The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Hel a 3.0101

Sequence P82007

Full FASTA alignment

Sequence name:
Query sequence:
MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI
STSIPINPNVNCNTIP

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Hel a 3.0101P82007Go!116165.63.2e-43
2Sola l 7.0101NP_001316123Go!11584.11.1e-18
3Api g 2ACV04796Go!11879.72.2e-17
4Ara h 9.0101ABX56711Go!11678.16.7e-17
5Mal d 3Q9M5X7Go!11576.32.3e-16
6Len c 3.0101A0AT29Go!11875.06.1e-16
7Cor a 8AAK28533Go!11574.67.9e-16
8Pyr c 3Q9M5X6Go!11574.49.1e-16
9Fra a 3.0101Q8VX12Go!11773.22.1e-15
10Pis s 3.0101A0A161AT60Go!12072.24.2e-15
11Lup an 3.0101XP_019446786Go!11671.66.3e-15
12Pla or 3.0101ABY21307Go!11871.47.3e-15
13Lyc e 3AAB42069Go!11471.28.2e-15
14Sola l 3.0101P93224Go!11471.28.2e-15
15Can s 3.0101W0U0V5Go!9170.69.4e-15
16Fra a 3.0102Q4PLT9Go!11770.61.3e-14
17Pla a 3.0101CAL07989Go!11870.61.3e-14
18Pru av 3Q9M5X8Go!11770.21.7e-14
19Hev b 12AAL25839Go!11669.82.2e-14
20Pha v 3.0101ADC80502Go!11569.03.7e-14
21Fra a 3.0202Q4PLT6Go!11769.03.8e-14
22Rub i 3.0101Q0Z8V0Go!11768.84.3e-14
23Pun g 1.0101A0A059STC4Go!12068.84.4e-14
24Fra a 3.0201Q4PLU0Go!11768.45.7e-14
25Ara h 17.0101A0A510A9S3Go!9367.96.6e-14
26Pru p 3CAB96876Go!9167.77.4e-14
27Tri tu 14.0101CAH69206Go!11568.07.5e-14
28Pru d 3P82534Go!9167.58.5e-14
29Art si 3.0102ANC85027Go!11667.88.6e-14
30Art v 3.0202ACE07187Go!11667.88.6e-14
31Art ar 3.0102ANC85020Go!11667.88.6e-14
32Pru ar 3P81651Go!9166.91.3e-13
33Pha v 3.0201ADC80503Go!11867.21.3e-13
34Ara h 9.0201ABX75045Go!9266.51.7e-13
35Pru p 3P81402Go!9166.12.2e-13
36Mor n 3.0101P85894Go!9166.12.2e-13
37Pru du 3.0101ACN11576Go!12366.42.3e-13
38Art ca 3.0102QIN55516Go!11765.44.5e-13
39Pun g 1.0201A0A059SSZ0Go!12065.44.6e-13
40Art la 3.0102ANC85025Go!11563.61.5e-12
41Art gm 3.0102ANC85023Go!11763.61.6e-12
42Art si 3.0101ANC85026Go!11663.41.8e-12
43Art v 3.0301EU564847Go!11763.41.8e-12
44Zea m 14.0101P19656-1Go!12063.12.4e-12
45Art v 3.0201EU564845Go!11462.63.1e-12
46Art ar 3.0101ANC85019Go!11662.63.1e-12
47Art la 3.0101ANC85024Go!11662.63.1e-12
48Art gm 3.0101ANC85022Go!11762.63.1e-12
49Pun g 1.0301A0A059ST23Go!12062.53.6e-12
50Zea m 14.0102P19656-2Go!12862.53.8e-12
51Art an 3.0101ANC85017Go!11760.91.1e-11
52Art ca 3.0101ANC85021Go!11760.91.1e-11
53Art an 3.0102ANC85018Go!11760.31.6e-11
54Hor v 1AAA32970Go!11758.36.4e-11
55Tri a 14.010119846220Go!9057.11.1e-10
56Hor v 1CAA42832Go!13457.61.2e-10
57Par j 1Q40905Go!13857.41.4e-10
58Par j 1O04404Go!17656.33.7e-10
59Par j 1P43217Go!13954.21.3e-09
60Amb a 6O04004Go!11853.91.3e-09
61Par j 2O04403Go!13353.81.6e-09
62Par j 1.0103CAI94601Go!13953.81.7e-09
63Par j 1.0101CAA54587Go!13351.48.6e-09
64Sin a 3.0101ABU95411Go!9250.89.1e-09
65Par j 2P55958Go!13350.22.0e-08
66Art v 3.0101P0C088Go!3736.76.1e-05
67Cas s 810998016Go!3633.94.1e-04
68Jug r 8.0201XP_018847114Go!9231.55.8e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 100.00 (116/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
Sequence 2 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI
           PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI
Sequence 2 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI

Sequence 1 STSIPINPNVNCNTIP
           STSIPINPNVNCNTIP
Sequence 2 STSIPINPNVNCNTIP



Alignment 2
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 50.00 (58/116)
Sequence 1 MKGTSMGVAILAMIVMA--QLMVHPSVAITCNDVTGNLTPCLPYLRSGGK
           --------AIL---V-A--QL------AITC--V--NL-PC-P-L--GG-
Sequence 2 ----MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGGE

Sequence 1 PTPACCAGAKKLLGATRTQADRRTACKCAKTAA---PQLKVRPDMASSLP
           P--ACC-G---L-G-T----DRRTAC-C-K-AA---P-LK---D-A-SLP
Sequence 2 PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLK--DDAAQSLP

Sequence 1 GKCGISTSIPINPNVNCNTIP
           -KCGIS---PI---VNC-TI-
Sequence 2 SKCGISLTVPISRTVNCDTIS



Alignment 3
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 47.41 (55/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMV----HPSVA--ITCNDVTGNLTPCLPYLR
           -----MGV---A--V---LMV----HP-V----TC--VTG-L--CL-YL-
Sequence 2 -----MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLK

Sequence 1 SGGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASS
           -GG-P-PACC-G-K-L-----T-ADR--AC-C-KT-A---K------AS-
Sequence 2 GGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASA

Sequence 1 LPGKCGISTSIPINPNVNCNTIP
           LPGKCGI----PI-P---C----
Sequence 2 LPGKCGIRIPYPISPSTDCSRVN



Alignment 4
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 42.24 (49/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           ----S---A------MA--------AI-C--V---L-PC-P-L--GG-P-
Sequence 2 --MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G---LLGA-RT-ADR--AC-C-K-AA--L-------A--LPG-CG
Sequence 2 PACCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCG

Sequence 1 ISTSIPINPNVNCNTIP-
           -S----I----NC-TI--
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 5
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 43.10 (50/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           ----S--V--LA--V-----V----AITC--VT--L-PC--Y-RSGG---
Sequence 2 --MASSAVTKLALVVALCMAVSVAHAITCGQVTSSLAPCIGYVRSGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G-----G--RT-ADR-TAC-C-K--A-----V-P--A--LPGKCG
Sequence 2 PACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I----NC-T--
Sequence 2 VNVPYKISTSTNCATVK



Alignment 6
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 41.38 (48/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V-A--------AI-C--VT--L-PCL-YL--G-
Sequence 2 MARGMKLACVVLVICMVVIAPMAEG---AISCGAVTSDLSPCLTYLTGGP

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPG
           -P-P-CC-G-KKLL-A--T--DR--AC-C-K-AA----K-----A--LPG
Sequence 2 GPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPG

Sequence 1 KCGISTSIPINPNVNCNTIP-
           KCG------I----NCNT---
Sequence 2 KCGVNIPYKISTTTNCNTVKF



Alignment 7
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 40.52 (47/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVA---ITCNDVTGNLTPCLPYLRSGG
           -----MG---L---V----MV---VA----TC----GNLTPC--YL--GG
Sequence 2 -----MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           ---P-CC-G------A-RT--DR--AC-C-K--A-------P--A--LPG
Sequence 2 VLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPG

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-P--NCN---
Sequence 2 KCGVNIPYKISPSTNCNNVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 42.24 (49/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           ----S--V--LA--V-----V----AITC--V--NL-PC--Y-RSGG---
Sequence 2 --MASSAVIKLALVVALCMAVSVAHAITCSQVSANLAPCINYVRSGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G-K---G---T--DR--AC-C-K--A-----V-P--A-SLPGKCG
Sequence 2 PACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I----NC-T--
Sequence 2 VNVPYKISTSTNCATVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 38.79 (45/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           ----T-M-----A-------------AITC--V--N--PCL-Y--SGG--
Sequence 2 MASSTAMKLSLVALLCIV-VALPIAQAITCGQVASNISPCLTYVKSGGAV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           --ACC-G---L-G---T-ADR--AC-C-K-AA---K---P--A--LPGKC
Sequence 2 PAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G-S----I----NC----
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 39.66 (46/116)
Sequence 1 MKGTSMGVAILAMIV-MAQLMVHPSVAITCNDVTGNLTPCLPYLRS--GG
           ----SM--A--A----M---------A--C--V-----PC--YL------
Sequence 2 -MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNA

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPG
           -P-P-CCAG-KKLL-A--T--DR--AC-C-K-AA----K-----A--LPG
Sequence 2 SPPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPG

Sequence 1 KCGISTSIPINPNVNCNTIP-
           KCG-S----I----NCNT---
Sequence 2 KCGVSIPYKISTSTNCNTVRF



Alignment 11
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 45.69 (53/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMV--HP-SVAITCNDVTGNLTPCLPYLRSGG
           ------G---LA--V-----V---P---AITC--VT-NL--CL-YLRSGG
Sequence 2 ----MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGG

Sequence 1 K-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLP
           --P-P-CC-G-K--L----T--DRRTAC-C-K-AA-------P--A-SLP
Sequence 2 AVPAP-CCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLP

Sequence 1 GKCGISTSIPINPNVNCNTIP
           GKCG------I----NC--I-
Sequence 2 GKCGVNIPYKISTSTNCASIK



Alignment 12
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 41.38 (48/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMV---HPSVAITCNDVTGNLTPCLPYLRSGG
           -------VA-LA----A-------H---AITC--V---LTPCL-YLRSGG
Sequence 2 --MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           ---PACC-G-K-L-----T--DR--AC-C-KTA-----------A-SL-G
Sequence 2 AVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-P---C----
Sequence 2 KCGVNLPYKISPTIDCSKVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 39.66 (46/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSV-AITCNDVTGNLTPCLPYLRSGGKP
           -----M---I----V-----V-P------C--VT--L-PCLPYL---G-P
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-P

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-G-K-LLGA--T--DR-TAC-C-K-AA---K------A--LPG-C
Sequence 2 LGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC

Sequence 1 GISTSIPINPNVNCNTIP
           G------I-P---C-T--
Sequence 2 GVNIPYKISPSTDCSTVQ



Alignment 14
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 39.66 (46/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSV-AITCNDVTGNLTPCLPYLRSGGKP
           -----M---I----V-----V-P------C--VT--L-PCLPYL---G-P
Sequence 2 ---MEMFGKIACFVVFCMVVVAPHAESLSCGEVTSGLAPCLPYLEGRG-P

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-G-K-LLGA--T--DR-TAC-C-K-AA---K------A--LPG-C
Sequence 2 LGGCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVC

Sequence 1 GISTSIPINPNVNCNTIP
           G------I-P---C-T--
Sequence 2 GVNIPYKISPSTDCSTVQ



Alignment 15
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 37.07 (43/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V---L-PCL-YL--GG---
Sequence 2 --------------------------ITCGQVASSLAPCLSYLKVGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC---K-L-GA--T-ADR--ACKC-K-AA---K-V----AS-LPGKCG
Sequence 2 DGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           -S----I-P---C----
Sequence 2 VSIPYKISPSTDCSSVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 37.93 (44/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-
           ----T-M-----A-------------AITC--V--N--PC--Y--SGG--
Sequence 2 MASSTAMKLSLVALLCIV-VALPIAQAITCGQVASNISPCVTYVKSGGAV

Sequence 1 PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGK
           P-P-CC-G---L-G---T-ADR---C-C-K-AA---K---P--A--LPGK
Sequence 2 PAP-CCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGK

Sequence 1 CGISTSIPINPNVNCNTIP
           CG-S----I----NC----
Sequence 2 CGVSVPYKISTTTNCAAVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 40.52 (47/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMV---HPSVAITCNDVTGNLTPCLPYLRSGG
           -------VA-LA----A-------H---AITC--V---LTPCL--LRSGG
Sequence 2 --MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           ---PACC-G-K-L-----T--DR--AC-C-KTA-----------A-SL-G
Sequence 2 AVAPACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAG

