List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL
SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF
EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
EAQKAAKPATEATATATAAVGAATGAATAATGGYKV


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
21       29 GKATTEEQK       5.756       Click here for PD Search       Click here for Cross-React search
22       30 KATTEEQKL       4.797       Click here for PD Search       Click here for Cross-React search
108       116 TPEAKYDAY       4.304       Click here for PD Search       Click here for Cross-React search
49       57 PPADKYKTF       4.204       Click here for PD Search       Click here for Cross-React search
25       33 TEEQKLIEK       3.994       Click here for PD Search       Click here for Cross-React search
243       251 QKAAKPATE       3.673       Click here for PD Search       Click here for Cross-React search
48       56 VPPADKYKT       3.603       Click here for PD Search       Click here for Cross-React search
240       248 SEAQKAAKP       3.41       Click here for PD Search       Click here for Cross-React search
20       28 AGKATTEEQ       2.908       Click here for PD Search       Click here for Cross-React search
24       32 TTEEQKLIE       2.882       Click here for PD Search       Click here for Cross-React search
105       113 EGATPEAKY       2.819       Click here for PD Search       Click here for Cross-React search
107       115 ATPEAKYDA       2.775       Click here for PD Search       Click here for Cross-React search
97       105 YKLAYKTAE       2.749       Click here for PD Search       Click here for Cross-React search
106       114 GATPEAKYD       2.718       Click here for PD Search       Click here for Cross-React search
19       27 PAGKATTEE       2.596       Click here for PD Search       Click here for Cross-React search
102       110 KTAEGATPE       2.596       Click here for PD Search       Click here for Cross-React search
241       249 EAQKAAKPA       2.571       Click here for PD Search       Click here for Cross-React search
47       55 GVPPADKYK       2.471       Click here for PD Search       Click here for Cross-React search
101       109 YKTAEGATP       2.349       Click here for PD Search       Click here for Cross-React search
90       98 TSKLDAAYK       2.267       Click here for PD Search       Click here for Cross-React search
78       86 KGAAESSSK       2.24       Click here for PD Search       Click here for Cross-React search
76       84 EPKGAAESS       2.239       Click here for PD Search       Click here for Cross-React search
109       117 PEAKYDAYV       2.213       Click here for PD Search       Click here for Cross-React search
247       255 KPATEATAT       2.209       Click here for PD Search       Click here for Cross-React search
239       247 MSEAQKAAK       2.183       Click here for PD Search       Click here for Cross-React search
192       200 TGGAYESYK       2.165       Click here for PD Search       Click here for Cross-React search
244       252 KAAKPATEA       2.142       Click here for PD Search       Click here for Cross-React search
242       250 AQKAAKPAT       2.142       Click here for PD Search       Click here for Cross-React search
50       58 PADKYKTFV       2.018       Click here for PD Search       Click here for Cross-React search
26       34 EEQKLIEKI       1.94       Click here for PD Search       Click here for Cross-React search
52       60 DKYKTFVAT       1.883       Click here for PD Search       Click here for Cross-React search
94       102 DAAYKLAYK       1.855       Click here for PD Search       Click here for Cross-React search
168       176 ANAAPANDK       1.851       Click here for PD Search       Click here for Cross-React search
104       112 AEGATPEAK       1.817       Click here for PD Search       Click here for Cross-React search
27       35 EQKLIEKIN       1.801       Click here for PD Search       Click here for Cross-React search
218       226 ATAPEVKYT       1.762       Click here for PD Search       Click here for Cross-React search
28       36 QKLIEKIND       1.737       Click here for PD Search       Click here for Cross-React search
98       106 KLAYKTAEG       1.736       Click here for PD Search       Click here for Cross-React search
77       85 PKGAAESSS       1.732       Click here for PD Search       Click here for Cross-React search
75       83 AEPKGAAES       1.688       Click here for PD Search       Click here for Cross-React search
74       82 SAEPKGAAE       1.688       Click here for PD Search       Click here for Cross-React search
23       31 ATTEEQKLI       1.681       Click here for PD Search       Click here for Cross-React search
96       104 AYKLAYKTA       1.603       Click here for PD Search       Click here for Cross-React search
95       103 AAYKLAYKT       1.603       Click here for PD Search       Click here for Cross-React search
169       177 NAAPANDKF       1.587       Click here for PD Search       Click here for Cross-React search
