The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: February 25, 2013  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Gly m 6.0401

Sequence Q9SB11

Full FASTA alignment

Sequence name:
Query sequence:
MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRK
SREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRAD
FYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVI
YVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYI
VFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVN
PESQQGSPRVKVA

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Gly m 6.0401Q9SB11Go!563602.32.0e-173
2Gly m 6.0501Q7GC77Go!517212.15.2e-56
3Pru du 63EHK_AGo!531111.98.0e-26
4Pru du 6.0101ADN39440Go!551111.61.0e-25
5Cor a 9AAL73404Go!515108.77.3e-25
6Jug r 4.0101Q2TPW5Go!507107.91.2e-24
7Pis v 2.0101DQ631676Go!496107.61.5e-24
8Car i 4.0101ABW86978Go!505107.02.3e-24
9Gly m 6.0101P04776Go!495106.53.2e-24
10Gly m glycinin G1AAA33966Go!495106.53.2e-24
11Fag e 1BAA21758Go!565106.73.2e-24
12Ana o 2AAN76862Go!457105.75.1e-24
13Fag e 1Q9XFM4Go!538105.95.2e-24
14Ses i 7.0101Q9AUD2Go!497105.75.4e-24
15Fag e 1BAA21760Go!504105.09.4e-24
16Pru du 6.0201ADN39441Go!504105.09.4e-24
17Pis v 5.0101EU410073Go!473104.31.4e-23
18Gly m 6.0301P11828Go!481100.81.6e-22
19Gly m 6.0201P04405Go!48599.93.1e-22
20Gly m glycinin G2CAA68460Go!48599.93.1e-22
21Ber e 2AAO38859Go!46598.38.7e-22
22Pis v 2.0201DQ631677Go!47296.82.6e-21
23Ara h 3O82580Go!50791.21.3e-19
24Ara h 3AAC63045Go!51091.21.3e-19
25Sin a 2.0101Q2TLW0Go!51088.58.8e-19
26Ses i 6.0101Q9XHP0Go!45979.83.2e-16
27Ara h 4AAD47382Go!53074.91.1e-14
28Gly m conglycininCAA35691Go!60544.51.7e-05
29Gly m 5.0101O22120Go!54344.22.0e-05
30Gly m 5.0201Q9FZP9Go!55936.54.2e-03
31Gly m conglycininAAB01374Go!63936.54.7e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Gly m 6.0401, Sequence: Q9SB11
Sequence identity: 100.00 (563/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
Sequence 2 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
Sequence 2 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
           LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
Sequence 2 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP

Sequence 1 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
           PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
Sequence 2 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET

Sequence 1 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
           MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
Sequence 2 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE

Sequence 1 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
           KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
Sequence 2 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP

Sequence 1 RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRK
           RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRK
Sequence 2 RRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRK

Sequence 1 SREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRAD
           SREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRAD
Sequence 2 SREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRAD

Sequence 1 FYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVI
           FYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVI
Sequence 2 FYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVI

Sequence 1 YVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYI
           YVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYI
Sequence 2 YVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYI

Sequence 1 VFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVN
           VFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVN
Sequence 2 VFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVN

Sequence 1 PESQQGSPRVKVA
           PESQQGSPRVKVA
Sequence 2 PESQQGSPRVKVA



Alignment 2
Sequence 1:
Sequence 2: Allergen Gly m 6.0501, Sequence: Q7GC77
Sequence identity: 82.24 (463/563)
Sequence 1 MGKPF-TLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESE
           MGKPF-TLSLSSLCLLLLSSACFAI-SSK-NECQLNNLNALEPDHRVESE
Sequence 2 MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESE

Sequence 1 GGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKG
           GGLI-TWNSQHPEL-CAGVTVSK-TLNRNGLHLPSYSPYP-MII--QGKG
Sequence 2 GGLIETWNSQHPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKG

Sequence 1 ALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVI
           A-G-A-PGCPETFE-PQ-QS-RRGSRSQ-QQLQDSHQKIRHFNEGDVLVI
Sequence 2 AIGFAFPGCPETFEKPQQQSSRRGSRSQ-QQLQDSHQKIRHFNEGDVLVI

Sequence 1 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPE
           PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQ-PRVFYLAGNPDIE-PE
Sequence 2 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQNPRVFYLAGNPDIEHPE

Sequence 1 TMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIA
           TMQQQQQQKSHGGRKQGQHQQ-EEE-GGSVLSGFSKHFLAQSFNTNED-A
Sequence 2 TMQQQQQQKSHGGRKQGQHQQQEEE-GGSVLSGFSKHFLAQSFNTNEDTA

Sequence 1 EKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHP
           EKL-SPDDERKQIVTVEGGLSVISPKWQEQ-DEDEDEDE--E-EQ-PS-P
Sequence 2 EKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDE--EYEQTPSYP

Sequence 1 PRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPR
           PRRPSHGK-E-DEDEDE-ED-PRP--P-Q---------------------
Sequence 2 PRRPSHGKHEDDEDEDEEEDQPRPDHPPQ---------------------

Sequence 1 KSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRA
           -----------P-RP-Q-EPR-RGC-TRNGVEENICT-KLHENIARPSRA
Sequence 2 ----------RPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIARPSRA

Sequence 1 DFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSV
           DFYNPKAGRISTLNSLTLPALRQF-LSAQYVVLY-NGIYSPHWNLNANSV
Sequence 2 DFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSV

Sequence 1 IYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEY
           IYVTRG-G-VRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQ-GEQG-EY
Sequence 2 IYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEY

Sequence 1 IVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLV
           -VFKTHHNAV-SY-KDVFRAIPSEVL--SYNL-QSQV--LKY-GN-GPLV
Sequence 2 VVFKTHHNAVSSYIKDVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLV

Sequence 1 NPESQQGSPRVKVA
           NP------------
Sequence 2 NP------------



Alignment 3
Sequence 1:
Sequence 2: Allergen Pru du 6, Sequence: 3EHK_A
Sequence identity: 41.03 (231/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           --------------------------S--N-CQLN-L-A-EPD-R---E-
Sequence 2 --------------------ARQSQLSPQNQCQLNQLQAREPDNRIQAEA

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           G-I-TWN-------CAGV--S--T--RNGLHLPSYS--P--I-I-QG-G-
Sequence 2 GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV

Sequence 1 LGVAIPGCPETFEEPQ---------------------EQSNRRGSRSQKQ
           LG----GCPETFEE-Q---------------------EQ----G---Q-Q
Sequence 2 LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ

Sequence 1 QLQ----------------------------------DSHQKIRHFNEGD
           --Q----------------------------------D-HQK-R---EGD
Sequence 2 ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD

Sequence 1 VLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDI
           V--IP-GV-YW-YN-GD---VA--L---S---NQLDQ-PR-FYLAGNP--
Sequence 2 VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN

Sequence 1 EYPETMQQQQQQKSHGGRKQGQHQQ--------EEEEEGGSVLSGFSKHF
           E-----Q-Q--Q----GR--GQHQQ--------E----G--V-SGF----
Sequence 2 EFNQQGQSQPRQQGEQGRP-GQHQQPFGRPRQQEQQGNGNNVFSGFNTQL

Sequence 1 LAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDED
           LAQ--N-NE--A--LQ---D-R-QI--V-G-L------------------
Sequence 2 LAQALNVNEETARNLQGQNDNRNQIIQVRGNLDFV---------------

Sequence 1 EDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQ
           -----------PPR----G--E----E----------------R-Q-Q-Q
Sequence 2 ----------QPPR----GRQEREHEE----------------RQQEQLQ

Sequence 1 DEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTL
           -E-----E--------------------------------NG-EE--C-L
Sequence 2 QERQQQGEQL----------------------------MANGLEETFCSL

Sequence 1 KLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGI
           -L-ENI--P-RAD---P-AGRISTLNS--LP-LR---LSA-----Y-NGI
Sequence 2 RLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGI

Sequence 1 YSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFV
           YSPHWN-NA-SV-YV-RG---V-VVN--G-A--D-E---GQL--VPQN--
Sequence 2 YSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHG

Sequence 1 VAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQS
           V--QAG-QGFEY--FKT--NA----L-------RA-P-EVLA--Y-----
Sequence 2 VIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISRE

Sequence 1 QVSELKYEGNWGPLVNPESQQGSPRVKVA
           Q---LKY------------Q---------
Sequence 2 QARQLKYNRQETIALSSSQQRRAVV----



Alignment 4
Sequence 1:
Sequence 2: Allergen Pru du 6.0101, Sequence: ADN39440
Sequence identity: 43.52 (245/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKL---NECQLNNLNALEPDHRVE
           M-K-F--SL---CLLL----C-A---S-L---N-CQLN-L-A-EPD-R--
Sequence 2 MAKAFVFSL---CLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQ

Sequence 1 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG
           -E-G-I-TWN-------CAGV--S--T--RNGLHLPSYS--P--I-I-QG
Sequence 2 AEAGQIETWNFNQEDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQG

Sequence 1 KGALGVAIPGCPETFEEPQ---------------------EQSNRRGSRS
           -G-LG----GCPETFEE-Q---------------------EQ----G---
Sequence 2 RGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQE

Sequence 1 QKQQLQ----------------------------------DSHQKIRHFN
           Q-Q--Q----------------------------------D-HQK-R---
Sequence 2 QQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDRHQKTRRIR

Sequence 1 EGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGN
           EGDV--IP-GV-YW-YN-GD---VA--L---S---NQLDQ-PR-FYLAGN
Sequence 2 EGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGN

Sequence 1 PDIEYPETMQQQQQQKSHGGRKQGQHQQ--------EEEEEGGSVLSGFS
           P--E-----Q-Q--Q----GR--GQHQQ--------E----G--V-SGF-
Sequence 2 PENEFNQQGQSQPRQQGEQGRP-GQHQQPFGRPRQQEQQGSGNNVFSGFN

Sequence 1 KHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDE
           ---LAQ--N-NE--A--LQ---D-R-QI--V-G-L---------------
Sequence 2 TQLLAQALNVNEETARNLQGQNDNRNQIIRVRGNLDFV------------

Sequence 1 DEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQD
           --------------PPR----G--E----E----------------R-Q-
Sequence 2 -------------QPPR----GRQEREHEE----------------RQQE