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-P---C----
Sequence 2 KCGVNLPYKISPTIDCSKVK



Alignment 18
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 37.07 (43/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVA--ITCNDVTGNLTPCLPYLRSGGK
           ----------LA--V-----V----A---TC--V--NL-PC--Y-R-GG-
Sequence 2 --MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIAYVRGGGA

Sequence 1 PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGK
           --PACC-G---------T-ADR-TAC-C-K--------V----A--LPGK
Sequence 2 VPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGK

Sequence 1 CGISTSIPINPNVNCNTIP
           CG------I-P--NC-T--
Sequence 2 CGVNVPYKISPSTNCATVK



Alignment 19
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 39.66 (46/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           -----------L-M-V-A--------AITC--V---L-PCL-YL---G--
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQ---AITCGQVQSALVPCLSYLKTTGPT

Sequence 1 TPA-CCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGK
           -PA-CC-G------A--T-ADRRTAC-C-K-AA---K---P-----LPGK
Sequence 2 PPATCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGK

Sequence 1 CGISTSIPINPNVNCNTIP
           CG------I----NC-T--
Sequence 2 CGVNIPYKISLSTNCATVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 35.34 (41/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           --------V--L-M-V------H-----TC--V--NL-PC---L--GG--
Sequence 2 MASVKFACVVVLCMVVVG---AHTAQGMTCGQVQSNLVPCVTFLQNGGFV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-G--------R--ADRR--C-C-KTAA-------P--A--LPGKC
Sequence 2 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G------I----NC--I-
Sequence 2 GVNIPYKISTSTNCASIN



Alignment 21
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 35.34 (41/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           ----T-M-----A-------------AITC--V-----PC--Y--SGG--
Sequence 2 MAISTAMKLSLVALLCIV-VALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           --ACC-G---L--A--T-ADR-T-C-C-K-A----K---P--A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G------I----NC----
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 22
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 37.07 (43/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           ------M--A--A--------V----AITC--VT-N--PC--Y---GG--
Sequence 2 MACSAVMKLALVALLCIV-VAVPVAQAITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           --ACC-G---L-----T-ADR---C-C-K-AA-------P--A--LPGKC
Sequence 2 PAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G-S----I----NC-T--
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 36.21 (42/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS-G
           -----------A--A----A--------A-TC--V---L-PC-PY-RS-G
Sequence 2 MTGSGLFKLACAVFAVALVAA-PIATEAAVTCGQVASSLAPCIPYARSAG

Sequence 1 GKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLP
           G---PACC-G-K-L-G--RT--DR---CKC-K-A-------------SLP
Sequence 2 GAVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLP

Sequence 1 GKCGISTSIPINPNVNCNTIP
           -KCG------I-P---C----
Sequence 2 AKCGVNIPYKISPSTDCARVK



Alignment 24
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 35.34 (41/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           ----T-M-----A-------------AITC--V-----PC--Y--SGG--
Sequence 2 MASSTAMKLSLVALLCIV-VALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           --ACC-G---L--A--T-ADR---C-C-K-A----K---P--A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G-S----I----NC----
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 25
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 33.62 (39/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -------------------------AI-C--VT----PC--YL-SGG---
Sequence 2 -------------------------AIQCSFVTKSIAPCFGYLKSGGTVS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQL--KVRPDMASSLPGKC
           --CC-G-----G---T--DR---C-C-K-AA--L-----P--A-SLPGKC
Sequence 2 GPCCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKC

Sequence 1 GISTSIPINPNVNCNTIP
           G-S----I----NC--I-
Sequence 2 GVSIPYKISTSINCSSIK



Alignment 26
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 33.62 (39/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V---L-PC-PY-R-GG---
Sequence 2 --------------------------ITCGQVSSSLAPCIPYVRGGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G--------RT--DR--AC-C-K--------V-P--A--LPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           -S----I----NC-T--
Sequence 2 VSIPYKISASTNCATVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 35.34 (41/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLR-SGGKP
           M---------L---V-A-L------A--C--V---L-PC--Y-R--G--P
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCG
           --ACC-G---L----R--AD---ACKC-K-AA--L------A---P-KCG
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAAGLNA--GKAAGIPTKCG

