The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology

SDAP Home Page
SDAP Overview
SDAP All
SDAP Food

Use SDAP All
Search SDAP All
List SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
NOAH/DIAMOD
MASIA
PCPMer
InterProSurf
EpiSearch

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
CE
FSSP
iProClass
ProtoMap
SCOP
TOPS
VAST

Bioinformatics Servers
@TOME
BLAST @ NCBI
BLAST @ PIR
FASTA @ PIR
Peptide Match @ PIR
ClustalW @ BCM
ClustalW @ EMBL - EBI
ClustalW @ PIR

Bioinformatics Tools
Cn3D
MolMol

Bioinformatics Links
Bioinformatics Links Directory

SDAP - All Allergens
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Ovidiu Ivanciuc      Submit new allergen information to SDAP
Last Updated: Nov 1, 2021  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
Access to SDAP is available free of charge for Academic and non-profit use.
Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu).
Secure access to SDAP is available from https://fermi.utmb.edu/SDAP

Allergen Pha v 3.0101

Sequence 289064177

Full FASTA alignment

Sequence name:
Query sequence:
MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
IPYKISTSTNCASIN

NoAllergenSequence Link in
SwissProt/NCBI/PIR
View SequenceSequence
Length
bit scoreE score
1Pha v 3.0101ADC80502Go!115151.36.0e-39
2Lup an 3.0101XP_019446786Go!116103.61.4e-24
3Ara h 9.0101ABX56711Go!116100.99.2e-24
4Hev b 12AAL25839Go!116100.51.2e-23
5Pha v 3.0201ADC80503Go!11898.06.8e-23
6Pru av 3Q9M5X8Go!11797.97.7e-23
7Rub i 3.0101Q0Z8V0Go!11797.97.7e-23
8Fra a 3.0202Q4PLT6Go!11797.78.8e-23
9Mal d 3Q9M5X7Go!11597.59.9e-23
10Fra a 3.0102Q4PLT9Go!11797.11.3e-22
11Fra a 3.0101Q8VX12Go!11796.81.6e-22
12Fra a 3.0201Q4PLU0Go!11795.93.1e-22
13Pyr c 3Q9M5X6Go!11595.15.0e-22
14Cor a 8AAK28533Go!11594.48.2e-22
15Pru d 3P82534Go!9193.11.6e-21
16Pru ar 3P81651Go!9190.69.1e-21
17Pis s 3.0101A0A161AT60Go!12088.94.0e-20
18Len c 3.0101A0AT29Go!11888.07.4e-20
19Pru p 3CAB96876Go!9187.48.6e-20
20Pru p 3P81402Go!9187.01.1e-19
21Ara h 9.0201ABX75045Go!9286.51.6e-19
22Mor n 3.0101P85894Go!9184.85.0e-19
23Sola l 3.0101P93224Go!11483.12.1e-18
24Lyc e 3AAB42069Go!11483.12.1e-18
25Pla a 3.0101CAL07989Go!11882.92.5e-18
26Pla or 3.0101ABY21307Go!11882.24.0e-18
27Zea m 14.0101P19656-1Go!12082.24.1e-18
28Art gm 3.0102ANC85023Go!11782.04.6e-18
29Art ca 3.0102QIN55516Go!11781.65.9e-18
30Art gm 3.0101ANC85022Go!11781.56.6e-18
31Pru du 3.0101ACN11576Go!12380.61.3e-17
32Zea m 14.0102P19656-2Go!12880.51.5e-17
33Art an 3.0102ANC85018Go!11780.21.6e-17
34Art ca 3.0101ANC85021Go!11779.82.0e-17
35Art an 3.0101ANC85017Go!11779.82.0e-17
36Can s 3.0101W0U0V5Go!9179.42.1e-17
37Art v 3.0202ACE07187Go!11679.33.0e-17
38Art ar 3.0102ANC85020Go!11679.33.0e-17
39Art si 3.0102ANC85027Go!11679.33.0e-17
40Api g 2ACV04796Go!11878.64.9e-17
41Pun g 1.0201A0A059SSZ0Go!12076.81.7e-16
42Art v 3.0201EU564845Go!11476.02.8e-16
43Art ar 3.0101ANC85019Go!11676.02.8e-16
44Art la 3.0101ANC85024Go!11676.02.8e-16
45Pun g 1.0301A0A059ST23Go!12075.73.6e-16
46Art la 3.0102ANC85025Go!11575.54.1e-16
47Pun g 1.0101A0A059STC4Go!12075.54.1e-16
48Ara h 17.0101A0A510A9S3Go!9375.04.8e-16
49Art v 3.0301EU564847Go!11774.67.6e-16
50Art si 3.0101ANC85026Go!11674.48.6e-16
51Hor v 1AAA32970Go!11773.51.6e-15
52Hor v 1CAA42832Go!13472.92.8e-15
53Tri tu 14.0101CAH69206Go!11570.51.3e-14
54Sola l 7.0101NP_001316123Go!11569.42.8e-14
55Sin a 3.0101ABU95411Go!9268.83.3e-14
56Tri a 14.010119846220Go!9067.77.0e-14
57Hel a 3.0101P82007Go!11663.61.5e-12
58Amb a 6O04004Go!11847.21.3e-07
59Par j 2O04403Go!13341.95.9e-06
60Par j 1Q40905Go!13840.22.1e-05
61Par j 2P55958Go!13340.02.3e-05
62Par j 1O04404Go!17640.03.0e-05
63Par j 1P43217Go!13939.63.1e-05
64Par j 1.0103CAI94601Go!13939.33.9e-05
65Par j 1.0101CAA54587Go!13335.84.1e-04
66Art v 3.0101P0C088Go!3732.79.9e-04
67Vit v 1P80274Go!3731.62.1e-03
68Cas s 810998016Go!3630.93.4e-03

Alignment made with FASTA 3.45
As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous.