Sequence 1 QDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENI
           Q-Q-E-------------------------RQ------G----NG-EE--
Sequence 2 QLQQE-------------------------RQQQG---GQLMANGLEETF

Sequence 1 CTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYK
           C-L-L-ENI--P-RAD---P-AGRISTLNS--LP-LR---LSA-----Y-
Sequence 2 CSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYR

Sequence 1 NGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQ
           NGIYSPHWN-NA-SV-YV-RG---V-VVN--G-A--D-E---GQL--VPQ
Sequence 2 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQ

Sequence 1 NFVVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNL
           N--V--QAG-QGFEY--FKT--NA----L-------RA-P-EVLA--Y--
Sequence 2 NHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQI

Sequence 1 RQSQVSELKYEGNWGPLVNPESQQGSPRVKVA
           ---Q---LKY------------Q---------
Sequence 2 SREQARQLKYNRQETIALSSSQQRRAVV----



Alignment 5
Sequence 1:
Sequence 2: Allergen Cor a 9, Sequence: AAL73404
Sequence identity: 43.69 (246/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAIS-------SSKLNECQLNNLNALEPD
           M-K----S-S-LCLL-L---C--I-------------EC-L--LNALEP-
Sequence 2 MAKLILVSFS-LCLLVLFNGCLGINVGLRRQQQRYFGECNLDRLNALEPT

Sequence 1 HRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMII
           -R-E-E---I--W--------CAGV-V---T---NGL-LP-YS--P--I-
Sequence 2 NRIEAEACQIESWDHNDQQFQCAGVAVIRRTIEPNGLLLPQYSNAPELIY

Sequence 1 IAQGKGALGVAIPGCPETFEEPQEQS---NRRGSRSQKQQLQDSHQKIRH
           I--G-G--GV--PGCPETFE-PQ-QS----R-G--------QD-HQKIRH
Sequence 2 IERGRGITGVLFPGCPETFEDPQQQSQQGQRQGQGQSQRSEQDRHQKIRH

Sequence 1 FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLA
           F-EGD----P-GV--W-YN-GD-PVV--SLL-T-N--NQLD--PR-FYLA
Sequence 2 FREGDIIALPAGVAHWCYNDGDSPVVTVSLLHTNNYANQLDENPRHFYLA

Sequence 1 GNPDIEYPETMQQQ------QQQKSHGGRKQGQHQQEEEEEGGSVLSGFS
           GNPD-E-----QQQ------QQQ-SHG---QG---QE---EG--V-SGF-
Sequence 2 GNPDDEHQRQGQQQFGQRRRQQQHSHG--EQGE--QEQQGEGNNVFSGFD

Sequence 1 KHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDE
           --FLA--FN---D-A--LQS--D-R--IV-VEG-L-V-------------
Sequence 2 AEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVV------------

Sequence 1 DEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQD
           -------------------------------------RP-R--Q------
Sequence 2 -------------------------------------RPERSRQ------

Sequence 1 QDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENI
           --------E-E-Q-R--RE---------R-RQ-----RG----NG-EE-I
Sequence 2 --------EWERQERQERE-----SEQERERQRRQGGRGRDV-NGFEETI

Sequence 1 CTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYK
           C-L-L-ENI---SRAD-Y----GRI-T-NS-TLP-LR--QLSA----L--
Sequence 2 CSLRLRENICTRSRADIYTEQVGRINTVNSNTLPVLRWLQLSAERGDLQR

Sequence 1 NGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQ
           -G-Y-PHWNLNA-SV-Y--RG---V-VV---GN-VFD-ELR-GQ-L--PQ
Sequence 2 EGLYVPHWNLNAHSVVYAIRGRARVQVVDDNGNTVFDDELRQGQVLTIPQ

Sequence 1 NFVVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNL
           NF-VA--A---GFE---FKT--NA--S-L-------RA-P--VLA-----
Sequence 2 NFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRALPDDVLANAFQI

Sequence 1 RQSQVSELKYEGNWGPLVNPESQQGSPRVKVA--------
           -------LKY------LV---S---S-R------------
Sequence 2 SREEARRLKYNRQETTLVRS-SRSSSERKRRSESEGRAEA



Alignment 6
Sequence 1:
Sequence 2: Allergen Jug r 4.0101, Sequence: Q2TPW5
Sequence identity: 43.34 (244/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSK----LNECQLNNLNALEPDHRV
           M-KP--LS--------L---C-A-S----------CQLN-L-ALEP--R-
Sequence 2 MAKPILLSIYLFLIVALFNGCLAQSGGRQQQQFGQCQLNRLDALEPTNRI

Sequence 1 ESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQ
           E-E-G-I--W--------CAGV-V---T---NGL-LP-YS--P----IA-
Sequence 2 EAEAGVIESWDPNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLVYIAR

Sequence 1 GKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDV
           G-G--GV--PGCPETFEE-Q-QS----SR---Q---D-HQKIRHF-EGD-
Sequence 2 GRGITGVLFPGCPETFEESQRQSQQGQSREFQQ---DRHQKIRHFREGDI

Sequence 1 LVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIE
           ---P-GV--W-YN-G--PVVAISLLDT-N--NQLDQ-PR-FYLAGNPD-E
Sequence 2 IAFPAGVAHWSYNDGSNPVVAISLLDTNNNANQLDQNPRNFYLAGNPDDE

Sequence 1 Y-PETMQQQQQQKSHGGRKQ--GQHQQEEEEEGGSVLSGFSKHFLAQSFN
           --P---Q---Q------R-Q--G-H-Q-----G--V-SGF---FLA--FN
Sequence 2 FRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLGNNVFSGFDADFLADAFN

Sequence 1 TNEDIAEKLQSPDDERKQIVTVEG-GLSVISPKWQEQQDEDEDEDEDDED
           -----A--LQS--D-R--IV-VEG--L-VI-P-W----------------
Sequence 2 VDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWS---------------

Sequence 1 EQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDED
           ---------------RE--E-E---E------------RE--------E-
Sequence 2 ---------------REEQEREERKE------------RER-------ER

Sequence 1 EDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHEN
           E-E---R-SR-------------------RG----NG-EE-ICTL-L-EN
Sequence 2 ESESERRQSR-------------------RGGRDDNGLEETICTLRLREN

Sequence 1 IARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHW
           I--PSRAD-Y---AGRIST-NS-TLP-LR--QLSA----LY----Y-PHW
Sequence 2 IGDPSRADIYTEEAGRISTVNSHTLPVLRWLQLSAERGALYSDALYVPHW

Sequence 1 NLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQA
           NLNA-SV-Y--RG---V-VV---G--VFD-ELR-GQLL--PQNF-V---A
Sequence 2 NLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVVKRA

Sequence 1 GEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSEL
           ---GFE---FKT--NA--S-L-------RA-P-EVLA------------L
Sequence 2 RNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLATAFQIPREDARRL

Sequence 1 KYEGNWGPLVNPESQQGSPRVKVA----
           K-------LV------------------
Sequence 2 KFNRQESTLVRSRPSRSRSSRSERRAEV



Alignment 7
Sequence 1:
Sequence 2: Allergen Pis v 2.0101, Sequence: DQ631676
Sequence identity: 36.59 (206/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFA-----ISSSK-------LNECQLNNLN
           MG----LS-S-L--LLL----FA-------S------------CQ--NLN
Sequence 2 MGYSSLLSFS-LGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLN

Sequence 1 ALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPY
           ALEP--R-ESE-G----W------L-CA-V-V---T----GL--PSY---
Sequence 2 ALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYDNA

Sequence 1 PRMIIIAQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKI
           P------QG-G--G---PGCPETF-E---QS--R--RSQ----Q--HQK-
Sequence 2 PELVYVVQGSGIHGAVFPGCPETFQE-ESQSRSRSERSQQSGEQ--HQKV

Sequence 1 RHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFY
           R---EGDV---P-GV--W-YN-G----V---L-D--N--NQLDQ--R-F-
Sequence 2 RPIQEGDVIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRKFV

Sequence 1 LAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFL
           L-G-P--E-----Q------S---R---Q-QQ---------LS-F----L
Sequence 2 LGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQ-----SNNILSAFDEEIL

Sequence 1 AQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDE
           AQSFN-----A--LQ-----R--IV-V---L-V-SP--QEQ--E-E-E--
Sequence 2 AQSFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSPHRQEQEQEYEEE--

Sequence 1 DDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQD
           ------------------------------------------RE--Q---
Sequence 2 ------------------------------------------RERRQ---

Sequence 1 EDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLK
           --------------------------------------RNG-EE--CT--
Sequence 2 --------------------------------------RNGLEETFCTMT

Sequence 1 LHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIY
           L--NI--PSRAD-YNP--GR-S--N-L-LP-LR--QLSA---VL----I-
Sequence 2 LKYNINDPSRADVYNPRGGRVSSVNALNLPILRFLQLSAKKGVLHRDAIL

Sequence 1 SPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVV
           -PHWN-NA-S--Y-TRG-G----V---G--VFD-E-R-GQL-VVPQNF-V
Sequence 2 APHWNVNAHSIVYITRGNGRIQIVSENGESVFDEEIREGQLVVVPQNFAV

Sequence 1 AEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQ
           ---A----FE---FKT-----TS-L-----VFRA-P--V---S-------
Sequence 2 VKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSFDISRED

Sequence 1 VSELKYEGNWGPLVNPESQQGSPRVKVA------------
           ---LK----------P-S----------------------
Sequence 2 ARRLKESRSETTIFAPGSSSQRKSQSERERQREREEREIH



Alignment 8
Sequence 1:
Sequence 2: Allergen Car i 4.0101, Sequence: ABW86978
Sequence identity: 44.05 (248/563)
Sequence 1 MGKPFTLSLSSLCLLLLS--SACFAISSS----KLNECQLNNLNALEPDH
           M-KP--LS---LCL--------C-A-S------K---CQLN-L-ALEP--
Sequence 2 MAKPILLSIY-LCLIIVALFNGCLAQSGGRQQHKFGQCQLNRLDALEPTN

Sequence 1 RVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIII
           R-E-E-G-I--W---H--L-CAGV-V---T---NGL-LP-YS--P----I
Sequence 2 RIEAEAGVIESWDPNHQQLQCAGVAVVRRTIEPNGLLLPHYSNAPQLVYI

