VT--LIGD-GV-AC----HG----
Sequence 2 ALDFIYSGTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQVE-



Alignment 14
Sequence 1:
Sequence 2: Allergen Tyr p 2, Sequence: O02380
Sequence identity: 44.93 (62/138)
Sequence 1 ------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPF
           --------LVA---A-QV---DC---EI--V-VDGC-G-D-C-IH--KP-
Sequence 2 MKFLILFALVAVAAAGQVKFTDCGKKEIASVAVDGCEG-DLCVIHKSKPV

Sequence 1 TLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQ
           ---A-F-ANQ-T----------L-GLE---PGI-T--C---KCPL-KG--
Sequence 2 HVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTK

Sequence 1 YDIKYTWNVPKIAPKSENVVVTVKLI--GDNGVLAC-AIATHGKIRD
           Y---Y--NVP---P---N----VKL---G--GVLAC-A--T--K---
Sequence 2 YTMNYSVNVPSVVP---NIKTVVKLLATGEHGVLACGAVNTDVKP--



Alignment 15
Sequence 1:
Sequence 2: Allergen Gly d 2.0201, Sequence: CAB76459
Sequence identity: 42.75 (59/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           --------------KDC---E--------C-G-D-C-IHRGKP-TLEA-F
Sequence 2 ---------GKMKFKDCGKGEVTELDITDCSG-DFCVIHRGKPLTLEAKF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           -ANQ-T--A-I---A---G--I-VPG--T--C-FVKCP--KG---D-KYT
Sequence 2 AANQDTTKATIKVLAKVAGTPIQVPGLETDGCKFVKCPIKKGDPIDFKYT

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           --VP-I-PK-----VT--L-GD-GVLAC----------
Sequence 2 TTVPAILPKVK-AEVTAELVGDHGVLACGRFGRQVE--



Alignment 16
Sequence 1:
Sequence 2: Allergen Der f 35.0101, Sequence: BAX34757
Sequence identity: 40.58 (56/138)
Sequence 1 --------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGK
           ---------L--A---A------DC---E-----V-GC-G-D-C--H-GK
Sequence 2 MIKFLCIFALTFAVASAGKMKFVDCGHKEVISLDVSGCEG-DYCVLHKGK

Sequence 1 PFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKG
           ---L------NQ-----K--I-A---G-EI-VPG-D---CH-V-CP--KG
Sequence 2 TIDLDMKCKSNQDSEHLKLIISADVNGIEIEVPGFDQDGCHYVQCPIHKG

Sequence 1 QQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           Q-YDIKY--NVP---P-------T-K-IGDNG---C-----G-I-D
Sequence 2 QDYDIKYSYNVPAVLPNIKGTL-TAKVIGDNGLVGC-LKLNGEIAD



Alignment 17
Sequence 1:
Sequence 2: Allergen Lep d 2.0202, Sequence: CAD32314
Sequence identity: 41.30 (57/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           ---------LVA---A-----KDC---E-------GC-G-D-C-IHRG--
Sequence 2 MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQK

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           -TL-A-F-ANQ-T----I---A---G--I-VPG--T--C---KCP--KG-
Sequence 2 MTLDAKFAANQDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGE

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           --D--Y----P-I-PK---V-VT--L-GD-GV-AC----HG----
Sequence 2 ALDFNYGMTIPAITPKIK-VDVTAELVGDHGVMACG-TIHGQVE-



Alignment 18
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEN8
Sequence identity: 39.86 (55/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-C-IH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A---G-E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 19
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEN9
Sequence identity: 39.13 (54/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-C-IH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCTIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A---G-E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P---P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTVLPNVKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 20
Sequence 1:
Sequence 2: Allergen Lep d 2.0201, Sequence: CAA58755
Sequence identity: 40.58 (56/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           ---------LVA---A-----KDC---E-------GC-G-D-C-IHRG--
Sequence 2 MMKFIALFALVAVASAGKMTFKDCGHGEVTELDISGCSG-DTCVIHRGQK