Alignment 1
Sequence 1:
Sequence 2: Allergen Pha v 3.0101, Sequence: ADC80502
Sequence identity: 100.00 (115/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
Sequence 2 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
Sequence 2 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN

Sequence 1 IPYKISTSTNCASIN
           IPYKISTSTNCASIN
Sequence 2 IPYKISTSTNCASIN



Alignment 2
Sequence 1:
Sequence 2: Allergen Lup an 3.0101, Sequence: XP_019446786
Sequence identity: 62.61 (72/115)
Sequence 1 -MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA
           ----VK-AC-V--CMVVV-A------TCGQV--NL--C---L--GG-VPA
Sequence 2 MAGIVKLACAVLICMVVVSAPLTKAITCGQVTANLAQCLNYLRSGGAVPA

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           -CCNG--NI-N-A--T-DRR--CNCLK-AA----GLNP-NA--LPGKCGV
Sequence 2 PCCNGIKNILNLAKTTPDRRTACNCLKAAAANTPGLNPSNAGSLPGKCGV

Sequence 1 NIPYKISTSTNCASIN
           NIPYKISTSTNCASI-
Sequence 2 NIPYKISTSTNCASIK



Alignment 3
Sequence 1:
Sequence 2: Allergen Ara h 9.0101, Sequence: ABX56711
Sequence identity: 60.00 (69/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           MAS-KFA-V---CM--VGA-------CGQV-S-L-PC--FL--GG--P--
Sequence 2 MASLKFAFVMLVCMAMVGAPMVNAISCGQVNSALAPCIPFLTKGGAPPPA

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GVR------R-TADR---CNCLK-AAG--RGLN--NA-ALPG-CGV-
Sequence 2 CCSGVRGLLGALRTTADRQAACNCLKAAAGSLRGLNQGNAAALPGRCGVS

Sequence 1 IPYKISTSTNCASIN-
           IPYKISTSTNCA-I--
Sequence 2 IPYKISTSTNCATIKF



Alignment 4
Sequence 1:
Sequence 2: Allergen Hev b 12, Sequence: AAL25839
Sequence identity: 61.74 (71/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP-A
           MA--K-----VLCM-V----TAQ--TCGQVQS-LVPC---L---G--P-A
Sequence 2 MAALKMVSFLVLCMLVAAPMTAQAITCGQVQSALVPCLSYLKTTGPTPPA

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           -CCNGVR-I-N-A--TADRR--C-CLK-AAG-V-GLNP-----LPGKCGV
Sequence 2 TCCNGVRTINNAAKTTADRRTACQCLKSAAGSVKGLNPTTVAGLPGKCGV

Sequence 1 NIPYKISTSTNCASIN
           NIPYKIS-STNCA---
Sequence 2 NIPYKISLSTNCATVK



Alignment 5
Sequence 1:
Sequence 2: Allergen Pha v 3.0201, Sequence: ADC80503
Sequence identity: 61.74 (71/115)
Sequence 1 MASVKFACVV-VLCMVVVGAHTAQG-MTCGQVQSNLVPCVTFLQNGGFVP
           MA----ACVV-VLC-VV--A-TA-----CGQV-S-L--C--FL--GG-VP
Sequence 2 MATLNSACVVAVLCLVVLTAPTAHAAISCGQVTSSLASCIPFLTKGGPVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GVR-----A--T-DR---CNCLK-AAGA--G-N-NNA--LPGKCG
Sequence 2 ASCCSGVRSLNAAAKTTPDRQAVCNCLKSAAGAIPGFNANNAGILPGKCG

Sequence 1 VNIPYKISTSTNCASIN-
           V-IPYKISTSTNCA-I--
Sequence 2 VSIPYKISTSTNCATIKF



Alignment 6
Sequence 1:
Sequence 2: Allergen Pru av 3, Sequence: Q9M5X8
Sequence identity: 60.00 (69/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           ----A--K-A-VV-LCMVV-----AQ--TCGQV-SNL-PC------GG-V
Sequence 2 MACSAMTKLALVVALCMVV-SVPIAQALTCGQVSSNLAPCIAYVRGGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           P--CCNG-RNI-N-A--TADR---CNCLK-----V-G-N-NNA-ALPGKC
Sequence 2 PPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKIS-STNCA---
Sequence 2 GVNVPYKISPSTNCATVK



Alignment 7
Sequence 1:
Sequence 2: Allergen Rub i 3.0101, Sequence: Q0Z8V0
Sequence identity: 58.26 (67/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           ----A--K-A-V--LC--VV----AQ--TCGQV--N--PC-----NGG-V
Sequence 2 MACSAVMKLALVALLC-IVVAVPVAQAITCGQVTQNVAPCFNYVKNGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           PA-CCNGVRN----A--TADR---CNCLK-AAG---GLNP--A--LPGKC
Sequence 2 PAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGSIPGLNPSLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GV--PYKISTSTNCA---
Sequence 2 GVSVPYKISTSTNCATVK



Alignment 8
Sequence 1:
Sequence 2: Allergen Fra a 3.0202, Sequence: Q4PLT6
Sequence identity: 56.52 (65/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K---V--LC--VV----AQ--TCGQV-S---PCV-----GG-V
Sequence 2 MAISTAMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           PA-CCNG-R-----A--TADR---CNCLK-A-GA--GLNPN-A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQTTCNCLKQASGAIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKISTSTNCA---
Sequence 2 GVNVPYKISTSTNCAAVK