237       245 TAMSEAQKA       1.575       Click here for PD Search       Click here for Cross-React search
84       92 SSKAALTSK       1.556       Click here for PD Search       Click here for Cross-React search
246       254 AKPATEATA       1.546       Click here for PD Search       Click here for Cross-React search
245       253 AAKPATEAT       1.546       Click here for PD Search       Click here for Cross-React search
100       108 AYKTAEGAT       1.535       Click here for PD Search       Click here for Cross-React search
18       26 APAGKATTE       1.514       Click here for PD Search       Click here for Cross-React search
32       40 EKINDGFKA       1.502       Click here for PD Search       Click here for Cross-React search
191       199 STGGAYESY       1.451       Click here for PD Search       Click here for Cross-React search
110       118 EAKYDAYVA       1.446       Click here for PD Search       Click here for Cross-React search
196       204 YESYKFIPA       1.438       Click here for PD Search       Click here for Cross-React search
195       203 AYESYKFIP       1.438       Click here for PD Search       Click here for Cross-React search
170       178 AAPANDKFT       1.424       Click here for PD Search       Click here for Cross-React search
189       197 KASTGGAYE       1.396       Click here for PD Search       Click here for Cross-React search
137       145 KPAAEEVKV       1.388       Click here for PD Search       Click here for Cross-React search
136       144 VKPAAEEVK       1.388       Click here for PD Search       Click here for Cross-React search
70       78 AEGLSAEPK       1.378       Click here for PD Search       Click here for Cross-React search
71       79 EGLSAEPKG       1.349       Click here for PD Search       Click here for Cross-React search
82       90 ESSSKAALT       1.347       Click here for PD Search       Click here for Cross-React search
221       229 PEVKYTVFE       1.331       Click here for PD Search       Click here for Cross-React search
51       59 ADKYKTFVA       1.318       Click here for PD Search       Click here for Cross-React search
103       111 TAEGATPEA       1.312       Click here for PD Search       Click here for Cross-React search
193       201 GGAYESYKF       1.299       Click here for PD Search       Click here for Cross-React search
91       99 SKLDAAYKL       1.295       Click here for PD Search       Click here for Cross-React search
219       227 TAPEVKYTV       1.294       Click here for PD Search       Click here for Cross-React search
134       142 HAVKPAAEE       1.285       Click here for PD Search       Click here for Cross-React search
8       16 PATPAAPAE       1.281       Click here for PD Search       Click here for Cross-React search
233       241 KKAITAMSE       1.262       Click here for PD Search       Click here for Cross-React search
46       54 AGVPPADKY       1.248       Click here for PD Search       Click here for Cross-React search
222       230 EVKYTVFET       1.243       Click here for PD Search       Click here for Cross-React search
111       119 AKYDAYVAT       1.205       Click here for PD Search       Click here for Cross-React search
86       94 KAALTSKLD       1.193       Click here for PD Search       Click here for Cross-React search
80       88 AAESSSKAA       1.155       Click here for PD Search       Click here for Cross-React search
14       22 PAEAAPAGK       1.136       Click here for PD Search       Click here for Cross-React search
229       237 ETALKKAIT       1.133       Click here for PD Search       Click here for Cross-React search
79       87 GAAESSSKA       1.132       Click here for PD Search       Click here for Cross-React search
248       256 PATEATATA       1.116       Click here for PD Search       Click here for Cross-React search
238       246 AMSEAQKAA       1.103       Click here for PD Search       Click here for Cross-React search
236       244 ITAMSEAQK       1.093       Click here for PD Search       Click here for Cross-React search
16       24 EAAPAGKAT       1.06       Click here for PD Search       Click here for Cross-React search
171       179 APANDKFTV       1.046       Click here for PD Search       Click here for Cross-React search
83       91 SSSKAALTS       1.043       Click here for PD Search       Click here for Cross-React search
31       39 IEKINDGFK       1.042       Click here for PD Search       Click here for Cross-React search
250       258 TEATATATA       1.041       Click here for PD Search       Click here for Cross-React search
249       257 ATEATATAT       1.041       Click here for PD Search       Click here for Cross-React search
226       234 TVFETALKK       1.028       Click here for PD Search       Click here for Cross-React search
174       182 NDKFTVFEA       1.004       Click here for PD Search       Click here for Cross-React search
173       181 ANDKFTVFE       1.004       Click here for PD Search       Click here for Cross-React search