Sequence 1 AQGKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEG
           A-G-G--GV--PGCPETFEE-Q-QS---G-R---QQ--D-HQKIRHF-EG
Sequence 2 ARGRGITGVLFPGCPETFEESQRQS-QQGQRREFQQ--DRHQKIRHFREG

Sequence 1 DVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPD
           D----P-GV--W-YN-G--PVVAI-LLDT-N--NQLDQ-PR-FYLAGNPD
Sequence 2 DIIAFPAGVAHWCYNDGSSPVVAIFLLDTHNNANQLDQNPRNFYLAGNPD

Sequence 1 IEY-PETMQ---QQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQ
           -E--P---Q---Q---Q--H--R--G-H-------G--V-SGF---FLA-
Sequence 2 DEFRPQGQQEYEQHRRQQQHQQRR-GEHGEQQRDLGNNVFSGFDAEFLAD

Sequence 1 SFNTNEDIAEKLQSPDDERKQIVTVEG-GLSVISPKWQEQQDEDEDEDED
           -FN-----A--LQS--D-R--IV-VEG--L-VI-P-W-------------
Sequence 2 AFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRPRWS------------

Sequence 1 DEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDE
           ------------------RE--E-E---E------------RE-------
Sequence 2 ------------------REEQEHEERKE------------RER------

Sequence 1 DEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKL
           -E-E-E---R-SR-------------------RG----NG-EE-ICTL-L
Sequence 2 -ERESESERRQSR-------------------RGGRDDNGLEETICTLSL

Sequence 1 HENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYS
           -ENI--PSRAD-Y---AGRIST-NS--LP-LR--QLSA----LY----Y-
Sequence 2 RENIGDPSRADIYTEEAGRISTVNSHNLPILRWLQLSAERGALYSDALYV

Sequence 1 PHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVA
           PHWNLNA-SV-Y--RG---V-VV---G--VFD-ELR-GQLL--PQNF-V-
Sequence 2 PHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLLTIPQNFAVV

Sequence 1 EQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQV
           --A---GFE---FKT--NA--S-L-------RA-P-EVL-----------
Sequence 2 KRARDEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLVNAFQIPREDA

Sequence 1 SELKYEGNWGPLVNPESQQGSPRVKVA-
           --LK-------LV---S-----------
Sequence 2 RRLKFNRQESTLVRSRSRSSRSERRAEV



Alignment 9
Sequence 1:
Sequence 2: Allergen Gly m 6.0101, Sequence: P04776
Sequence identity: 43.16 (243/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSS---KLNECQLNNLNALEPDHRVE
           ----------SLC-LL-S--CFA-SS------NECQ---LNAL-PD-R-E
Sequence 2 ----MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIE

Sequence 1 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG
           SEGGLI-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG
Sequence 2 SEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG

Sequence 1 KGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVL
           KG--G---PGCP-TFEEPQ-Q---RG--S--Q---D-HQKI--F-EGD--
Sequence 2 KGIFGMIYPGCPSTFEEPQ-QPQQRGQSSRPQ---DRHQKIYNFREGDLI

Sequence 1 VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEY
           --P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN---E-
Sequence 2 AVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEF

Sequence 1 PETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNED
           ------QQ-Q--H---K-G-HQQEEE-EGGS-LSGF---FL---F-----
Sequence 2 ---LKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ

Sequence 1 IAEKLQSPDD--ERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQI
           IA--LQ----------IVTV-GGLSVI-P---EQQ---------------
Sequence 2 IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ---------------

Sequence 1 PSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDE
           ------RP------Q-E-E-E---KP-------GK----Q----------
Sequence 2 -----QRP------QEEEEEEEDEKPQ----CKGKDKHCQ----------

Sequence 1 DQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIAR
           -----------------RPR------R----RNG--E-ICT--L--NI--
Sequence 2 -----------------RPRGSQSKSR----RNGIDETICTMRLRHNIGQ

Sequence 1 PSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLN
           -S--D-YNP-AG---T--SL--PAL----LSA----L-KN----PH-NLN
Sequence 2 TSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLN

Sequence 1 ANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQ
           ANS-IY---G-----VVNC-G--VFDGEL--G--L-VPQNFVVA------
Sequence 2 ANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSD

Sequence 1 GFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYE
           -FEY--FKT--------L--------A-P-EV--H--NL---Q----K--
Sequence 2 NFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN

Sequence 1 GNWGPLVNPESQQGSPRVKVA
           -----LV-P---Q--------
Sequence 2 NPFKFLVPPQESQKRAVA---



Alignment 10
Sequence 1:
Sequence 2: Allergen Gly m glycinin G1, Sequence: AAA33966
Sequence identity: 43.16 (243/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSS---KLNECQLNNLNALEPDHRVE
           ----------SLC-LL-S--CFA-SS------NECQ---LNAL-PD-R-E
Sequence 2 ----MAKLVFSLCFLLFSGCCFAFSSREQPQQNECQIQKLNALKPDNRIE

Sequence 1 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG
           SEGGLI-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG
Sequence 2 SEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQG

Sequence 1 KGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVL
           KG--G---PGCP-TFEEPQ-Q---RG--S--Q---D-HQKI--F-EGD--
Sequence 2 KGIFGMIYPGCPSTFEEPQ-QPQQRGQSSRPQ---DRHQKIYNFREGDLI

Sequence 1 VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEY
           --P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN---E-
Sequence 2 AVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEF

Sequence 1 PETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNED
           ------QQ-Q--H---K-G-HQQEEE-EGGS-LSGF---FL---F-----
Sequence 2 ---LKYQQEQGGHQSQK-GKHQQEEENEGGSILSGFTLEFLEHAFSVDKQ

Sequence 1 IAEKLQSPDD--ERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQI
           IA--LQ----------IVTV-GGLSVI-P---EQQ---------------
Sequence 2 IAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQ---------------

Sequence 1 PSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDE
           ------RP------Q-E-E-E---KP-------GK----Q----------
Sequence 2 -----QRP------QEEEEEEEDEKPQ----CKGKDKHCQ----------

Sequence 1 DQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIAR
           -----------------RPR------R----RNG--E-ICT--L--NI--
Sequence 2 -----------------RPRGSQSKSR----RNGIDETICTMRLRHNIGQ

Sequence 1 PSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLN
           -S--D-YNP-AG---T--SL--PAL----LSA----L-KN----PH-NLN
Sequence 2 TSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLN

Sequence 1 ANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQ
           ANS-IY---G-----VVNC-G--VFDGEL--G--L-VPQNFVVA------
Sequence 2 ANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSD

Sequence 1 GFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYE
           -FEY--FKT--------L--------A-P-EV--H--NL---Q----K--
Sequence 2 NFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNN

Sequence 1 GNWGPLVNPESQQGSPRVKVA
           -----LV-P---Q--------
Sequence 2 NPFKFLVPPQESQKRAVA---



Alignment 11
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21758
Sequence identity: 36.41 (205/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSK-------------LNECQLNNL
           M-----LS-S-LCL--LS---------K----------------C----L
Sequence 2 MSTKLILSFS-LCLMVLSCSAQLLPWRKGQRSRPHRGHQQFHHQCDVQRL

Sequence 1 NALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSP
           -A-EP--RV-SE-G----W----PE--CAG-----------GL-LPSYS-
Sequence 2 TASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPGGLLLPSYSN

Sequence 1 YPRMIIIAQGKGALGVAIPGCPETF------EEPQ------------EQS
           -P------QG-G--GV--PGCPETF------E-PQ------------E-S
Sequence 2 APYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEES

Sequence 1 NR--------------RG---------------------------SRSQK
           -R--------------RG---------------------------SR---
Sequence 2 SRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQ

Sequence 1 QQLQ---------DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAIS
           ---Q---------D-HQKI-----GDV---P-GV--WT-N-GD-----I-
Sequence 2 RTRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISIT

Sequence 1 LLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQ
           L-D---F-NQLD---R-F-LAG-------E----Q-Q----G---Q----
Sequence 2 LYDANSFQNQLDGNVRNFFLAGQSK-QSREDRRSQRQTREEGSDRQSRES

Sequence 1 QEEEEE-GGSVLSGFSKHFLAQSF-NTNEDIAEKLQSPDDERKQIVTVEG
           ---E-------L-GF----L---F-N-------KL----D-R--IV----
Sequence 2 DDDEALLEANILTGFQDEILQEIFRNVDQETISKLRGDNDQRGFIVQAR-

Sequence 1 GLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDED
           ----------------------D-----P---------------------
Sequence 2 ----------------------DLKLRVP---------------------

Sequence 1 EDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQE
           -----------------------E-E-E-Q-----------------R--
Sequence 2 ----------------------EEYEEELQ-----------------RER

Sequence 1 EPRERGCETR-NGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLT
           --R-RG---R-NG-E---C-LK---N--RPSRAD--NP-AGRI-T-NS--
Sequence 2 GDRKRGGSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNN

Sequence 1 LPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQG
           LP-L---QLSAQ-VVLYKN-I--P-WNLNA-S--YVTRG-G-V-VV---G
Sequence 2 LPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEG

Sequence 1 NAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLK--
           --VFD----RGQ-LVVPQ-F-V---AG--G-E----K---NA-TS-----
Sequence 2 RSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGK

Sequence 1 -DVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA
           --V-RAIP-EVLA-SY---------LK----------P------------
Sequence 2 TSVLRAIPVEVLANSYDISTKEAFRLKNGRQEVEVFLPFQSRDEKERERF



Alignment 12
Sequence 1:
Sequence 2: Allergen Ana o 2, Sequence: AAN76862
Sequence identity: 38.72 (218/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISS--SKLNECQLNNLNALEPDHRVES
           ----------S-C-L-L---C-A---------ECQ---L-ALEPD-RVE-
Sequence 2 ---------LSVCFLILFHGCLASRQEWQQQDECQIDRLDALEPDNRVEY

Sequence 1 EGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGK
           E-G----W---H----CAGV-----T---NGL-LP-YS--P--I---QG-
Sequence 2 EAGTVEAWDPNHEQFRCAGVALVRHTIQPNGLLLPQYSNAPQLIYVVQGE