Alignment 9
Sequence 1:
Sequence 2: Allergen Mal d 3, Sequence: Q9M5X7
Sequence identity: 59.13 (68/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           ----A--K-A-VV-LCM-V--AH-----TCGQV-S-L-PC------GG-V
Sequence 2 MASSAVTKLALVVALCMAVSVAHA---ITCGQVTSSLAPCIGYVRSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           P--CCNG-R-I---AR-TADR---CNCLK--AG---G-NPNNA--LPGKC
Sequence 2 PPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKISTSTNCA---
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 10
Sequence 1:
Sequence 2: Allergen Fra a 3.0102, Sequence: Q4PLT9
Sequence identity: 56.52 (65/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K---V--LC--VV----AQ--TCGQV-SN--PCVT----GG-V
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASNISPCVTYVKSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           PA-CC-G-RN----A--TADR---CNCLK-AAG---GLNPN-A--LPGKC
Sequence 2 PAPCCSGIRNLNGMAKTTADRQATCNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GV--PYKIST-TNCA---
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 11
Sequence 1:
Sequence 2: Allergen Fra a 3.0101, Sequence: Q8VX12
Sequence identity: 55.65 (64/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K---V--LC--VV----AQ--TCGQV-SN--PC-T----GG-V
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASNISPCLTYVKSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           PA-CC-G-RN----A--TADR---CNCLK-AAG---GLNPN-A--LPGKC
Sequence 2 PAACCSGIRNLNGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GV--PYKIST-TNCA---
Sequence 2 GVSVPYKISTTTNCAAVK



Alignment 12
Sequence 1:
Sequence 2: Allergen Fra a 3.0201, Sequence: Q4PLU0
Sequence identity: 54.78 (63/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K---V--LC--VV----AQ--TCGQV-S---PCV-----GG-V
Sequence 2 MASSTAMKLSLVALLC-IVVALPIAQAITCGQVASSISPCVNYVKSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           PA-CCNG-R-----A--TADR---CNCLK-A-GA--GLNP--A--LPGKC
Sequence 2 PAACCNGIRSLNSAAKTTADRQATCNCLKQASGAIKGLNPSLAAGLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GV--PYKISTSTNCA---
Sequence 2 GVSVPYKISTSTNCAAVK



Alignment 13
Sequence 1:
Sequence 2: Allergen Pyr c 3, Sequence: Q9M5X6
Sequence identity: 55.65 (64/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           ----A--K-A-VV-LCM-V--AH-----TC-QV--NL-PC------GG-V
Sequence 2 MASSAVIKLALVVALCMAVSVAHA---ITCSQVSANLAPCINYVRSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           P--CCNG---I---A--T-DR---CNCLK--AG-V-G-NP-NA--LPGKC
Sequence 2 PPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKISTSTNCA---
Sequence 2 GVNVPYKISTSTNCATVK



Alignment 14
Sequence 1:
Sequence 2: Allergen Cor a 8, Sequence: AAK28533
Sequence identity: 53.04 (61/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           M-S-K--C-V-LCM-V---------TC-Q---NL-PCV--L-NGG--P--
Sequence 2 MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPS

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GVR------R-T-DR---CNCLK--A----GLNPN-A--LPGKCGVN
Sequence 2 CCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVN

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-STNC----
Sequence 2 IPYKISPSTNCNNVK



Alignment 15
Sequence 1:
Sequence 2: Allergen Pru d 3, Sequence: P82534
Sequence identity: 51.30 (59/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-SNL-PC------GG-VP--
Sequence 2 ------------------------ITCGQVSSNLAPCINYVKGGGAVPPA

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNG-RN--N-AR-TADRR--CNCLK---G---G-NPNNA-ALPGKCGVN
Sequence 2 CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVN

Sequence 1 IPYKISTSTNCASIN
           -PYKIS-STNCA---
Sequence 2 VPYKISASTNCATVK



Alignment 16
Sequence 1:
Sequence 2: Allergen Pru ar 3, Sequence: P81651
Sequence identity: 50.43 (58/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC------GG-VP--
Sequence 2 ------------------------ITCGQVSSSLAPCIGYVRGGGAVPPA

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNG-RN--N-AR-T-DRR--CNCLK---G---G-NPNNA-ALPGKCGVN
Sequence 2 CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVN

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-STNCA---
Sequence 2 IPYKISASTNCATVK



Alignment 17
Sequence 1:
Sequence 2: Allergen Pis s 3.0101, Sequence: A0A161AT60
Sequence identity: 53.04 (61/115)
Sequence 1 -MASVKFACV-VVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ--NGGF
           ---S-K-ACV--V-CMVV----------CG-V-----PCVT-LQ--N---
Sequence 2 MARSMKLACVALVICMVVIAPMAEAALSCGTVSADMAPCVTYLQAPNNAS

Sequence 1 VPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGK
           -P--CC-GV------A--T-DR---CNCLK-AAG----LN-NNA-ALPGK
Sequence 2 PPPPCCAGVKKLLAAATTTPDRQAACNCLKSAAGSIPKLNTNNAAALPGK

Sequence 1 CGVNIPYKISTSTNCASIN-
           CGV-IPYKISTSTNC-----
Sequence 2 CGVSIPYKISTSTNCNTVRF



Alignment 18
Sequence 1:
Sequence 2: Allergen Len c 3.0101, Sequence: A0AT29
Sequence identity: 53.91 (62/115)
Sequence 1 -MASVKFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNG-GFV
           -----K-ACVV-V-CMVV----------CG-V-S-L-PC-T-L--G-G--
Sequence 2 MARGMKLACVVLVICMVVIAPMAEGAISCGAVTSDLSPCLTYLTGGPGPS

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           P--CC-GV------A--T-DR---CNCLK-AAG----LN-NNA-ALPGKC
Sequence 2 PQ-CCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKC

Sequence 1 GVNIPYKISTSTNCASIN-
           GVNIPYKIST-TNC-----
Sequence 2 GVNIPYKISTTTNCNTVKF



Alignment 19
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: CAB96876
Sequence identity: 48.70 (56/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC------GG-VP--
Sequence 2 ------------------------ITCGQVSSSLAPCIPYVRGGGAVPPA

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNG-RN--N-AR-T-DR---CNCLK-----V-G-NPNNA-ALPGKCGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVS

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-STNCA---
Sequence 2 IPYKISASTNCATVK



Alignment 20
Sequence 1:
Sequence 2: Allergen Pru p 3, Sequence: P81402
Sequence identity: 48.70 (56/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC------GG-VP--
Sequence 2 ------------------------ITCGQVSSALAPCIPYVRGGGAVPPA

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNG-RN--N-AR-T-DR---CNCLK-----V-G-NPNNA-ALPGKCGV-
Sequence 2 CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVH

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-STNCA---
Sequence 2 IPYKISASTNCATVK



Alignment 21
Sequence 1:
Sequence 2: Allergen Ara h 9.0201, Sequence: ABX75045
Sequence identity: 51.30 (59/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           --------------------------CGQV-S-L-PC-TFL--GG-VP-G
Sequence 2 ------------------------LSCGQVNSALAPCITFLTKGG-VPSG

Sequence 1 -CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           -CC-GVR-----A--TADR---CNCLK-AAG---GLN--NA-ALPG-CGV
Sequence 2 PCCSGVRGLLGAAKTTADRQAACNCLKAAAGSLHGLNQGNAAALPGRCGV

Sequence 1 NIPYKISTSTNCASIN-
           -IPYKISTSTNCA-I--
Sequence 2 SIPYKISTSTNCATIKF



Alignment 22
Sequence 1:
Sequence 2: Allergen Mor n 3.0101, Sequence: P85894
Sequence identity: 46.96 (54/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC---L--GG-VPA-
Sequence 2 ------------------------ITCGQVSSSLAPCINYLRAGGVVPAN

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCNGVR---N-A--TADR---CNCLK-A-----GLN-N-A--LPGKCGV-
Sequence 2 CCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVS

Sequence 1 IPYKISTSTNCASIN
           -PYKIS-ST-C-S--
Sequence 2 VPYKISPSTDCKSVK



Alignment 23
Sequence 1:
Sequence 2: Allergen Sola l 3.0101, Sequence: P93224
Sequence identity: 46.09 (53/115)
Sequence 1 -MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA
           -----K-AC-VV-CMVVV--H-A----CG-V-S-L-PC---L---G----
Sequence 2 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-G

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           GCC-GV------A----DR---C-CLK-AA----G-----A--LPG-CGV
Sequence 2 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV

Sequence 1 NIPYKISTSTNCASIN
           NIPYKIS-ST-C----
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 24
Sequence 1:
Sequence 2: Allergen Lyc e 3, Sequence: AAB42069
Sequence identity: 46.09 (53/115)
Sequence 1 -MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA
           -----K-AC-VV-CMVVV--H-A----CG-V-S-L-PC---L---G----
Sequence 2 MEMFGKIACFVVFCMVVVAPH-AESLSCGEVTSGLAPCLPYLEGRGPL-G

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           GCC-GV------A----DR---C-CLK-AA----G-----A--LPG-CGV
Sequence 2 GCCGGVKGLLGAAKTPEDRKTACTCLKSAANSIKGIDTGKAAGLPGVCGV

Sequence 1 NIPYKISTSTNCASIN
           NIPYKIS-ST-C----
Sequence 2 NIPYKISPSTDCSTVQ



Alignment 25
Sequence 1:
Sequence 2: Allergen Pla a 3.0101, Sequence: CAL07989
Sequence identity: 45.22 (52/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K-AC----CMV----H-----TCG-V---L-PC-TFL--GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           ---CCNGV----N-A--T-DR---C-CLKTA-----G----NA--L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKIS----C----
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 26
Sequence 1:
Sequence 2: Allergen Pla or 3.0101, Sequence: ABY21307
Sequence identity: 44.35 (51/115)
Sequence 1 ---MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           -------K-AC----CMV----H-----TCG-V---L-PC-T-L--GG-V
Sequence 2 MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTYLRSGGAV

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           ---CCNGV----N-A--T-DR---C-CLKTA-----G----NA--L-GKC
Sequence 2 APACCNGVKALNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKC

Sequence 1 GVNIPYKISTSTNCASIN
           GVN-PYKIS----C----
Sequence 2 GVNLPYKISPTIDCSKVK



Alignment 27
Sequence 1:
Sequence 2: Allergen Zea m 14.0101, Sequence: P19656-1
Sequence identity: 48.70 (56/115)
Sequence 1 ----MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGF
           ----------A--VV-------A-------CGQV-S---PC-------G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           -P-AGCC-GVR---N-AR-TADRR--CNCLK-AA--V-GLN--NA---P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTSTNCASIN
           KCGV-IPY-ISTST-C---N
Sequence 2 KCGVSIPYTISTSTDCSRVN



Alignment 28
Sequence 1:
Sequence 2: Allergen Art gm 3.0102, Sequence: ANC85023
Sequence identity: 46.09 (53/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV---------TC--V-----PC--FL--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCLSFLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-------L---NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 29
Sequence 1:
Sequence 2: Allergen Art ca 3.0102, Sequence: QIN55516
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV---CMVV---------TC--V-----PC--FL--GG-VP
Sequence 2 MAMKMMKVFCVMIVCMVVLSSYAEAALTCSDVSNKITPCLSFLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A----DR---CNCLKT-------L---NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTGPDRQKACNCLKTTFKSNKDLKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNTVK



Alignment 30
Sequence 1:
Sequence 2: Allergen Art gm 3.0101, Sequence: ANC85022
Sequence identity: 45.22 (52/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV---------TC--V-----PC--FL--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKISPCTSFLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-----------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDFKSDNAAVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 31
Sequence 1:
Sequence 2: Allergen Pru du 3.0101, Sequence: ACN11576
Sequence identity: 48.70 (56/115)
Sequence 1 ----MASVKFACVVVL--CMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNG
           --------K--C-V----CM-V-G--------CGQV--NL-PC-----NG
Sequence 2 MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANG

Sequence 1 GFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNN--AQA
           G-----CC-GVR-----A--TADR--ICNCLK-A-------N-N---A--
Sequence 2 GALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAG

Sequence 1 LPGKCGVNIPYKISTSTNCASIN
           LPGKCGVNIPYKIS-ST-C--I-
Sequence 2 LPGKCGVNIPYKISPSTDCKTIK



Alignment 32
Sequence 1:
Sequence 2: Allergen Zea m 14.0102, Sequence: P19656-2
Sequence identity: 47.83 (55/115)
Sequence 1 ----MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGF
           ----------A--VV-------A-------CGQV-S---PC-------G-
Sequence 2 MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGS

Sequence 1 VP-AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           -P-AGCC-GVR---N-AR-TADRR--CNCLK-AA--V-GLN--NA---P-
Sequence 2 GPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPS

Sequence 1 KCGVNIPYKISTSTNCASIN--------
           KCGV-IPY-ISTST-C------------
Sequence 2 KCGVSIPYTISTSTDCSRYSRRMHASAD



Alignment 33
Sequence 1:
Sequence 2: Allergen Art an 3.0102, Sequence: ANC85018
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV---------TC--V-----PC--FL--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVTSSYAEAALTCNDVTKKISPCTSFLEKGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           --CC-GV------A--T-DR---CNCLKT-----------NA--LP-KCG
Sequence 2 VDCCTGVKGLNDAAKTTPDRQAACNCLKTSFKSSNNFKEENAAVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 34
Sequence 1:
Sequence 2: Allergen Art ca 3.0101, Sequence: ANC85021
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV---------TC--V-----PC--FL--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-----------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 35
Sequence 1:
Sequence 2: Allergen Art an 3.0101, Sequence: ANC85017
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV---------TC--V-----PC--FL--GG-V-
Sequence 2 MAMKMMKVFCVMVVCMVVSSSYAEAALTCSDVSNKILPCTSFLKQGGEVS

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-----------NA--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQAACNCLKTTFKSNKDFKSDNAVVLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 36
Sequence 1:
Sequence 2: Allergen Can s 3.0101, Sequence: W0U0V5
Sequence identity: 42.61 (49/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC---L--GG-VP-G
Sequence 2 ------------------------ITCGQVASSLAPCLSYLKVGGAVPDG

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CCN--------A---ADR---C-CLK-AA----G-N-N-A--LPGKCGV-
Sequence 2 CCNDIKSLSGAAKTPADRQAACKCLKSAASSIKGVNFNLASGLPGKCGVS

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-ST-C-S--
Sequence 2 IPYKISPSTDCSSVK



Alignment 37
Sequence 1:
Sequence 2: Allergen Art v 3.0202, Sequence: ACE07187
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---KF-C--V-CMV------A---TC--V-----PC---L--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-------L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 38
Sequence 1:
Sequence 2: Allergen Art ar 3.0102, Sequence: ANC85020
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---KF-C--V-CMV------A---TC--V-----PC---L--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-------L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 39
Sequence 1:
Sequence 2: Allergen Art si 3.0102, Sequence: ANC85027
Sequence identity: 44.35 (51/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---KF-C--V-CMV------A---TC--V-----PC---L--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVLSSSY-AEALTCSDVSNKITPCLNYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT-------L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTSFKSNKDLKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 40
Sequence 1:
Sequence 2: Allergen Api g 2, Sequence: ACV04796
Sequence identity: 47.83 (55/115)
Sequence 1 -MASVKFACVVVLCMVVVGAHTA--QGMTCGQVQSNLVPCVTFLQNGGFV
           ---S-----V-V--MVVV--H-A---G-TCGQV---L--C---L--GG--
Sequence 2 MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYP

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           ---CC-GV------A---ADR---C-CLKT-AG-V-G-N---A-ALPGKC
Sequence 2 SPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           G--IPY-IS-ST-C---N
Sequence 2 GIRIPYPISPSTDCSRVN



Alignment 41
Sequence 1:
Sequence 2: Allergen Pun g 1.0201, Sequence: A0A059SSZ0
Sequence identity: 48.70 (56/115)
Sequence 1 MASVKFACVVV----LCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGF
           MAS--F----V----LCMVV---------TCGQV-S-L-PC---------
Sequence 2 MASKRFLNNLVPALFLCMVVAASVVESAVTCGQVTSSLTPCIPYARGVVA

Sequence 1 VP-AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           -P-A-CC-GVR---N-A--T-DR---CNCLK--A----G-N-----ALPG
Sequence 2 APSAACCSGVRSLNNAAKTTPDRQTACNCLKVIARSITGINYGRVGALPG

Sequence 1 KCGVNIPYKISTSTNCASIN
           KCGV-IPYKIS-ST-C----
Sequence 2 KCGVSIPYKISPSTDCSRVK



Alignment 42
Sequence 1:
Sequence 2: Allergen Art v 3.0201, Sequence: EU564845
Sequence identity: 42.61 (49/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           M---KF-C--V-CMVV-----A----C--V------C---L--GG-VPA-
Sequence 2 MKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVPAD

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GV------A--T-DR---CNCLKT------------A--LP-KCGVN
Sequence 2 CCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCGVN

Sequence 1 IPYKISTSTNCASIN
           IPYKIS--T-C----
Sequence 2 IPYKISLETDCNKVK



Alignment 43
Sequence 1:
Sequence 2: Allergen Art ar 3.0101, Sequence: ANC85019
Sequence identity: 42.61 (49/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---KF-C--V-CMVV-----A----C--V------C---L--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT------------A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 44
Sequence 1:
Sequence 2: Allergen Art la 3.0101, Sequence: ANC85024
Sequence identity: 42.61 (49/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---KF-C--V-CMVV-----A----C--V------C---L--GG-VP
Sequence 2 MAMKMMKFFCAMVVCMVVSSSY-AEALKCSDVSNKISACLSYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---CNCLKT------------A--LP-KCG
Sequence 2 ADCCTGVKGLNDAAKTTPDRQTACNCLKTTFKSNKDFKSDFAASLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           VNIPYKIS--T-C----
Sequence 2 VNIPYKISLETDCNKVK