Sequence 1 ISTSIPINPNVNCNTIP
           -S----I---V-C--I-
Sequence 2 VSVPYAISSSVDCSKIR



Alignment 28
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 33.62 (39/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V--NL-PC--Y---GG---
Sequence 2 --------------------------ITCGQVSSNLAPCINYVKGGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G--------RT-ADRR-AC-C-K--------V-P--A--LPGKCG
Sequence 2 PACCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I----NC-T--
Sequence 2 VNVPYKISASTNCATVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 38.79 (45/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V---L------A-TC-DV----TPCL-YL--GG---
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 38.79 (45/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V---L------A-TC-DV----TPCL-YL--GG---
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 38.79 (45/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V---L------A-TC-DV----TPCL-YL--GG---
Sequence 2 -MAMKMMKFFCAMVVCMVLSSSYAEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 32
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 33.62 (39/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V---L-PC--Y-R-GG---
Sequence 2 --------------------------ITCGQVSSSLAPCIGYVRGGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G--------RT--DRRTAC-C-K--------V-P--A--LPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I----NC-T--
Sequence 2 VNIPYKISASTNCATVK



Alignment 33
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 38.79 (45/116)
Sequence 1 --MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK
           ---------VA-L---V------H---AI-C--VT--L--C-P-L--GG-
Sequence 2 MATLNSACVVAVLCLVVLTAPTAH--AAISCGQVTSSLASCIPFLTKGG-

Sequence 1 PTPA-CCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           P-PA-CC-G---L--A--T--DR---C-C-K-AA----------A--LPG
Sequence 2 PVPASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPG

Sequence 1 KCGISTSIPINPNVNCNTIP-
           KCG-S----I----NC-TI--
Sequence 2 KCGVSIPYKISTSTNCATIKF



Alignment 34
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 33.62 (39/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           ----------------------------C--V---L-PC---L--GG-P-
Sequence 2 --------------------------LSCGQVNSALAPCITFLTKGGVPS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G---LLGA--T-ADR--AC-C-K-AA--L-------A--LPG-CG
Sequence 2 GPCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCG

Sequence 1 ISTSIPINPNVNCNTIP-
           -S----I----NC-TI--
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 35
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 32.76 (38/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V---L-PC-PY-R-GG---
Sequence 2 --------------------------ITCGQVSSALAPCIPYVRGGGAVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           PACC-G--------RT--DR--AC-C-K--------V-P--A--LPGKCG
Sequence 2 PACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I----NC-T--
Sequence 2 VHIPYKISASTNCATVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 32.76 (38/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------ITC--V---L-PC--YLR-GG---
Sequence 2 --------------------------ITCGQVSSSLAPCINYLRAGGVVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G---L--A--T-ADR--AC-C-K-A----K------A--LPGKCG
Sequence 2 ANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCG

Sequence 1 ISTSIPINPNVNCNTIP
           -S----I-P---C----
Sequence 2 VSVPYKISPSTDCKSVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 34.48 (40/116)
Sequence 1 ----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSG
           ----------------M--MA--------A--C--V--NLTPC--Y---G
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GKPTPACCAGAKKLLGATRTQADRRTACKCAKTAA---PQLKVRPDMASS
           G---P-CC-G---L-----T-ADR---C-C-K-A----P--------A--
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGISTSIPINPNVNCNTIP
           LPGKCG------I-P---C-TI-
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 37.07 (43/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           M----M-V-------M--L------A-TC-DV----TPCL--L--GG---
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR--AC-C-KT-----K----D-A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CNT--
Sequence 2 VNIPYKISLETDCNTVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 36.21 (42/116)
Sequence 1 -----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS
           ---------------L-M-V-A--------A-TC--VT--LTPC-PY-R-
Sequence 2 MASKRFLNNLVPALFLCMVVAASVV---ESAVTCGQVTSSLTPCIPYARG

Sequence 1 G-GKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASS
           ----P--ACC-G---L--A--T--DR-TAC-C-K--A-------------
Sequence 2 VVAAPSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGA

Sequence 1 LPGKCGISTSIPINPNVNCNTIP
           LPGKCG-S----I-P---C----
Sequence 2 LPGKCGVSIPYKISPSTDCSRVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 34.48 (40/116)
Sequence 1 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP
           --------V----M-V----------A-TC-DV-----PCL-YL--GG--
Sequence 2 MKMMKVFCVMVVCMVVKSS---YAEAALTCSDVSTKISPCLSYLKKGGEV

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-G-K-L--AT-T--DR-TAC-C-K------K----D-A--LP-KC
Sequence 2 PADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKC

Sequence 1 GISTSIPINPNVNCNTIP
           G------------CN---
Sequence 2 GLNLPYKLSLETDCNKVK



Alignment 41
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 34.48 (40/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TC-DV-----PCL--L--GG
Sequence 2 MAMKMMKVFCVMVVCMVVSSS---YAEAALTCSDVSNKISPCLSFLKQGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           -----CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A--LP-
Sequence 2 EVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-----CN---
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 34.48 (40/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TC-DV-----PCL-YL--GG
Sequence 2 MAMKMMKVFCVMVVCMVVSSSY----AEALTCSDVSNKISPCLNYLKQGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           -----CCAG-K-L--A--T--DR-TAC-C-K------K----D-A--LP-
Sequence 2 EVPANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------------CN---
Sequence 2 KCGVTIPYKLSMETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 35.34 (41/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           M----M-V-------M---------A-TC-DV-----PCL-YL--GG---
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--AT-T--DR-TAC-C-K------K----D-A--LP-KCG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------------CN---
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 33.62 (39/116)
Sequence 1 ----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSG
           ------------A--A----A--------AI-C--V-----PC--Y-R--
Sequence 2 MARTQQLAVVATAVVALVLLAA--ATSEAAISCGQVASAIAPCISYARGQ

Sequence 1 GK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSL
           G--P---CC-G---L--A-RT-ADRR-AC-C-K-AA----------A-S-
Sequence 2 GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASI

Sequence 1 PGKCGISTSIPINPNVNCNTIP
           P-KCG-S----I-----C----
Sequence 2 PSKCGVSIPYTISTSTDCSRVN



Alignment 45
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 35.34 (41/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V----------A--C-DV------CL-YL--GG---
Sequence 2 ---MKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 35.34 (41/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V----------A--C-DV------CL-YL--GG---
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 35.34 (41/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -----M-----AM-V----------A--C-DV------CL-YL--GG---
Sequence 2 -MAMKMMKFFCAMVVCMVVSSSYAEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A-SLP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-----CN---
Sequence 2 VNIPYKISLETDCNKVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 33.62 (39/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TC-DV-----PC---L--GG
Sequence 2 MAMKMMKVFCVMVVCMVVSSS---YAEAALTCSDVSNKISPCTSFLKQGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           -----CC-G-K-L--A--T--DR-TAC-C-KT-----K----D-A--LP-
Sequence 2 EVPADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-----CN---
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 49
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 37.07 (43/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVA---ITCNDVTGNLTPCLPYLR-SG
           ----S-G---LA--V-----V---VA---ITC--V---L--C--Y-R--G
Sequence 2 --MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNG

Sequence 1 GKPTP-ACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSL
           --P-P-ACC-G---L--A--T--DR--AC-C-K--A--------------
Sequence 2 AGPVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGA

Sequence 1 PGKCGISTSIPINPNVNCNTIP
           PGKCG-S----I-P--NC----
Sequence 2 PGKCGVSIPYKIAPSTNCDNVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 33.62 (39/116)
Sequence 1 ----MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS-
           ------------A--A----A--------AI-C--V-----PC--Y-R--
Sequence 2 MARTQQLAVVATAVVALVLLAA--ATSEAAISCGQVASAIAPCISYARGQ

Sequence 1 GGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSL
           G--P---CC-G---L--A-RT-ADRR-AC-C-K-AA----------A-S-
Sequence 2 GSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASI

Sequence 1 PGKCGISTSIPINPNVNCNTIP--------
           P-KCG-S----I-----C------------
Sequence 2 PSKCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 51
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 32.76 (38/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TC-DV-----PC---L--GG
Sequence 2 MAMKMMKVFCVMVVCMVVSSS---YAEAALTCSDVSNKILPCTSFLKQGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           -----CC-G-K-L--A--T--DR--AC-C-KT-----K----D-A--LP-
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-----CN---
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 52
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 32.76 (38/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TC-DV-----PC---L--GG
Sequence 2 MAMKMMKVFCVMVVCMVVSSS---YAEAALTCSDVSNKILPCTSFLKQGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPG
           -----CC-G-K-L--A--T--DR--AC-C-KT-----K----D-A--LP-
Sequence 2 EVSADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-----CN---
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 53
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 32.76 (38/116)
Sequence 1 ---MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGG
           ----------V----M-V----------A-TCNDVT----PC---L--GG
Sequence 2 MAMKMMKVFCVMVVCMVVTSS---YAEAALTCNDVTKKISPCTSFLEKGG

Sequence 1 KPTPACCAGAKKLLGATRTQADRRTACKCAKTA-APQLKVRPDMASSLPG
           -----CC-G-K-L--A--T--DR--AC-C-KT------------A--LP-
Sequence 2 EVPVDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPS

Sequence 1 KCGISTSIPINPNVNCNTIP
           KCG------I-----CN---
Sequence 2 KCGVNIPYKISLETDCNKVK



Alignment 54
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 28.45 (33/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           M----------A---M--------VA--C--V-----PCL-Y---G--P-
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G---L--------DR-T-C-C-K--A----------A-S-P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 ISTSIPINPNVNCNTIP
           ------I-P---C--I-
Sequence 2 VNVPYTISPDIDCSRIY



Alignment 55
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 28.45 (33/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           --------------------------I-C--V-----PCL-Y---G--P-
Sequence 2 --------------------------IDCGHVDSLVRPCLSYVQGGPGPS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G-K-L----R-Q-DR--AC-C-K--A--------D-A-S-P-KCG
Sequence 2 GQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCG

Sequence 1 ISTSIPINPNVNCNTIP
           ------I--N--C----
Sequence 2 VNLPYTISLNIDCSRV-



Alignment 56
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 27.59 (32/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           M----------A---M--------VA--C--V-----PCL-Y---G--P-
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKCG
           --CC-G---L--------DR-T-C-C-K--A----------A-S-P-KC-
Sequence 2 GECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCN

Sequence 1 ISTSIPINPNVNCNTIP-----------------
           ------I-P---C---------------------
Sequence 2 VNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 57
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 33.62 (39/116)
Sequence 1 -----------MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPC
           ------------------V--------------P----TC--V-G-L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 LPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VR
           LP------K-P---CC-GAK-L-G-T-T---R--AC-C--TA--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PDMASSLPGKCGISTSI--PINPNVNCNTIP-------
           ----S--P--CGI--S---PI--N--C-T---------
Sequence 2 GKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVLHYKGN



Alignment 58
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 34.48 (40/116)
Sequence 1 ------------MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTP
           ------------------G-A-------A-----P----TC--V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-V
           CLP------K-P---CC-GAK-L-G-T-T---R--AC-C--TA-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 RPDMASSLPGKCGISTS--IPINPNVNCNTIP------------------
           -----S--P--CGI--S---PI--N--C-T--------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVT

Sequence 1 --------------------------
           --------------------------
Sequence 2 GPSDPAHKARLERPQIRVPPPAPEKA



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 30.17 (35/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-P
           ---------------------------TC------L-PCLP------K-P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-GAK-L-G-T-T---R--AC-C--TA------------S--P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GISTS--IPINPNVNCNTIP------------------------------
           GI--S---PI--N--C-T--------------------------------
Sequence 2 GIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 60
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 30.17 (35/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMV--HPSV---AITCNDVTGNLTPCLPYLRS
           ---------IL-------L-V---P-------TC--V---L-PC---L--
Sequence 2 ----MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-T

Sequence 1 GGKPTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLP
           G--P--ACC-G---L-----T-ADR---C-C-K---------P-----L-
Sequence 2 GQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSIAYDPKRMPLLS

Sequence 1 GKCGISTSIP-INPNVNCNTIP-
           -KCG-----P----N--C---P-
Sequence 2 TKCGVKPDFPAVDKNLDCSKLPV