Sequence 1 GALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLV
           G--G---PGCPET---PQ-Q----G---Q----QD-HQKIR-F--GD---
Sequence 2 GMTGISYPGCPETYQAPQ-QGRQQG---QSGRFQDRHQKIRRFRRGDIIA

Sequence 1 IPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYP
           IP-GV--W-YN-G--PVV---LLD-SN--NQLD-TPR-F-LAGNP-----
Sequence 2 IPAGVAHWCYNEGNSPVVTVTLLDVSNSQNQLDRTPRKFHLAGNPK----

Sequence 1 ETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDI
           ---QQQQQ--S-G-------------------SGF----LA--F---E--
Sequence 2 DVFQQQQQHQSRGR---------------NLFSGFDTELLAEAFQVDERL

Sequence 1 AEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSH
           ---L-S--D-R--IV-V-----------------------DDE---I---
Sequence 2 IKQLKS-EDNRGGIVKVK----------------------DDELRVI---

Sequence 1 PPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQP
           -----------------------RPSR-SQ--R-------E-E-E-ED--
Sequence 2 -----------------------RPSR-SQSER-----GSESEEESEDEK

Sequence 1 RKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSR
           R----W-----------------------NG-EE-ICT--L-ENI--P-R
Sequence 2 RR---WGQRD-------------------NGIEETICTMRLKENINDPAR

Sequence 1 ADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANS
           AD-Y-P--GR--TLNSL-LP-L---QLS----VLYKN----PHWNLN--S
Sequence 2 ADIYTPEVGRLTTLNSLNLPILKWLQLSVEKGVLYKNALVLPHWNLNSHS

Sequence 1 VIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFE
           -IY---G-G-V-VV---GN-VFDGE-R-GQ-LVVPQNF-V---A-E--FE
Sequence 2 IIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVPQNFAVVKRAREERFE

Sequence 1 YIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEGNW
           -I-FKT---A-TS-L-----V----P-EVLA-------------K-----
Sequence 2 WISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIKFNNQQ

Sequence 1 GPLVNPESQQGSPRVKVA
           --L---ES----------
Sequence 2 TTLTSGESSHHMRDDA--



Alignment 13
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: Q9XFM4
Sequence identity: 35.88 (202/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSK-------------LNECQLNNL
           M-----LS-S-LCL--LS---------K----------------C----L
Sequence 2 MSTKLILSFS-LCLMVLSCSAQLLPWQKGQRSRPHHGHQQFQHQCDIQRL

Sequence 1 NALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSP
           -A-EP--RV-SE-G----W----PE--CAG-----------GL-LPSYS-
Sequence 2 TASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPGGLLLPSYSN

Sequence 1 YPRMIIIAQGKGALGVAIPGCPETF------EEPQEQSNRRG--------
           -P------QG-G--GV--PGCPETF------E-P--Q---R---------
Sequence 2 APYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGES

Sequence 1 SRSQKQQLQ------------------------DSHQKIRHFNEGDVLVI
           SR------Q------------------------D-HQKI-----GDV---
Sequence 2 SRGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPS

Sequence 1 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPE
           P-GV--WT-N-GD-----I-L-D---F-NQLD---R-F-LAG-------E
Sequence 2 PAGVVQWTHNNGDNDLISITLYDANSFQNQLDENVRNFFLAGQSK-QSRE

Sequence 1 TMQQQQQQKSHGGRKQGQHQQEEEEE-GGSVLSGFSKHFLAQSF-NTNED
           ----Q-Q----G---Q----Q--E-------LSGF----L---F-N----
Sequence 2 DRRSQRQTREEGSDRQSRESQDDEALLEANILSGFEDEILQEIFRNVDQE

Sequence 1 IAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPS
           ---KL----D-R--IV--------------------------D-----P-
Sequence 2 TISKLRGENDQRGFIVQAR-----------------------DLKLRVP-

Sequence 1 HPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQ
           -------------------------------------------E-E-E-Q
Sequence 2 ------------------------------------------EEYEEELQ

Sequence 1 PRKSREWRSKKTQPRRPRQEEPRERGCETR-NGVEENICTLKLHENIARP
           -----------------R----R-RG---R-NG-E---C-LK---N--RP
Sequence 2 -----------------RERGDRKRGGSGRSNGLEQAFCNLKFRQNVNRP

Sequence 1 SRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNA
           SRAD--NP-AGRI-T--S--LP-L---QLSAQ-VVLYKN-I--P-WNLNA
Sequence 2 SRADVFNPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNA

Sequence 1 NSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQG
           -S--YVTRG-G-V-VV---G--VFD----RGQ-LVVPQ-F-V---AG--G
Sequence 2 HSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREG

Sequence 1 FEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEG
           -E----K---NA-TS-------V-RAIP-EVLA-SY---------LK---
Sequence 2 LEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGR

Sequence 1 NWGPLVNPESQQGSPRVKVA---
           -------P---------------
Sequence 2 QEVEVFRPFQSRDEKERERFSIV



Alignment 14
Sequence 1:
Sequence 2: Allergen Ses i 7.0101, Sequence: Q9AUD2
Sequence identity: 34.81 (196/563)
Sequence 1 -----------------MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQ
           ------------------G----L------------------------C-
Sequence 2 MALTSLLSFFIVVTLLIRGLSAQLAGEQDFYWQDLQSQQQHKLQARTDCR

Sequence 1 LNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLP
           ---L-A-EP--R-ESE-GL---W--------CAGV----------GL-LP
Sequence 2 VERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRGLLLP

Sequence 1 SYSPYPRMIIIAQGKGALGVAIPGCPETFE-EPQEQSNRRGSRSQKQQLQ
           -Y---P-------G-G--G--IPGC-ETFE---Q----RR----------
Sequence 2 HYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQPRQDRR------RRFM

Sequence 1 DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQ
           D-HQK-R-F--GD-L--P-G---W-YN-G-EP-----LLDT-N--NQLDQ
Sequence 2 DRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLDQ

Sequence 1 TPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSG
           T-R-F-LAGNP----------Q----S--GR-Q---QQ-E---------G
Sequence 2 TFRHFFLAGNP----------QGGRQSYFGRPQTEKQQGETK---NIFNG

Sequence 1 FSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDE
           F----LA--F------A--L---DD-R--IV--E--L----P-------E
Sequence 2 FDDEILADAFGVDVQTARRLKGQDDLRGRIVRAER-LDIVLP------GE

Sequence 1 DEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKRE
           -E-E----------------------E-D--------------P--G---
Sequence 2 EEEE--------------------RWERD--------------PYSGA--

Sequence 1 QDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEE
           ---------------------------------------------NG-EE
Sequence 2 ---------------------------------------------NGLEE

Sequence 1 NICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVL
           --CT-KL-EN---P-RAD-YNP--GRIS-LNSLTLP-L----LSA---VL
Sequence 2 TLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVL

Sequence 1 YKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVV
           Y-NG---PHWNLNA-S-IY-TRG-G---VV---G--VFDG--R-GQL--V
Sequence 2 YRNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIV

Sequence 1 PQNFVVAEQAGE-QGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHS
           PQN-VVA--A----G-E-I-FKT--NA-TS-L-------RA-P-EV----
Sequence 2 PQNYVVAKRASQDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTA

Sequence 1 YNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA---------------
           Y---------LKY-----------S----PR-------------------
Sequence 2 YQVSRDEARRLKYNREESRVFSSTSRYSWPRSSRPMSYMPKPFEYVLDVI

Sequence 1 ----
           ----
Sequence 2 KSMM



Alignment 15
Sequence 1:
Sequence 2: Allergen Fag e 1, Sequence: BAA21760
Sequence identity: 33.04 (186/563)
Sequence 1 --------------MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNN
           ---------------------------------------------C----
Sequence 2 MSTKLILSFSLCLMVLSCSAQLWPWQKGQGSRPHHGRQQHQFQHQCDIQR

Sequence 1 LNALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYS
           L-A-EP--RV-SE-G----W----PE--C-G-----------GL-LPSYS
Sequence 2 LTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLLLPSYS

Sequence 1 PYPRMIIIAQGKGALGVAIPGCPETF------EEPQEQSNR--RGSRSQK
           --P------QG-G--GV-IPGCPETF------E-PQ-Q--R--R-S-S--
Sequence 2 NAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESEE

Sequence 1 QQLQ-DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFN
           -----D-HQKI----EGDV---P-GV--WT-N-G--------LLD-----
Sequence 2 ESSRGDQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYH

Sequence 1 NQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEE-G
           -QLD---R-F-LAG----------Q-Q------G---Q-------E---G
Sequence 2 KQLDENVRSFFLAG----------QSQRETREEGSDRQSRESDDDEALLG

Sequence 1 GSVLSGFSKHFLAQSF-NTNEDIAEKLQSPDDERKQIVTVEGGLSVISPK
           ---LSGF----L---F---------KL----D-R--IV------------
Sequence 2 ANILSGFQDEILHELFRDVDRETISKLRGENDQRGFIV------------

Sequence 1 WQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSR
           -Q-Q----------D-----P-------------QD--E-----------
Sequence 2 -QAQ----------DLKLRVP-------------QDFEEEYERER-----

Sequence 1 PSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCE
           ---G-R---Q-------------------------------------G--
Sequence 2 ---GDRRRGQG------------------------------------GSG

Sequence 1 TRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQL
           --NGVE---C-LK---N---P------NP-AGRI-T-NS--LP-L---QL
Sequence 2 RSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQL

Sequence 1 SAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELR
           SAQ-VVLYKN-I--P-WNLNA-S--YVTRG-G-V-VV---G--VFD----
Sequence 2 SAQHVVLYKNAIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQ

Sequence 1 RGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL---KDVFRAIPS
           RGQ-LVVPQ-F-V---AG--G-E----K---NA-TS-------V-RAIP-
Sequence 2 RGQILVVPQGFAVVLKAGREGLEWVELKNSGNAITSPIGGRTSVLRAIPV

Sequence 1 EVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA---
           EVLA-SY---------LK----------P---------------
Sequence 2 EVLANSYDISTKEAYKLKNGRQEVEVFRPFQSRDEKERERFSIV