Alignment 45
Sequence 1:
Sequence 2: Allergen Pun g 1.0301, Sequence: A0A059ST23
Sequence identity: 46.09 (53/115)
Sequence 1 MAS---VKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ-NG-G
           MAS------A--V--CM-V-------G-TCGQV-S-L--C------NG-G
Sequence 2 MASSGFLRLAGFVLVCMAVASTVAEAGITCGQVSSSLAGCIQYARGNGAG

Sequence 1 FVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           -VP--CCNG-R-----A--T-DR---C-CLK--A----G-N-------PG
Sequence 2 PVPQACCNGIRSLNSAAKTTPDRQAACRCLKSLASSISGINYGLVAGAPG

Sequence 1 KCGVNIPYKISTSTNCASIN
           KCGV-IPYKI--STNC----
Sequence 2 KCGVSIPYKIAPSTNCDNVK



Alignment 46
Sequence 1:
Sequence 2: Allergen Art la 3.0102, Sequence: ANC85025
Sequence identity: 40.00 (46/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           M---K--CV-V-CMVV---------TC--V-----PC---L--GG-VPA-
Sequence 2 MKMMKVFCVMVVCMVVKSSYAEAALTCSDVSTKISPCLSYLKKGGEVPAD

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GV---------T-DR---CNCLK--------L----A--LP-KCG-N
Sequence 2 CCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCGLN

Sequence 1 IPYKISTSTNCASIN
           -PYK-S--T-C----
Sequence 2 LPYKLSLETDCNKVK



Alignment 47
Sequence 1:
Sequence 2: Allergen Pun g 1.0101, Sequence: A0A059STC4
Sequence identity: 44.35 (51/115)
Sequence 1 ---MASVKFACVV-VLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQN-GG
           -------K-AC-V-----V-----T----TCGQV-S-L-PC-------GG
Sequence 2 MTGSGLFKLACAVFAVALVAAPIATEAAVTCGQVASSLAPCIPYARSAGG

Sequence 1 FVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           -VP--CC-G-------AR-T-DR---C-CLK-A-----G-N------LP-
Sequence 2 AVPPACCSGIKTLDGMARTTPDRQATCKCLKSASTSISGINYGLVASLPA

Sequence 1 KCGVNIPYKISTSTNCASIN
           KCGVNIPYKIS-ST-CA---
Sequence 2 KCGVNIPYKISPSTDCARVK



Alignment 48
Sequence 1:
Sequence 2: Allergen Ara h 17.0101, Sequence: A0A510A9S3
Sequence identity: 41.74 (48/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           --------------------------C--V-----PC---L--GG-V---
Sequence 2 -----------------------AIQCSFVTKSIAPCFGYLKSGGTVSGP

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAV-RGLNPNNAQALPGKCGV
           CC-G--NI---A--T-DR---CNCLK-AA-------NPNNA--LPGKCGV
Sequence 2 CCSGIQNINGTAKTTSDRQAVCNCLKSAAASLGSQINPNNAASLPGKCGV

Sequence 1 NIPYKISTSTNCASIN
           -IPYKISTS-NC-SI-
Sequence 2 SIPYKISTSINCSSIK



Alignment 49
Sequence 1:
Sequence 2: Allergen Art v 3.0301, Sequence: EU564847
Sequence identity: 38.26 (44/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           ------K--C--V-CMVV---------TC--V-----PC---L--GG-VP
Sequence 2 MAIKMMKVFCIMVVCMVVSTSYAESALTCSDVSTKISPCLSYLKKGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV---------T-DR---CNCLK--------L----A--LP-KCG
Sequence 2 ADCCTGVKGLNDATKTTPDRQTACNCLKASFKSNKDLKSDFAVPLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           -N-PYK-S--T-C----
Sequence 2 LNLPYKLSLETDCNKVK



Alignment 50
Sequence 1:
Sequence 2: Allergen Art si 3.0101, Sequence: ANC85026
Sequence identity: 41.74 (48/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           --M---K--CV-V-CMVV-----A---TC--V-----PC---L--GG-VP
Sequence 2 MAMKMMKVFCVMVVCMVVSSSY-AEALTCSDVSNKISPCLNYLKQGGEVP

Sequence 1 AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           A-CC-GV------A--T-DR---C-CLK--------L----A--LP-KCG
Sequence 2 ANCCAGVKGLNDAAKTTPDRQTACTCLKNSFKTNKDLKSDYAVPLPSKCG

Sequence 1 VNIPYKISTSTNCASIN
           V-IPYK-S--T-C----
Sequence 2 VTIPYKLSMETDCNKVK



Alignment 51
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: AAA32970
Sequence identity: 43.48 (50/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           ---A-V---------M-------A----CGQV-S---PC-T--Q-GG--P
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGP

Sequence 1 AG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           -G-CCNGVR---N-A-S--DR---CNCLK--A-----LN-NNA---P-KC
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 GVNIPYKISTSTNCASIN
           -VN-PY-IS----C--I-
Sequence 2 NVNVPYTISPDIDCSRIY



Alignment 52
Sequence 1:
Sequence 2: Allergen Hor v 1, Sequence: CAA42832
Sequence identity: 42.61 (49/115)
Sequence 1 --MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           ---A-V---------M-------A----CGQV-S---PC-T--Q-GG--P
Sequence 2 MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQ-GGPGP

Sequence 1 AG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           -G-CCNGVR---N-A-S--DR---CNCLK--A-----LN-NNA---P-KC
Sequence 2 SGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKC

Sequence 1 GVNIPYKISTSTNCASIN-----------------
           -VN-PY-IS----C---------------------
Sequence 2 NVNVPYTISPDIDCSRFTERRSVKLVLSSSIHVEL



Alignment 53
Sequence 1:
Sequence 2: Allergen Tri tu 14.0101, Sequence: CAH69206
Sequence identity: 45.22 (52/115)
Sequence 1 MASVKFACVVVLCMV--VVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVP
           MA----A-VV----V-----A-T-----CGQV-S-L-PC-------G--P
Sequence 2 MARSAVAQVVLVAVVAAMLLAVTEAAVSCGQVSSALSPCISYARGNGASP

Sequence 1 -AGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           -A-CC-GVR----SARSTAD----C-C-K-AA----GLN---A---P-KC
Sequence 2 SAACCSGVRSLASSARSTADKQAACKCIKSAAA---GLNAGKAAGIPTKC

Sequence 1 GVNIPYKISTSTNCASIN
           GV--PY-IS-S--C--I-
Sequence 2 GVSVPYAISSSVDCSKIR



Alignment 54
Sequence 1:
Sequence 2: Allergen Sola l 7.0101, Sequence: NP_001316123
Sequence identity: 42.61 (49/115)
Sequence 1 MASVKFACVVVLCMVVVG----AHTAQG-MTCGQVQSNLVPCVTFLQNGG
           -----------L--VV------A--A-G--TCGQV--NL-PCV-FL--GG
Sequence 2 -----MKAIAILVLVVLAVFQLAMVARGAITCGQVDANLAPCVPFLTQGG

Sequence 1 FVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPG
           ---A-CC-GVR-------S--DRR--CNC-K-AA-----L----AQ-LP-
Sequence 2 EPGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRYPNLKDDAAQSLPS

Sequence 1 KCGVNIPYKISTSTNCASIN
           KCG------IS---NC--I-
Sequence 2 KCGISLTVPISRTVNCDTIS



Alignment 55
Sequence 1:
Sequence 2: Allergen Sin a 3.0101, Sequence: ABU95411
Sequence identity: 40.87 (47/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           --------------------------CG-V-SNL--C---L------P-G
Sequence 2 -----------------------ALSCGTVNSNLAACIGYLTQNAPLPKG

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GV-N--N-AR-T-DR---C-CL--AA-----LN---A-ALP--CGVN
Sequence 2 CCTGVTNLNNMARTTPDRQQACRCLVGAANSFPSLNAARAAALPKACGVN

Sequence 1 IPYKISTSTNCASIN
           IPYKIS-STNC-S--
Sequence 2 IPYKISKSTNCNSVR



Alignment 56
Sequence 1:
Sequence 2: Allergen Tri a 14.0101, Sequence: 19846220
Sequence identity: 37.39 (43/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           --------------------------CG-V-S---PC----Q-GG--P-G
Sequence 2 ------------------------IDCGHVDSLVRPCLSYVQ-GGPGPSG

Sequence 1 -CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           -CC-GV-N--N-ARS--DR---CNCLK--A-----LN--NA---P-KCGV
Sequence 2 QCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLNEDNARSIPPKCGV

Sequence 1 NIPYKISTSTNCASIN
           N-PY-IS----C----
Sequence 2 NLPYTISLNIDCSRV-



Alignment 57
Sequence 1:
Sequence 2: Allergen Hel a 3.0101, Sequence: P82007
Sequence identity: 35.65 (41/115)
Sequence 1 MASVKFACVVVLCMVVVG---AHTAQGMTCGQVQSNLVPCVTFLQNGGFV
           --------V--L-M-V------H-----TC--V--NL-PC---L--GG--
Sequence 2 -MKGTSMGVAILAMIVMAQLMVHPSVAITCNDVTGNLTPCLPYLRSGGKP

Sequence 1 PAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKC
           ---CC-G--------R--ADRR--C-C-KTAA-------P--A--LPGKC
Sequence 2 TPACCAGAKKLLGATRTQADRRTACKCAKTAAPQLK-VRPDMASSLPGKC

Sequence 1 GVNIPYKISTSTNCASIN
           G------I----NC--I-
Sequence 2 GISTSIPINPNVNCNTIP



Alignment 58
Sequence 1:
Sequence 2: Allergen Amb a 6, Sequence: O04004
Sequence identity: 32.17 (37/115)
Sequence 1 MASVKFACVVVLCMVVVG--------AHTAQGMTCGQVQSNLVPCVTFLQ
           -------C---L--V-VG-----------A---TC--VQ--L-PC--FL-
Sequence 2 -----MDCIRILWSVAVGLLLVSWRPTMFAASPTCDTVQNILAPCAGFL-

Sequence 1 NGGFVPAGCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQA
           -G------CC-GV-N--NS----ADR---CNC-K----------P-----
Sequence 2 TGQEPSKACCTGVNNLNNSRKTKADRVAVCNCIKELTKSI-AYDPKRMPL

Sequence 1 LPGKCGVNIPYK-ISTSTNCASIN-
           L--KCGV------------C-----
Sequence 2 LSTKCGVKPDFPAVDKNLDCSKLPV



Alignment 59
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: O04403
Sequence identity: 26.09 (30/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMT--------CGQVQSNLVPCVTFLQ
           M--V--A--VV----------A------------CG-V-----PC--F--
Sequence 2 MRTVSMAALVVIAAALAWTSSAELASAPAPGEGPCGKVVHHIMPCLKFVK

Sequence 1 NGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQ
           -----P---CC-G----------T---R--C-C---A-----G-------
Sequence 2 GEEKEPSKSCCSGTKKLSEEVKTTEQKREACKCIVAATKGISGIKNELVA

Sequence 1 ALPGKCGV--NIPYKISTSTNCASIN--------
           --P-KCG-----P--I-----C--I---------
Sequence 2 EVPKKCGITTTLP-PITADFDCSKIESTIFRGYY