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           -TL-A-F-ANQ-T----I---A---G--I-VPG--T--C---KCP--KG-
Sequence 2 MTLDAKFAANQDTNKVTIKVLAKVAGTTIQVPGLETDGCKVLKCPIKKGE

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           --D--Y----P-I-PK-----VT--L-GD-GV-AC----HG----
Sequence 2 ALDFNYGMTIPAITPKIK-ADVTAELVGDHGVMACG-TIHGQVE-



Alignment 21
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP1
Sequence identity: 39.86 (55/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-CIIH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVA-



Alignment 22
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP2
Sequence identity: 39.86 (55/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-CIIH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVFD-



Alignment 23
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP6
Sequence identity: 40.58 (56/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-CIIH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC-------I--
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVID-



Alignment 24
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP3
Sequence identity: 39.13 (54/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-CIIH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P-------T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTIT-TASLVGDHGVVACGKVNTEVVD-



Alignment 25
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP5
Sequence identity: 38.41 (53/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E--------C-G-D-C-IH-GK-
Sequence 2 MFKFICLALLVSYATAGDVKFTDCAHGEVTSLDLSRCSG-DHCTIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A---G-E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISATMNGIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P---P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTVLPNVKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 26
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP4
Sequence identity: 39.13 (54/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC---D-CIIH-GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGC-SDDHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 27
Sequence 1:
Sequence 2: Allergen Blo t 2.0104, Sequence: A6XEP0
Sequence identity: 39.13 (54/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV----A--V---DCA--E-------GC-G-D-CII--GK-
Sequence 2 MFKFICLALLVSYAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIRKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 28
Sequence 1:
Sequence 2: Allergen Blo t 2.0102, Sequence: AAQ73482
Sequence identity: 38.41 (53/138)
Sequence 1 -------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKP
           --------LLV-------V----CA--E-------GC-G-D-CIIH-GK-
Sequence 2 MFKFICLALLVSPAAGGDVKFTACAHGEVTSLDLSGCSG-DHCIIHKGKS

Sequence 1 FTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQ
           FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ
Sequence 2 FTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQ

Sequence 1 QYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 KYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 29
Sequence 1:
Sequence 2: Allergen Blo t 2.0101, Sequence: AAQ73483
Sequence identity: 37.68 (52/138)
Sequence 1 ---------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRG
           -----------------A--V---DCA--E-------GC-G-D-CIIH-G
Sequence 2 MFKFICLALLPFWSRAAAGDVKFTDCAHGEVTSLDLSGCSG-DHCIIHKG

Sequence 1 KPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVK
           K-FTL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-K
Sequence 2 KSFTLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKK

Sequence 1 GQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           GQ-Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 GQKYELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 30
Sequence 1:
Sequence 2: Allergen Gly d 2.0101, Sequence: CAB59976
Sequence identity: 38.41 (53/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           ---------------DC--NEIK---V--C-G---C-IHRGKP-TL-A-F
Sequence 2 ---------GKMNFTDCGHNEIKELSVSNCTG-NYCVIHRGKPLTLDAKF

Sequence 1 DANQNTKTAKIEIKASLDG-LEIDVPGIDTNACHFVKCPLVKGQQYDIKY
           DANQ-T--------A--DG---ID-PG--TNAC---KCP--KG------Y
Sequence 2 DANQDTASVGLVLTAIIDGDIAIDIPGLETNACKLMKCPIRKGEHQELIY

Sequence 1 TWN-VPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           -----P---P------V---LIG--GVLAC----------
Sequence 2 NIGEIPDATPEIK-AKVKAQLIGEHGVLACGWVDGEVQE-