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 31.90 (37/116)
Sequence 1 -----MKGTSMGVAILAMIVMAQLMVHPSVAI-TCNDVTGNLTPCLPYLR
           -----M-------A-LA----A-L---P------C--V-----PCL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 SGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMAS
           ---K-P---CC-G-KKL-----T----R-ACKC---A-------------
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 SLPGKCGISTSIP-INPNVNCNTIP--------
           --P-KCGI-T--P-I-----C--I---------
Sequence 2 EVPKKCGITTTLPPITADFDCSKIESTIFRGYY



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 30.17 (35/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-P
           ---------------------------TC------L-PCLP------K-P
Sequence 2 -------------------------QETCGTMVRALMPCLPFVQGKEKEP

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-GAK-L-G-T-T---R--AC-C--TA------------S--P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GISTS--IPINPNVNCNTIP------------------------------
           GI--S---PI--N--C-T--------------------------------
Sequence 2 GIVDSKLPPIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 28.45 (33/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGK-P
           -----------------------------------L-PCLP------K-P
Sequence 2 -------------------------------MVRALMPCLPFVQGKEKEP

Sequence 1 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC
           ---CC-GAK-L-G-T-T---R--AC-C--TA------------S--P--C
Sequence 2 SKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHC

Sequence 1 GISTSI--PINPNVNCNTIP------------------------------
           GI--S---PI--N--C-T--------------------------------
Sequence 2 GIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLE

Sequence 1 --------------
           --------------
Sequence 2 RPQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 27.59 (32/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -------------------------A--C--V--NL--C--YL-----P-
Sequence 2 -------------------------ALSCGTVNSNLAACIGYLTQNA-PL

Sequence 1 P-ACCAGAKKLLGATRTQADRRTACKCAKTAAPQL-KVRPDMASSLPGKC
           P--CC-G---L----RT--DR--AC-C---AA----------A--LP--C
Sequence 2 PKGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKAC

Sequence 1 GISTSIPINPNVNCNTIP
           G------I----NCN---
Sequence 2 GVNIPYKISKSTNCNSVR



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 30.17 (35/116)
Sequence 1 MKGTSMGVAILAMIVMAQLM-VHPSVAIT-----CNDVTGNLTPCLPYLR
           M---SM----------A------P--A-------C--V-----PCL----
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 SGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMAS
           ---K-P---CC-G-KKL-----T----R-ACKC---A-------------
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 SLPGKCGISTSIP-INPNVNCNTIP--------
           --P-KC-I-T--P-I-----C--I---------
Sequence 2 EVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 15.52 (18/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           -------------------------A-TC-DV-----PCL-YL--GG---
Sequence 2 -------------------------ALTCSDVSNKISPCLSYLKQGGEVP

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKCGI
           --CCAG-K-L----------------------------------------
Sequence 2 ADCCAGVKGLND--------------------------------------

Sequence 1 STSIPINPNVNCNTIP
           ----------------
Sequence 2 ----------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 16.38 (19/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRS-GGKP
           --------------------------ITC--V---L-PCL-YL-S-GG-P
Sequence 2 -------------------------SITCTQVSKSLMPCLTYLKSNGGSP

Sequence 1 TPA-CCAGAKKLLGATRTQADRRTACKCAKTAAPQLKVRPDMASSLPGKC
           -P--CC-G-K----------------------------------------
Sequence 2 PPGTCCQGVKL---------------------------------------

Sequence 1 GISTSIPINPNVNCNTIP
           ------------------
Sequence 2 ------------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Jug r 8.0201, Sequence: XP_018847114
Sequence identity: 23.28 (27/116)
Sequence 1 MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKPT
           MK-----V--L-----A---V----A-TCN-----L-PC-----S---P-
Sequence 2 MKASYIAVCTLLVLLLAKTEV--TMAVTCNPT--QLSPCVGAITSSNPPS

Sequence 1 PACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK--VRPDMASSLPGKC
           --CC---K---------------C-C-----P-LK--V----A------C
Sequence 2 SLCCSKIKE-----------QKPCLCQYLKNPNLKKFVDSPNARKVANTC

Sequence 1 GISTSIPINPNVNCNTIP
           G-----------------
Sequence 2 GTPFPKC-----------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.