Alignment 60
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: Q40905
Sequence identity: 22.61 (26/115)
Sequence 1 -------------MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPC
           ---------------------------V----------TCG-V---L-PC
Sequence 2 MRTVSARSSVALVVIVAAVLVWTSSASVAPAPAPGSEETCGTVVGALMPC

Sequence 1 VTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLN
           --F-Q-----P--GCC-G-------------R---C-C--TA--------
Sequence 2 LPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDID

Sequence 1 PNNAQALPGKCGV---NIPYKISTSTNCASIN-------
           -------P--CG------P--I-----C-----------
Sequence 2 GKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVLHYKGN



Alignment 61
Sequence 1:
Sequence 2: Allergen Par j 2, Sequence: P55958
Sequence identity: 25.22 (29/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGM--------TCGQVQSNLVPCVTFLQ
           M--V--A--VV----------A------------CG-V-----PC--F--
Sequence 2 MRTVSMAALVVIAAALAWTSSAEPAPAPAPGEEACGKVVQDIMPCLHFVK

Sequence 1 NGGFVPAG-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQ
           -----P---CC-G----------T---R--C-C---A-----G-------
Sequence 2 GEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVA

Sequence 1 ALPGKCGV--NIPYKISTSTNCASIN--------
           --P-KC------P--I-----C--I---------
Sequence 2 EVPKKCDIKTTLP-PITADFDCSKIQSTIFRGYY



Alignment 62
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: O04404
Sequence identity: 22.61 (26/115)
Sequence 1 --------------MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVP
           --------------------A------------------TCG-V---L-P
Sequence 2 MRTVSAPSAVALVVIVAAGLAWTSLASVAPPAPAPGSEETCGTVVRALMP

Sequence 1 CVTFLQNGGFVPA-GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGL
           C--F-Q-----P--GCC-G-------------R---C-C--TA-------
Sequence 2 CLPFVQGKEKEPSKGCCSGAKRLDGETKTGLQRVHACECIQTAMKTYSDI

Sequence 1 NPNNAQALPGKCGV---NIPYKISTSTNCASIN-----------------
           --------P--CG------P--I-----C---------------------
Sequence 2 DGKLVSEVPKHCGIVDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPV

Sequence 1 ---------------------------
           ---------------------------
Sequence 2 TGPSDPAHKARLERPQIRVPPPAPEKA



Alignment 63
Sequence 1:
Sequence 2: Allergen Par j 1, Sequence: P43217
Sequence identity: 20.87 (24/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA-
           -------------------------TCG-----L-PC--F-Q-----P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           GCC-G-------------R---C-C--TA---------------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISTSTNCASIN-------------------------------
           -----P--I-----C-----------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 64
Sequence 1:
Sequence 2: Allergen Par j 1.0103, Sequence: CAI94601
Sequence identity: 20.87 (24/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA-
           -------------------------TCG-----L-PC--F-Q-----P--
Sequence 2 -----------------------QETCGTMVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           GCC-G-------------R---C-C--TA---------------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISTSTNCASIN-------------------------------
           -----P--I-----C-----------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTLGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 65
Sequence 1:
Sequence 2: Allergen Par j 1.0101, Sequence: CAA54587
Sequence identity: 18.26 (21/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPA-
           ---------------------------------L-PC--F-Q-----P--
Sequence 2 -----------------------------MVRALMPCLPFVQGKEKEPSK

Sequence 1 GCCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           GCC-G-------------R---C-C--TA---------------P--CG-
Sequence 2 GCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGKLVSEVPKHCGI

Sequence 1 ---NIPYKISTSTNCASIN-------------------------------
           -----P--I-----C-----------------------------------
Sequence 2 VDSKLP-PIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER

Sequence 1 -------------
           -------------
Sequence 2 PQIRVPPPAPEKA



Alignment 66
Sequence 1:
Sequence 2: Allergen Art v 3.0101, Sequence: P0C088
Sequence identity: 13.04 (15/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TC--V-----PC---L--GG-VPA-
Sequence 2 -----------------------ALTCSDVSNKISPCLSYLKQGGEVPAD

Sequence 1 CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGVN
           CC-GV---------------------------------------------
Sequence 2 CCAGVKGLND----------------------------------------

Sequence 1 IPYKISTSTNCASIN
           ---------------
Sequence 2 ---------------



Alignment 67
Sequence 1:
Sequence 2: Allergen Vit v 1, Sequence: P80274
Sequence identity: 15.65 (18/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQNGGFVPAG
           -------------------------TCGQV-S-L-PC---LQ--G-VPAG
Sequence 2 -----------------------TVTCGQVASALSPCIDYLQKDGAVPAG

Sequence 1 -CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCGV
           -CC-----------------------------------------------
Sequence 2 SCCXKXLSSA----------------------------------------

Sequence 1 NIPYKISTSTNCASIN
           ----------------
Sequence 2 ----------------



Alignment 68
Sequence 1:
Sequence 2: Allergen Cas s 8, Sequence: 10998016
Sequence identity: 15.65 (18/115)
Sequence 1 MASVKFACVVVLCMVVVGAHTAQGMTCGQVQSNLVPCVTFLQ-NGGFVPA
           -------------------------TC-QV---L-PC-T-L--NGG--P-
Sequence 2 -----------------------SITCTQVSKSLMPCLTYLKSNGGSPPP

Sequence 1 G-CCNGVRNIMNSARSTADRRGICNCLKTAAGAVRGLNPNNAQALPGKCG
           G-CC-GV-------------------------------------------
Sequence 2 GTCCQGVKL-----------------------------------------

Sequence 1 VNIPYKISTSTNCASIN
           -----------------
Sequence 2 -----------------


SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | Toolbox | News | Employment | Sitemap 
UT System | Reports to the State | Compact With Texans | Statewide Search
 
This site published by Ovidiu Ivanciuc
Copyright   2001-2013  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.