155       163 EKVDSAFKV       0.994       Click here for PD Search       Click here for Cross-React search
29       37 KLIEKINDG       0.993       Click here for PD Search       Click here for Cross-React search
112       120 KYDAYVATL       0.984       Click here for PD Search       Click here for Cross-React search
92       100 KLDAAYKLA       0.977       Click here for PD Search       Click here for Cross-React search
53       61 KYKTFVATF       0.977       Click here for PD Search       Click here for Cross-React search
206       214 EAAVKQAYA       0.967       Click here for PD Search       Click here for Cross-React search
85       93 SKAALTSKL       0.957       Click here for PD Search       Click here for Cross-React search
81       89 AESSSKAAL       0.943       Click here for PD Search       Click here for Cross-React search
185       193 NNAIKASTG       0.942       Click here for PD Search       Click here for Cross-React search
154       162 IEKVDSAFK       0.939       Click here for PD Search       Click here for Cross-React search
89       97 LTSKLDAAY       0.935       Click here for PD Search       Click here for Cross-React search
190       198 ASTGGAYES       0.935       Click here for PD Search       Click here for Cross-React search
167       175 AANAAPAND       0.935       Click here for PD Search       Click here for Cross-React search
194       202 GAYESYKFI       0.92       Click here for PD Search       Click here for Cross-React search
217       225 VATAPEVKY       0.906       Click here for PD Search       Click here for Cross-React search
172       180 PANDKFTVF       0.897       Click here for PD Search       Click here for Cross-React search
11       19 PAAPAEAAP       0.897       Click here for PD Search       Click here for Cross-React search
63       71 AASNKAFAE       0.896       Click here for PD Search       Click here for Cross-React search
17       25 AAPAGKATT       0.883       Click here for PD Search       Click here for Cross-React search
64       72 ASNKAFAEG       0.878       Click here for PD Search       Click here for Cross-React search
267       275 ATAATGGYK       0.877       Click here for PD Search       Click here for Cross-React search
99       107 LAYKTAEGA       0.877       Click here for PD Search       Click here for Cross-React search
33       41 KINDGFKAA       0.876       Click here for PD Search       Click here for Cross-React search
10       18 TPAAPAEAA       0.837       Click here for PD Search       Click here for Cross-React search
9       17 ATPAAPAEA       0.837       Click here for PD Search       Click here for Cross-React search
216       224 TVATAPEVK       0.835       Click here for PD Search       Click here for Cross-React search
184       192 FNNAIKAST       0.825       Click here for PD Search       Click here for Cross-React search
166       174 TAANAAPAN       0.808       Click here for PD Search       Click here for Cross-React search
210       218 KQAYAATVA       0.806       Click here for PD Search       Click here for Cross-React search
208       216 AVKQAYAAT       0.806       Click here for PD Search       Click here for Cross-React search
45       53 AAGVPPADK       0.805       Click here for PD Search       Click here for Cross-React search
225       233 YTVFETALK       0.805       Click here for PD Search       Click here for Cross-React search
224       232 KYTVFETAL       0.805       Click here for PD Search       Click here for Cross-React search
73       81 LSAEPKGAA       0.804       Click here for PD Search       Click here for Cross-React search
205       213 LEAAVKQAY       0.789       Click here for PD Search       Click here for Cross-React search
72       80 GLSAEPKGA       0.787       Click here for PD Search       Click here for Cross-React search
203       211 PALEAAVKQ       0.779       Click here for PD Search       Click here for Cross-React search
220       228 APEVKYTVF       0.777       Click here for PD Search       Click here for Cross-React search
93       101 LDAAYKLAY       0.765       Click here for PD Search       Click here for Cross-React search
198       206 SYKFIPALE       0.757       Click here for PD Search       Click here for Cross-React search
197       205 ESYKFIPAL       0.757       Click here for PD Search       Click here for Cross-React search
181       189 EAAFNNAIK       0.746       Click here for PD Search       Click here for Cross-React search
15       23 AEAAPAGKA       0.742       Click here for PD Search       Click here for Cross-React search
150       158 ELQVIEKVD       0.735       Click here for PD Search       Click here for Cross-React search
7       15 GPATPAAPA       0.732       Click here for PD Search       Click here for Cross-React search
60       68 TFGAASNKA       0.731       Click here for PD Search       Click here for Cross-React search
59       67 ATFGAASNK       0.731       Click here for PD Search       Click here for Cross-React search
251       259 EATATATAA       0.729       Click here for PD Search       Click here for Cross-React search