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru du 6.0201, Sequence: ADN39441
Sequence identity: 39.61 (223/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISS---SKLNECQLNNLNALEPDHRVE
           ------------CLLLL---C-A----------E-QLN-L-A-EPD----
Sequence 2 ------------CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQ

Sequence 1 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG
           SE-G----WN---P----AGV-V---T---NGLHLPSY---P--I-I--G
Sequence 2 SEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRG

Sequence 1 KGALGVAIPGCPETFEEPQEQ-------------SNRRGSRSQKQ----Q
           -G-LG---PGC-ETFE--Q-Q-------------S---G---Q-Q-----
Sequence 2 RGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGED

Sequence 1 LQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQL
           -QD-HQKIRH--EGD----P-GV-YW-YN-G--P-VA-SLLD--N--NQL
Sequence 2 QQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQL

Sequence 1 DQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVL
           DQ-PR-FYLAGNP--E-------QQQ-----GR-Q-Q-QQ-----G----
Sequence 2 DQVPRRFYLAGNPQDEF----NPQQQ-----GRQQQQQQQGQQGNGNNIF

Sequence 1 SGFSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQ
           SGF----LAQ--N-N---A--LQ--DD-R--IV-V-G-L---SP------
Sequence 2 SGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPF-----

Sequence 1 DEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGK
           ---------------------R---G---Q-----E-----------Q--
Sequence 2 --------------------SRSAGGRGDQERQQEEQ----------QSQ

Sequence 1 REQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGV
           RE----Q-E-E-------------------------------G----NGV
Sequence 2 REREEKQREQEQQG----------------------------GGGQDNGV

Sequence 1 EENICTLKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYV
           EE--C---L--NI--PSRADFYNP--GRIS--N---LP-LR---LSA---
Sequence 2 EETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKG

Sequence 1 VLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLL
           VLY-N-IY-PHW--NAN---Y--RG---V-VVN--G----D-E-R-GQL-
Sequence 2 VLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLF

Sequence 1 VVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAH
           --PQN--V--QA---GFEYI-F-T--N--T--L-----V-RA-P-EVL--
Sequence 2 LIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQN

Sequence 1 SYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVKVA--
           -----------LKY------L----S------------
Sequence 2 AFRISRQEARNLKYNRQESRLLSATSPPRGRLMSILGY



Alignment 17
Sequence 1:
Sequence 2: Allergen Pis v 5.0101, Sequence: EU410073
Sequence identity: 39.43 (222/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAI--SSSKLNECQLNNLNALEPDHRVES
           M--P--LSLS--CLL-L---C-A--------NECQ---L-ALEPD-RVE-
Sequence 2 MANPSLLSLS-VCLLILFHGCLASRQQGQQQNECQIDQLDALEPDNRVEY

Sequence 1 EGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGK
           E-G---TW---H----CAGV-V---T---NGL-LP-YS--P----I--G-
Sequence 2 EAGMVETWDPNHEQFRCAGVAVARHTIQPNGLRLPEYSNAPTLMYIVEGE

Sequence 1 GALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLV
           G--G--IPGCPET---PQ-Q----G---Q----QD-HQKI--F--GD---
Sequence 2 GMTGTLIPGCPETYQAPQ-QGQQHG---QSSRFQDKHQKIQRFRKGDIIA

Sequence 1 IPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYP
           -P-GV--W-YN-G--PVV---LLD-SN--NQLD--PR-F-LAGNP--E--
Sequence 2 LPAGVANWCYNEGNSPVVTVTLLDVSNSQNQLDMYPRKFNLAGNPEDEF-

Sequence 1 ETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDI
           ---QQQQQQ-S-G-R-Q-Q--------------GF----LA--F------
Sequence 2 ---QQQQQQQSRG-RRQSQQKSCN-----NIFCGFDTKILAEVFQVEQSL

Sequence 1 AEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSH
           ---LQ---D-R--IV-V-G-L-VI--------------------------
Sequence 2 VKQLQNEKDNRGAIVKVKGDLQVI-------------------------R

Sequence 1 PPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQP
           PPRR-S-------E-E-E-E----------G-R--D--------------
Sequence 2 PPRRQSE-RGFESEEESEYE---------RGRRGRD--------------

Sequence 1 RKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSR
           -----------------------------NG-EE-ICT-KL-ENI--PSR
Sequence 2 -----------------------------NGLEETICTMKLKENIHDPSR

Sequence 1 ADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANS
           -D-Y-P--GRI--LNSL-LP-L---QLSA---VL--N----PHWN-NA-S
Sequence 2 SDIYTPEVGRITSLNSLNLPILKWLQLSAERGVLQNNALMVPHWNFNAHS

Sequence 1 VIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFE
           --Y---G---V-VV---GN-VFDGE---GQ--VVPQNF-V---A--Q-FE
Sequence 2 IVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQNFAVVKRARGQRFE

Sequence 1 YIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYEGNW
           -I-FKT---A--S-L-----V-RA-P-EVLA-------------K-----
Sequence 2 WISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKFNNEQ

Sequence 1 GPLVNPESQQGSPRVKVA
           --L----S-Q--------
Sequence 2 PTLSSGQSSQQMRDDA--



Alignment 18
Sequence 1:
Sequence 2: Allergen Gly m 6.0301, Sequence: P11828
Sequence identity: 42.63 (240/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAIS---SSKLNECQLNNLNALEPDHRVE
           ----------SLC-LL-S--CFA-S-------NECQ---LNAL-PD-R-E
Sequence 2 ----MAKLVLSLCFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIE

Sequence 1 SEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQG
           SEGG-I-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG
Sequence 2 SEGGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNAPQEIYIQQG

Sequence 1 KGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVL
           -G--G---PGCP-TFEEPQ----------Q----QD-HQKI-HF-EGD--
Sequence 2 SGIFGMIFPGCPSTFEEPQQ-------KGQSSRPQDRHQKIYHFREGDLI

Sequence 1 VIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEY
           --P-G--YW-YN--D-PVVA-SL-DT--F-NQLDQ-PR-FYLAGN---E-
Sequence 2 AVPTGFAYWMYNNEDTPVVAVSLIDTNSFQNQLDQMPRRFYLAGNQEQEF

Sequence 1 PETMQQQQQQKSHGGR--KQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTN
           -----Q-Q-QK--GG-----G--QQEEE-EGGS-LSGF---FL---F---
Sequence 2 ----LQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFAPEFLEHAFVVD

Sequence 1 EDIAEKLQSPDDERKQ--IVTVEGGLSVISPKWQEQQDEDEDEDEDDEDE
           --I--KLQ----E-----IVTV-GGLSVISP---EQQ-------------
Sequence 2 RQIVRKLQGENEEEEKGAIVTVKGGLSVISPPTEEQQ-------------

Sequence 1 QIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDE
           --------RP------------E-E-KP--------------D-DE----
Sequence 2 -------QRP------------EEEEKP--------------DCDE----

Sequence 1 DEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENI
           -------------K--Q----------------RNG--E-ICT--L--NI
Sequence 2 -----------KDKHCQS-------------QSRNGIDETICTMRLRHNI

Sequence 1 ARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWN
           ---S--D--NP-AG-I-T--SL--PAL----LSAQ---L-KN----PH-N
Sequence 2 GQTSSPDIFNPQAGSITTATSLDFPALSWLKLSAQFGSLRKNAMFVPHYN

Sequence 1 LNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAG
           LNANS-IY---G---V-VVNC-G--VFDGEL--GQ-L-VPQNF-VA----
Sequence 2 LNANSIIYALNGRALVQVVNCNGERVFDGELQEGQVLIVPQNFAVAARSQ

Sequence 1 EQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELK
           ---FEY--FKT--------L--------A-P-EV-----NLR--Q----K
Sequence 2 SDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFNLRRQQARQVK

Sequence 1 YEGNWGPLVNPESQQGSPRVKVA
           -------LV-P---Q--------
Sequence 2 NNNPFSFLVPPKESQRRVVA---



Alignment 19
Sequence 1:
Sequence 2: Allergen Gly m 6.0201, Sequence: P04405
Sequence identity: 41.03 (231/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAIS-SSKLNECQLNNLNALEPDHRVESE
           ----------SLC-LL-S--CFA-------NECQ---LNAL-PD-R-ESE
Sequence 2 ----MAKLVLSLCFLLFSG-CFALREQAQQNECQIQKLNALKPDNRIESE

Sequence 1 GGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKG
           GG-I-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG-G
Sequence 2 GGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNG

Sequence 1 ALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVI
           --G---PGCP-T--EPQE-S--RG-RSQ--Q--D-HQK---F-EGD----
Sequence 2 IFGMIFPGCPSTYQEPQE-SQQRG-RSQRPQ--DRHQKVHRFREGDLIAV

Sequence 1 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPE
           P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN---E---
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEF--

Sequence 1 TMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIA
           ----QQQQ---G---Q---QQEEE-EG---LSGF---FL---F--N--I-
Sequence 2 -LKYQQQQQG-GSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIV

Sequence 1 EKLQSPDDERKQ--IVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPS
           --LQ----E-----IVTV-GGL-V--P-----------------------
Sequence 2 RNLQGENEEEDSGAIVTVKGGLRVTAPAM---------------------

Sequence 1 HPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQ
           ---R-P------Q-ED-D--E--P-------G---Q--------------
Sequence 2 ---RKP-----QQEEDDDDEEEQPQCVETDKGCQRQ--------------

Sequence 1 PRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPS
           --------SK-------------------RNG--E-ICT--L--NI---S
Sequence 2 --------SKRS-----------------RNGIDETICTMRLRQNIGQNS

Sequence 1 RADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNAN
           --D-YNP-AG-I-T--SL--PAL----LSAQY--L-KN----PH--LNAN
Sequence 2 SPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNAN

Sequence 1 SVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGF
           S-IY---G---V-VVNC-G--VFDGEL--G--L-VPQNF-VA-------F
Sequence 2 SIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNF

Sequence 1 EYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYEGN
           EY--FKT--------L--------A-P-EV--H--NL---Q----K----
Sequence 2 EYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNP

Sequence 1 WGPLVNPESQQGSPRVKVA
           ---LV-P---Q--------
Sequence 2 FSFLVPPQESQRRAVA---