Alignment 31
Sequence 1:
Sequence 2: Allergen Blo t 2.0103, Sequence: AAQ73481
Sequence identity: 34.78 (48/138)
Sequence 1 ------SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPF
           --------L-----------------E-------GC-G-D-CIIH-GK-F
Sequence 2 MFKFICLALLVSSRRQRCQIYRSCTWEVTSLDLSGCSG-DHCIIHKGKSF

Sequence 1 TLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQ
           TL---F-ANQ------I-I-A-----E--VPG-D---C----CPL-KGQ-
Sequence 2 TLKTFFIANQDSEKLEIKISAIMNNIEVPVPGVDKDGCKHTTCPLKKGQK

Sequence 1 YDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           Y---Y----P-I-P----V--T--L-GD-GV-AC----------
Sequence 2 YELDYSLIIPTILPNLKTVT-TASLVGDHGVVACGKVNTEVVD-



Alignment 32
Sequence 1:
Sequence 2: Allergen Lep d 2.0101, Sequence: CAA57160
Sequence identity: 33.33 (46/138)
Sequence 1 SLLVAAVVADQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALF
           -------------------------------------IHRG---TLEA-F
Sequence 2 -------------------------------------IHRGEKMTLEAKF

Sequence 1 DANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFVKCPLVKGQQYDIKYT
           -ANQ-T----I---A---G--I-VPG--T--C-F-KCP--KG---D--Y-
Sequence 2 AANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYS

Sequence 1 WNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
           ---P-I-PK-----VT--LIGD-GV-AC----HG----
Sequence 2 GTIPAITPKVK-ADVTAELIGDHGVMACG-TVHGQVE-



Alignment 33
Sequence 1:
Sequence 2: Allergen Der f 22.0101, Sequence: ABG76195
Sequence identity: 40.58 (56/138)
Sequence 1 -----------SLLVAAVVADQVDV--KDCANNEIKKVMVDGCH-GSDPC
           -------------L-AAV-AD---V--KDC--NEIK---V-G-------C
Sequence 2 MNRFLIVCMALFCLAAAVQADETNVQYKDCGHNEIKSFFVTGGNPNQKSC

Sequence 1 IIHRGKPFTLEALFDANQNTKTAKIEIK--ASLDGLEIDVPGID-TNAC-
           -IH------L---F-AN-NT---KI-------L-G-E---PGID-T-AC-
Sequence 2 VIHKHSKNQLRISFVANENTGN-KINTRFICNLGGIELGWPGIDGTDACQ

Sequence 1 -HFVKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKL-IGDNGVLACAI
           -H---CPL-KGQ-Y------N-----P---NV--TV-L--G--G-L-C--
Sequence 2 GHGLSCPLTKGQTYNYHLDFNLGDDVP-TANVTATVRLENGHGGDLLCGR

Sequence 1 ATHGKIRD
           --------
Sequence 2 MHISLQN-



Alignment 34
Sequence 1:
Sequence 2: Allergen Can f 7.0101, Sequence: Q28895
Sequence identity: 25.36 (35/138)
Sequence 1 ----------SLLVAAVVADQVDVKDC--ANNEIKKVMVDGCHGSDPCII
           ------------L--------V--KDC--A---IK---V--C----PC--
Sequence 2 MRLLVAAFLLLALGDLGPGGAVHFKDCGSAVGVIKELNVNPCP-AQPCKL

Sequence 1 HRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHF-VKC
           H-G--------F--N------K--------G-----P------C-----C
Sequence 2 HKGQSYSVNVTFTSNIPSQSSKAVVHGIVLGVAVPFPIPEADGCKSGINC

Sequence 1 PLVKGQQYDIKYTWNVP-KIAPKSENVVVTVKLIGDNGVLACAIATHGKI
           P--K---Y---Y----P-K----S---VV---L-GDN------------I
Sequence 2 PIQKDKTYS--YLNKLPVKNEYPSIKLVVQWMLLGDNNQHLFCWEIPVQI

Sequence 1 RD
           --
Sequence 2 EG


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.