114       122 DAYVATLSE       0.729       Click here for PD Search       Click here for Cross-React search
5       13 YGGPATPAA       0.726       Click here for PD Search       Click here for Cross-React search
223       231 VKYTVFETA       0.725       Click here for PD Search       Click here for Cross-React search
227       235 VFETALKKA       0.72       Click here for PD Search       Click here for Cross-React search
6       14 GGPATPAAP       0.717       Click here for PD Search       Click here for Cross-React search
66       74 NKAFAEGLS       0.716       Click here for PD Search       Click here for Cross-React search
65       73 SNKAFAEGL       0.716       Click here for PD Search       Click here for Cross-React search
4       12 GYGGPATPA       0.712       Click here for PD Search       Click here for Cross-React search
135       143 AVKPAAEEV       0.701       Click here for PD Search       Click here for Cross-React search
152       160 QVIEKVDSA       0.697       Click here for PD Search       Click here for Cross-React search
228       236 FETALKKAI       0.68       Click here for PD Search       Click here for Cross-React search
230       238 TALKKAITA       0.661       Click here for PD Search       Click here for Cross-React search
113       121 YDAYVATLS       0.659       Click here for PD Search       Click here for Cross-React search
268       276 TAATGGYKV       0.644       Click here for PD Search       Click here for Cross-React search
130       138 TLEVHAVKP       0.642       Click here for PD Search       Click here for Cross-React search
234       242 KAITAMSEA       0.638       Click here for PD Search       Click here for Cross-React search
175       183 DKFTVFEAA       0.631       Click here for PD Search       Click here for Cross-React search
2       10 DLGYGGPAT       0.627       Click here for PD Search       Click here for Cross-React search
88       96 ALTSKLDAA       0.603       Click here for PD Search       Click here for Cross-React search
87       95 AALTSKLDA       0.603       Click here for PD Search       Click here for Cross-React search
232       240 LKKAITAMS       0.601       Click here for PD Search       Click here for Cross-React search
69       77 FAEGLSAEP       0.596       Click here for PD Search       Click here for Cross-React search
148       156 AGELQVIEK       0.593       Click here for PD Search       Click here for Cross-React search
209       217 VKQAYAATV       0.592       Click here for PD Search       Click here for Cross-React search
12       20 AAPAEAAPA       0.586       Click here for PD Search       Click here for Cross-React search
3       11 LGYGGPATP       0.581       Click here for PD Search       Click here for Cross-React search
211       219 QAYAATVAT       0.581       Click here for PD Search       Click here for Cross-React search
186       194 NAIKASTGG       0.58       Click here for PD Search       Click here for Cross-React search
156       164 KVDSAFKVA       0.58       Click here for PD Search       Click here for Cross-React search
183       191 AFNNAIKAS       0.577       Click here for PD Search       Click here for Cross-React search
214       222 AATVATAPE       0.574       Click here for PD Search       Click here for Cross-React search
13       21 APAEAAPAG       0.574       Click here for PD Search       Click here for Cross-React search
199       207 YKFIPALEA       0.57       Click here for PD Search       Click here for Cross-React search
158       166 DSAFKVAAT       0.57       Click here for PD Search       Click here for Cross-React search
151       159 LQVIEKVDS       0.569       Click here for PD Search       Click here for Cross-React search
188       196 IKASTGGAY       0.565       Click here for PD Search       Click here for Cross-React search
207       215 AAVKQAYAA       0.564       Click here for PD Search       Click here for Cross-React search
235       243 AITAMSEAQ       0.552       Click here for PD Search       Click here for Cross-React search
133       141 VHAVKPAAE       0.551       Click here for PD Search       Click here for Cross-React search
132       140 EVHAVKPAA       0.551       Click here for PD Search       Click here for Cross-React search
144       152 KVIPAGELQ       0.529       Click here for PD Search       Click here for Cross-React search
35       43 NDGFKAALA       0.521       Click here for PD Search       Click here for Cross-React search
213       221 YAATVATAP       0.519       Click here for PD Search       Click here for Cross-React search
62       70 GAASNKAFA       0.512       Click here for PD Search       Click here for Cross-React search
204       212 ALEAAVKQA       0.509       Click here for PD Search       Click here for Cross-React search
165       173 ATAANAAPA       0.508       Click here for PD Search       Click here for Cross-React search
164       172 AATAANAAP       0.508       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database