Alignment 20
Sequence 1:
Sequence 2: Allergen Gly m glycinin G2, Sequence: CAA68460
Sequence identity: 41.03 (231/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAIS-SSKLNECQLNNLNALEPDHRVESE
           ----------SLC-LL-S--CFA-------NECQ---LNAL-PD-R-ESE
Sequence 2 ----MAKLVLSLCFLLFSG-CFALREQAQQNECQIQKLNALKPDNRIESE

Sequence 1 GGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKG
           GG-I-TWN-------CAGV--S--TLNRN-L--PSY---P--I-I-QG-G
Sequence 2 GGFIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGNG

Sequence 1 ALGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVI
           --G---PGCP-T--EPQE-S--RG-RSQ--Q--D-HQK---F-EGD----
Sequence 2 IFGMIFPGCPSTYQEPQE-SQQRG-RSQRPQ--DRHQKVHRFREGDLIAV

Sequence 1 PPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPE
           P-GV--W-YN--D-PVVA-S--DT----NQLDQ-PR-FYLAGN---E---
Sequence 2 PTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEF--

Sequence 1 TMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIA
           ----QQQQ---G---Q---QQEEE-EG---LSGF---FL---F--N--I-
Sequence 2 -LKYQQQQQG-GSQSQKGKQQEEENEGSNILSGFAPEFLKEAFGVNMQIV

Sequence 1 EKLQSPDDERKQ--IVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPS
           --LQ----E-----IVTV-GGL-V--P-----------------------
Sequence 2 RNLQGENEEEDSGAIVTVKGGLRVTAPAM---------------------

Sequence 1 HPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQ
           ---R-P------Q-ED-D--E--P-------G---Q--------------
Sequence 2 ---RKP-----QQEEDDDDEEEQPQCVETDKGCQRQ--------------

Sequence 1 PRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPS
           --------SK-------------------RNG--E-ICT--L--NI---S
Sequence 2 --------SKRS-----------------RNGIDETICTMRLRQNIGQNS

Sequence 1 RADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNAN
           --D-YNP-AG-I-T--SL--PAL----LSAQY--L-KN----PH--LNAN
Sequence 2 SPDIYNPQAGSITTATSLDFPALWLLKLSAQYGSLRKNAMFVPHYTLNAN

Sequence 1 SVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGF
           S-IY---G---V-VVNC-G--VFDGEL--G--L-VPQNF-VA-------F
Sequence 2 SIIYALNGRALVQVVNCNGERVFDGELQEGGVLIVPQNFAVAAKSQSDNF

Sequence 1 EYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSELKYEGN
           EY--FKT--------L--------A-P-EV--H--NL---Q----K----
Sequence 2 EYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQQARQVKNNNP

Sequence 1 WGPLVNPESQQGSPRVKVA
           ---LV-P---Q--------
Sequence 2 FSFLVPPQESQRRAVA---



Alignment 21
Sequence 1:
Sequence 2: Allergen Ber e 2, Sequence: AAO38859
Sequence identity: 36.23 (204/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAIS--SSKLNECQLNNLNALEPDHRVES
           M-K-F-LSL------LL---C-AI------L-EC----L-A-EP--R-E-
Sequence 2 MAKLFLLSLG---IFLLFHCCLAIEYEQEELYECRIQRLTAQEPQYRLEA

Sequence 1 EGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGK
           E-G----W--------CAGV-----T----GL-LP-Y---P------QG-
Sequence 2 EAGVSEVWDYTDQQFRCAGVAALRNTIRPQGLLLPVYTNAPKLYYVTQGR

Sequence 1 GALGVAIPGCPETFEEPQEQSNRRGSRSQKQQ---LQDSHQKIRHFNEGD
           G-LGV--PGCPETF---Q--S---GSR-Q-------QD-HQK--H---GD
Sequence 2 GILGVLMPGCPETF---QSMSQFQGSREQEEERGRFQDQHQKVHHLKKGD

Sequence 1 VLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDI
           ---IP-GV--W-YN-GDE--V------T----NQLDQ-PR-F-LAGN---
Sequence 2 IIAIPAGVALWCYNDGDEDLVTVLVQHTASDLNQLDQNPRHFFLAGN---

Sequence 1 EYPETMQQQQQQKSHG-GRKQGQHQQEEEEEGGSVLSGFSKHFLAQ--SF
           ------Q--Q-Q-----G---GQ-----------V--GF----LA----F
Sequence 2 -----IQRSQKQRGERYGLRGGQQILAD-----NVFKGFNMEALADVLGF

Sequence 1 NTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDED
           ------A-K----DD-R--IV-VE-GL-VI--------------------
Sequence 2 GMDTETARKVRGEDDQRGHIVRVEQGLKVI--------------------

Sequence 1 EQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDED
           ------PPR-----------------------------RE----Q-----
Sequence 2 -----RPPR----------------------------IREELEQQ-----

Sequence 1 EDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHEN
           ----------------------------E-G----NG-EE-IC------N
Sequence 2 ----------------------------EGG--GYNGLEETICSATFIQN

Sequence 1 IARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHW
           I--P--ADFYNP-AGR--T-NSL--P-L---QLSA---VLY-N----P-W
Sequence 2 IDNPAEADFYNPRAGRLTTVNSLKVPILTFLQLSAMKGVLYENAMMAPLW

Sequence 1 NLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQA
           -LNANSV-Y--RG---V--V---G--VFD--LR-GQ--VVPQNFVV--QA
Sequence 2 RLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVVVPQNFVVVKQA

Sequence 1 GEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSEL
           G--GFE--VF-T--NA--S---------R-IP--VLA--Y-L-Q------
Sequence 2 GSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARRI

Sequence 1 KYEGNWGPLVNPESQQGSPRVKVA
           K-------L--P-S----------
Sequence 2 KLNRDEAVLFQPGSRSRGRASA--



Alignment 22
Sequence 1:
Sequence 2: Allergen Pis v 2.0201, Sequence: DQ631677
Sequence identity: 35.52 (200/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFA-----ISSSK-------LNECQLNNLN
           MG----LS-S-L--LLL----FA-------S------------CQ--NLN
Sequence 2 MGYSSLLSFS-LGFLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLN

Sequence 1 ALEPDHRVESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPY
           ALEP--R-ESE-G----W------L-CA-V-V---T----GL--PSY---
Sequence 2 ALEPKRRIESEAGVTEFWDQNEEQLQCANVAVFRHTIQSRGLLVPSYNNA

Sequence 1 PRMIIIAQGKGALGVAIPGCPETF-EEPQEQSNRRGSRSQK-QQLQDSHQ
           P------QG-G--G---PGCPETF-EE-Q-QS----SRS---QQ----HQ
Sequence 2 PELVYVVQGSGIHGAVFPGCPETFQEESQSQSRSQHSRSERSQQSGEQHQ

Sequence 1 KIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRV
           K-RH--EGD----P-GV--W-YN-G----V---L-D--N--NQLDQ--R-
Sequence 2 KVRHIREGDIIALPAGVAHWIYNNGQSKLVLVALADVGNSENQLDQYLRK

Sequence 1 FYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKH
           F-L-G-P--E-----Q---Q--S------GQ------------LS-F---
Sequence 2 FVLGGSPQQEIQGGGQSWSQSRSS---RKGQ-------QSNNILSAFDEE

Sequence 1 FLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDE
           -LAQSFN-------KLQ-----R--IV-V---L-V-SP--QE----D---
Sequence 2 ILAQSFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSPQRQEKEYSD---

Sequence 1 DEDDEDEQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQD
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 QDEDEDEDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICT
           -----------------------------------------NG-EE--CT
Sequence 2 -----------------------------------------NGLEETFCT

Sequence 1 LKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG
           --L--NI--PSRAD-YNP--GR----N-L-LP-LR--QLS----VLY-N-
Sequence 2 MTLKLNINDPSRADVYNPRGGRVTSINALNLPILRFLQLSVEKGVLYQNA

Sequence 1 IYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNF
           I--PHWN-NA-S--Y-TRG-G----V---G--VFD-E-R-GQL-VVPQNF
Sequence 2 IMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIREGQLVVVPQNF

Sequence 1 VVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSYNLRQ
           -V---A---GFE---FKT---A--S-L-----V-R--P--V---S-----
Sequence 2 AVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDISR

Sequence 1 SQVSELKYEGNWGPLVNPESQQGSPRVKVA
           -----LK----------P-S-----R----
Sequence 2 EDAWNLKESRSEMTIFAPGSRSQRQRN---



Alignment 23
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: O82580
Sequence identity: 39.25 (221/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           -----------------------------N-CQ---LNA--PD-R-ESEG
Sequence 2 -----------------------RQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           G-I-TWN----E--CAGV--S-L-L-RN-L--P-YS--P--I-I-QG-G-
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRHF
           -G---PGCP---EEP--Q--R--S-----------Q-QQ--DSHQK---F
Sequence 2 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF

Sequence 1 NEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAG
           -EGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LAG
Sequence 2 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NPDIEY------------------PETMQQQQQQKSHGGRKQGQHQ----
           N---E-------------------P---Q-Q--Q--------GQH-----
Sequence 2 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER

Sequence 1 --QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIVT
           --QEEE-EGG---SGF---FL-Q-F------I---L-------E---IVT
Sequence 2 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT

Sequence 1 VEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDE
           V-GGL---SP------DE-E--DED-------------------E-DE--
Sequence 2 VRGGLRILSPDRKRRADEEEEYDEDE-----------------YEYDE--

Sequence 1 DEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRP
           ---ED--R--R-S-G-----------------------------------
Sequence 2 ---EDRRR-GRGSRG-----------------------------------

Sequence 1 RQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNS
           -------RG----NG-EE-ICT-----NI-R----D-YNP-AG---T-N-
Sequence 2 -------RG----NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND

Sequence 1 LTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNC
           L-L--LR----SA-Y--LY-N-----H-N-NA-S-IY--RG---V-VV--
Sequence 2 LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDS

Sequence 1 QGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL-
           -GN-V-D-EL--G--LVVPQNF-VA-------FEY--FKT--------L-
Sequence 2 NGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLA

Sequence 1 --KDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVK
           ----V----P-EV-A-SY-L---Q---LK--------V-P-SQQ-SPR--
Sequence 2 GENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFV-PPSQQ-SPRAV

Sequence 1 VA
           --
Sequence 2 A-



Alignment 24
Sequence 1:
Sequence 2: Allergen Ara h 3, Sequence: AAC63045
Sequence identity: 39.25 (221/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           -----------------------------N-CQ---LNA--PD-R-ESEG
Sequence 2 --------------------ISFRQQPEENACQFQRLNAQRPDNRIESEG

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           G-I-TWN----E--CAGV--S-L-L-RN-L--P-YS--P--I-I-QG-G-
Sequence 2 GYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGY

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRHF
           -G---PGCP---EEP--Q--R--S-----------Q-QQ--DSHQK---F
Sequence 2 FGLIFPGCPRHYEEPHTQGRRSQSQRPPRRLQGEDQSQQQRDSHQKVHRF

Sequence 1 NEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAG
           -EGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LAG
Sequence 2 DEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAG

Sequence 1 NPDIEY------------------PETMQQQQQQKSHGGRKQGQHQ----
           N---E-------------------P---Q-Q--Q--------GQH-----
Sequence 2 NTEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRER

Sequence 1 --QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIVT
           --QEEE-EGG---SGF---FL-Q-F------I---L-------E---IVT
Sequence 2 AGQEEENEGGNIFSGFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVT

Sequence 1 VEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDEDE
           V-GGL---SP------DE-E--DED-------------------E-DE--
Sequence 2 VRGGLRILSPDRKRRADEEEEYDEDE-----------------YEYDE--

Sequence 1 DEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRRP
           ---ED--R--R-S-G-----------------------------------
Sequence 2 ---EDRRR-GRGSRG-----------------------------------

Sequence 1 RQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLNS
           -------RG----NG-EE-ICT-----NI-R----D-YNP-AG---T-N-
Sequence 2 -------RG----NGIEETICTASAKKNIGRNRSPDIYNPQAGSLKTAND

Sequence 1 LTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNC
           L-L--LR----SA-Y--LY-N-----H-N-NA-S-IY--RG---V-VV--
Sequence 2 LNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDS

Sequence 1 QGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYL-
           -GN-V-D-EL--G--LVVPQNF-VA-------FEY--FKT--------L-
Sequence 2 NGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLA

Sequence 1 --KDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRVK
           ----V----P-EV-A-SY-L---Q---LK--------V-P-SQQ-SPR--
Sequence 2 GENSVIDNLPEEVVANSYGLQREQARQLKNNNPFKFFV-PPSQQ-SPRAV

Sequence 1 VA
           --
Sequence 2 A-



Alignment 25
Sequence 1:
Sequence 2: Allergen Sin a 2.0101, Sequence: Q2TLW0
Sequence identity: 32.68 (184/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKL-----NECQLNNLNALEPDHR
           M-K---L-------LL----C-A--S----------C-L-NL--L-P---
Sequence 2 MVKLAHLLVATVGVLLVLNGCLARQSLGVPPQVKDACNLDNLDVLQPTEV

Sequence 1 VESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIA
           --SE-G----W---HP---CAGV----L-----GL-LP-----P------
Sequence 2 IKSEAGQVEYWDHNHPQIRCAGVSIARLVIQKGGLYLPTFFSSPFISYVV

Sequence 1 QGKGALGVAIPGCPETFEEPQ----EQSNRRGSRSQK-------------
           QG-G--G--IPGC-ETF---Q-----Q----G---Q--------------
Sequence 2 QGMGISGRVIPGCAETFMDSQPMQGQQGQQQGQQGQQGQQGQQGQQGQQG

Sequence 1 ---QQLQ------------------DSHQKIRHFNEGDVLVIPPGVPYWT
           ---QQ-Q------------------D-HQK--H---GD-----PG---W-
Sequence 2 QQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAMTPGSAQWI

Sequence 1 YNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQ
           YNTGD-P----SL-D--N--NQLD--PR-F-LAGN---------QQQQQQ
Sequence 2 YNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGNN--QQGSSQQQQQQQ

Sequence 1 KSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAEKLQSPDD
           ----------------------LSGF----LAQ--------A--LQ---D
Sequence 2 QN-------------------ILSGFDPQVLAQALKIDVRLAQELQNQQD

Sequence 1 ERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGK
           -R--IV-V-G---V---------------------------PP-R-----
Sequence 2 KRGNIVRVKGPFQVV-------------------------RPPLR-----

Sequence 1 REQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSK
           ---------------------------------------Q---S--WR--
Sequence 2 ---------------------------------------QAYESEQWR--

Sequence 1 KTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAG
           ---PR-P-Q--P--------NG-EE-IC----HENI--P-RAD-Y-P--G
Sequence 2 --HPRGPPQS-PQD------NGLEETICSMRTHENIDDPARADIYKPNLG

Sequence 1 RISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQG
           R----NS-TLP-L----LSA----L-------P--N-NAN---Y-T-GQ-
Sequence 2 RVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQA

Sequence 1 KVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHN
           ---VVN--G--V-D-----GQL-V-PQ-F----Q-----FE-I-FKT--N
Sequence 2 RIQVVNDNGQNVLDQQVQKGQLVVIPQGFAYVVQS-QNNFEWISFKTNAN

Sequence 1 AVTSYLK---DVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQ
           A--S-L-------RA-P-EV----Y----------K-------L------
Sequence 2 AMISTLAGRTSALRALPLEVITNAYQISLEEARKIKFNTLETTLTRARGG

Sequence 1 QGSPRVKVA---
           Q-----------
Sequence 2 QQPQLIEEIVEV



Alignment 26
Sequence 1:
Sequence 2: Allergen Ses i 6.0101, Sequence: Q9XHP0
Sequence identity: 27.89 (157/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISS----SKLNECQLNNLNALEPDHRV
           --------L--L-L-LL-SA--A------------C---------P--R-
Sequence 2 --MVAFKFLLALSLSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRI

Sequence 1 ESEGGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQ
           -SEGG----W--------CAG------T---NGL-LP-Y-P-PR---I--
Sequence 2 QSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIER

Sequence 1 GKGALGVAIPGCPETFEEPQEQSNRRGSRSQKQQ----LQDSHQKIRHFN
           G-G------PGC-ET------Q----------QQ------D-HQK-----
Sequence 2 GQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLR

Sequence 1 EGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGN
           -GD---IP-G---W-YN-G-E--VA-S--D-----NQLDQ--R-FYLAG-
Sequence 2 QGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGG

Sequence 1 PDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSF
           -----P----Q-QQ--------Q--H--------------F----L---F
Sequence 2 ----VPRSGEQEQQAR------QTFH---------NIFRAFDAELLSEAF

Sequence 1 NTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDED
           N---------QS---ER--IV----------P------DE-E-E-E----
Sequence 2 NVPQETIRRMQSEEEERGLIVMARERMTFVRP------DEEEGEQE----

Sequence 1 EQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDED
           ------------H--R--D-------------------------------
Sequence 2 ------------HRGRQLD-------------------------------

Sequence 1 EDEDQPRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHEN
           -----------------------------------NG-EE--CT-K---N
Sequence 2 -----------------------------------NGLEETFCTMKFRTN

Sequence 1 IARPSRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNGIYSPHW
           ------AD-----AGR--------LP-L----LSA----LY-N---SP-W
Sequence 2 VESRREADIFSRQAGRVHVVDRNKLPILKYMDLSAEKGNLYSNALVSPDW

Sequence 1 NLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQA
           --------YVTRG---V-VV---G-A--------G---VVPQ-------A
Sequence 2 SMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQYYTSTARA

Sequence 1 GEQGFEYIVFKTHHNAVTSYL---KDVFRAIPSEVLAHSYNLRQSQVSEL
           G--GFE---FKT------S-L-----V-RA-P--V---SY-----Q---L
Sequence 2 GNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQAL

Sequence 1 KYE-GNWGPLVNPESQQGSPRVKVA
           K---G----L--P------------
Sequence 2 KMNRGSQSFLLSPGGRRS-------



Alignment 27
Sequence 1:
Sequence 2: Allergen Ara h 4, Sequence: AAD47382
Sequence identity: 39.43 (222/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAI-SSSKLNECQLNNLNALEPDHRVESE
           M-K---LS----C-L-L-------------N-CQ---LNA--PD-R-ESE
Sequence 2 MAKLLELSFC-FCFLVLGASSISFRQQPEENACQFQRLNAQRPDNRIESE

Sequence 1 GGLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKG
           GG-I-TWN----E--CAGV--S-L-L-RN-L--P-YS--P--I-I-QG-G
Sequence 2 GGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRG

Sequence 1 ALGVAIPGCPETFEEPQEQSNRRGSR---------SQKQQLQDSHQKIRH
           --G---PGCP-T-EEP--Q--R--S-----------Q-QQ-QDSHQK---
Sequence 2 YFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHR

Sequence 1 FNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLA
           FNEGD----P-GV--W-YN--D--VVA-SL-DT-N--NQLDQ-PR-F-LA
Sequence 2 FNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLA

Sequence 1 GNPDIEYPETMQQQQQQKS----------HGG--------RKQGQHQ---
           GN---E-----QQ--Q-------------H----------R--GQH----
Sequence 2 GNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRPRGQHSRRE

Sequence 1 ---QEEEEEGGSVLSGFSKHFLAQSFNTNE-DIAEKL--QSPDDERKQIV
           ---QEEE-EGG---SGF---FL-Q-F------I---L-------E---IV
Sequence 2 RAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIV

Sequence 1 TVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPPRRPSHGKREQDED
           TV-GGL---SP------DE-E--DED----Q---H----------EQD--
Sequence 2 TVRGGLRILSPDGTRGADEEEEYDED----QYEYH----------EQD--

Sequence 1 EDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSREWRSKKTQPRR
           --------R--R-S-G----------------------------------
Sequence 2 -------GRRGRGSRGG---------------------------------

Sequence 1 PRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTLN
           ---------G----NG-EE-ICT-----NI--------Y-P---------
Sequence 2 ---------G----NGIEETICTACVKKNIGGNRSPHIYDPQRWFTQNCH

Sequence 1 SLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVN
           -L-L--LR---LSA-Y--LY-N----PH-N-NA-S-IY--RG---V-VV-
Sequence 2 DLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAHSIIYALRGRAHVQVVD

Sequence 1 CQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTH-HNAVTSY
           --GN-V-D-EL--G--LVVPQNF-VA-------FEY--FKT---------
Sequence 2 SNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANF

Sequence 1 LKD--VFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQGSPRV
           ----------P-EV-A-SY-L---Q---LK--------V-P--Q--SPR-
Sequence 2 AGENSFIDNLPEEVVANSYGLPREQARQLKNNNPFKFFVPPFQQ--SPRA

Sequence 1 KVA
           ---
Sequence 2 VA-



Alignment 28
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: CAA35691
Sequence identity: 16.34 (92/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
           -----------------------------L-----V----G----E----
Sequence 2 -----------------MMRARFPLLLLGLVFLASVSVSFGIAYWEKENP

Sequence 1 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
           ------Q-----R-----Q-------------------------------
Sequence 2 KHNKCLQSCNSERDSYRNQACHARCNLLKVEKEECEEGEIPRPRPRPQHP

Sequence 1 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
           ---------K-----E-------P--Q--Q-E---E-E--E----P----
Sequence 2 EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEE---EHEQREEQEWPRKEE

Sequence 1 RRPSHGKREQDEDEDEDEDK---PRPSRPSQGKREQDQDQDEDEDEDEDQ
           -R---G--E-DEDEDE--D----P-P-RP---K-E------E-EDEDE-Q
Sequence 2 KRGEKGSEEEDEDEDEEQDERQFPFP-RPPHQKEERN----EEEDEDEEQ

Sequence 1 PRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEEN-ICTLKLHENIARP
           -R-S-E--S-----RR-----P---G---------N--------------
Sequence 2 QRESEE--SEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR

Sequence 1 SRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG--IYS-----
           S-----N----RI---NS-----L------A-Y-----NG--I-S-----
Sequence 2 S-PQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNND

Sequence 1 --PHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFV
           ------L-------V--G-----VVN---N-----E--R---L--P-N--
Sequence 2 DRDSYRLQSGDALRVPSGT-TYYVVNPDNN-----ENLRLITLAIPVN--

Sequence 1 VAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVS
           -----G---FE---F-----A--SYL----R-I----L--SY--------
Sequence 2 ---KPGR--FESF-FLSSTEAQQSYLQGFSRNI----LEASYDTKFEEIN

Sequence 1 ELKYEGNWGPLVNPESQQGSPRVKVA------------------------
           --------G-------QQG--R----------------------------
Sequence 2 KVLFSREEG------QQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVIS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLS

Sequence 1 -------
           -------
Sequence 2 SILRAFY



Alignment 29
Sequence 1:
Sequence 2: Allergen Gly m 5.0101, Sequence: O22120
Sequence identity: 15.10 (85/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
           --------------------------------------------------
Sequence 2 -----------------------------VEKEECEEGEIPRPRPRPQHP

Sequence 1 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
           ---------K-----E-------P--Q--Q-E---E-E--E----P----
Sequence 2 EREPQQPGEKEEDEDEQPRPIPFPRPQPRQEE---EHEQREEQEWPRKEE

Sequence 1 RRPSHGKREQDEDEDEDEDK---PRPSRPSQGKREQDQDQDEDEDEDEDQ
           -R---G--E-DEDEDE--D----P-P-RP---K-E--Q-----EDEDE-Q
Sequence 2 KRGEKGSEEEDEDEDEEQDERQFPFP-RPPHQKEERKQE----EDEDEEQ

Sequence 1 PRKSREWRSKKTQPRRPRQEEPRERGCETRNGVEEN-ICTLKLHENIARP
           -R-S-E--S-----RR-----P---G---------N--------------
Sequence 2 QRESEE--SEDSELRRHKNKNPFLFGSNRFETLFKNQYGRIRVLQRFNQR

Sequence 1 SRADFYNPKAGRISTLNSLTLPALRQFQLSAQYVVLYKNG--IYS-----
           S-----N----RI---NS-----L------A-Y-----NG--I-S-----
Sequence 2 S-PQLQNLRDYRILEFNSKPNTLLLPNHADADYLIVILNGTAILSLVNND

Sequence 1 --PHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDGELRRGQLLVVPQNFV
           ------L-------V--G-----VVN---N-----E--R---L--P-N--
Sequence 2 DRDSYRLQSGDALRVPSGT-TYYVVNPDNN-----ENLRLITLAIPVN--

Sequence 1 VAEQAGEQGFEYIVFKTHHNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVS
           -----G---FE---F-----A--SYL----R-I----L--SY--------
Sequence 2 ---KPGR--FESF-FLSSTEAQQSYLQGFSRNI----LEASYDTKFEEIN

Sequence 1 ELKYEGNWGPLVNPESQQGSPRVKVA------------------------
           --------G-------QQG--R----------------------------
Sequence 2 KVLFSREEG------QQQGEQRLQESVIVEISKEQIRALSKRAKSSSRKT

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ISSEDKPFNLRSRDPIYSNKLGKFFEITPEKNPQLRDLDIFLSIVDMNEG

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRA

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 ELSEQDIFVIPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVIS

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 QIPSQVQELAFPGSAQAVEKLLKNQRESYFVDAQPKKKEEGNKGRKGPLS

Sequence 1 -------
           -------
Sequence 2 SILRAFY



Alignment 30
Sequence 1:
Sequence 2: Allergen Gly m 5.0201, Sequence: Q9FZP9
Sequence identity: 13.85 (78/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
           -------E---------------P----QQ-----EDE-------P---P
Sequence 2 ----VEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRP

Sequence 1 RRP----SHGKREQDE-------------DEDEDE-DKPRPSRPSQGKRE
           R-P-----H---E--E--------------E--DE---PRP--P-Q---E
Sequence 2 RQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEE

Sequence 1 Q--------------DQDQDEDEDEDEDQPRKSREWRSKKTQ--PRRPRQ
           --------------------ED-DEDE-Q---S-E------Q--PRR---
Sequence 2 KHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKN

Sequence 1 EEPRERGCETRNGVEEN-ICTLKLHENIARPSRADFYNPKAGRISTLNSL
           --P-------------N--------------S-----N----RI---NS-
Sequence 2 KNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ-QLQNLRDYRILEFNSK

Sequence 1 TLPALRQFQLSAQYVVLYKNG--IYS-------PHWNLNANSVIYVTRGQ
           ----L------A-Y-----NG--I------------NL-------V--G-
Sequence 2 PNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGT

Sequence 1 GKVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHH
           ----VVN---------E--R---L--P-N-------G---FE---F----
Sequence 2 -TYYVVNPDND-----ENLRMITLAIPVN-----KPGR--FESF-FLSST

Sequence 1 NAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQG
           -A--SYL-----------L--SY----------------G-----E--Q-
Sequence 2 QAQQSYLQ----GFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQE

Sequence 1 SPRVKVA-------------------------------------------
           S--V----------------------------------------------
Sequence 2 SVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLRSRDPIYSNKLGKLF

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 EITPEKNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVVVNATSDLN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPGSAKDIENLIKSQ

Sequence 1 --------------------------------
           --------------------------------
Sequence 2 SESYFVDAQPQQKEEGNKGRKGPLSSILRAFY



Alignment 31
Sequence 1:
Sequence 2: Allergen Gly m conglycinin, Sequence: AAB01374
Sequence identity: 12.97 (73/563)
Sequence 1 MGKPFTLSLSSLCLLLLSSACFAISSSKLNECQLNNLNALEPDHRVESEG
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 GLIQTWNSQHPELKCAGVTVSKLTLNRNGLHLPSYSPYPRMIIIAQGKGA
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 LGVAIPGCPETFEEPQEQSNRRGSRSQKQQLQDSHQKIRHFNEGDVLVIP
           --------------------------------------------------
Sequence 2 --------------------------------------------------

Sequence 1 PGVPYWTYNTGDEPVVAISLLDTSNFNNQLDQTPRVFYLAGNPDIEYPET
           --------------------------------------------------
Sequence 2 ------------------------------------------MMRARFPL

Sequence 1 MQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSGFSKHFLAQSFNTNEDIAE
           ---------------G----E---------------------N-------
Sequence 2 LLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARC

Sequence 1 KLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDEDEQIPSHPP
           -L-----E---------------P----QQ-----EDE-------P---P
Sequence 2 NLLKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRP

Sequence 1 RRPS----HGKREQDE-------------DEDEDE-DKPRPSRPSQG---
           R-P-----H---E--E--------------E--DE---PRP--P-Q----
Sequence 2 RQPHQEEEHEQKEEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEE

Sequence 1 ------KREQDQ-----DQDEDEDEDEDQPRKSREWRSKKTQ--PRRPRQ
           ------K-E--Q--------ED-DEDE-Q---S-E------Q--PRR---
Sequence 2 KHEWQHKQEKHQGKESEEEEEDQDEDEEQDKESQESEGSESQREPRRHKN

Sequence 1 EEPRERGCETRNGVEEN-ICTLKLHENIARPSRADFYNPKAGRISTLNSL
           --P-------------N--------------S-----N----RI---NS-
Sequence 2 KNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRSQ-QLQNLRDYRILEFNSK

Sequence 1 TLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQ
           ----L------A-Y-----NG--------N-----Y--------RV----
Sequence 2 PNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDALRVPAGT

Sequence 1 GNAVFDGELRRGQLLVVPQNFVVAEQAGEQGFEYIV----------FKTH
           ---V----------------F-V-----------I-----------F---
Sequence 2 TFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESF

Sequence 1 HNAVTSYLKDVFRAIPSEVLAHSYNLRQSQVSELKYEGNWGPLVNPESQQ
           ----T--------------L--SY----------------G-----E--Q
Sequence 2 FLSSTQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQ

Sequence 1 GSPRVKVA------------------------------------------
           -S--V---------------------------------------------
Sequence 2 ESVIVEISKKQIRELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKL

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FEITQRNPQLRDLDVFLSVVDMNEGALFLPHFNSKAIVVLVINEGEANIE

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 LVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIFVIPAGYPVMVNATSDLN

Sequence 1 --------------------------------------------------
           --------------------------------------------------
Sequence 2 FFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDIENLIKSQ

Sequence 1 --------------------------------
           --------------------------------
Sequence 2 SESYFVDAQPQQKEEGNKGRKGPLSSILRAFY


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.