List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP
ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE
AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA
APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET
ALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
32       40 GKATTEEQK       5.948       Click here for PD Search       Click here for Cross-React search
33       41 KATTEEQKL       4.957       Click here for PD Search       Click here for Cross-React search
59       67 QPADKYRTF       4.765       Click here for PD Search       Click here for Cross-React search
118       126 TPEAKYDAY       4.447       Click here for PD Search       Click here for Cross-React search
36       44 TEEQKLIEK       4.127       Click here for PD Search       Click here for Cross-React search
58       66 VQPADKYRT       4.084       Click here for PD Search       Click here for Cross-React search
250       258 SEAQKAAKP       3.524       Click here for PD Search       Click here for Cross-React search
31       39 AGKATTEEQ       3.005       Click here for PD Search       Click here for Cross-React search
35       43 TTEEQKLIE       2.978       Click here for PD Search       Click here for Cross-React search
115       123 EGATPEAKY       2.913       Click here for PD Search       Click here for Cross-React search
117       125 ATPEAKYDA       2.867       Click here for PD Search       Click here for Cross-React search
107       115 YKLAYKTAE       2.84       Click here for PD Search       Click here for Cross-React search
116       124 GATPEAKYD       2.809       Click here for PD Search       Click here for Cross-React search
57       65 GVQPADKYR       2.8       Click here for PD Search       Click here for Cross-React search
112       120 KTAEGATPE       2.683       Click here for PD Search       Click here for Cross-React search
251       259 EAQKAAKPA       2.656       Click here for PD Search       Click here for Cross-React search
111       119 YKTAEGATP       2.427       Click here for PD Search       Click here for Cross-React search
100       108 TSKLDAAYK       2.342       Click here for PD Search       Click here for Cross-React search
88       96 KGAAESSSK       2.315       Click here for PD Search       Click here for Cross-React search
86       94 EPKGAAESS       2.313       Click here for PD Search       Click here for Cross-React search
119       127 PEAKYDAYV       2.287       Click here for PD Search       Click here for Cross-React search
249       257 MSEAQKAAK       2.255       Click here for PD Search       Click here for Cross-React search
202       210 TGGAYESYK       2.237       Click here for PD Search       Click here for Cross-React search
60       68 PADKYRTFV       2.042       Click here for PD Search       Click here for Cross-React search
37       45 EEQKLIEKI       2.005       Click here for PD Search       Click here for Cross-React search
104       112 DAAYKLAYK       1.917       Click here for PD Search       Click here for Cross-React search
178       186 ANAAPANDK       1.913       Click here for PD Search       Click here for Cross-React search
62       70 DKYRTFVAT       1.906       Click here for PD Search       Click here for Cross-React search
114       122 AEGATPEAK       1.878       Click here for PD Search       Click here for Cross-React search
38       46 EQKLIEKIN       1.861       Click here for PD Search       Click here for Cross-React search
228       236 ATAPEVKYT       1.82       Click here for PD Search       Click here for Cross-React search
108       116 KLAYKTAEG       1.794       Click here for PD Search       Click here for Cross-React search
87       95 PKGAAESSS       1.79       Click here for PD Search       Click here for Cross-React search
30       38 AAGKATTEE       1.753       Click here for PD Search       Click here for Cross-React search
34       42 ATTEEQKLI       1.737       Click here for PD Search       Click here for Cross-React search
195       203 NDEIKASTG       1.733       Click here for PD Search       Click here for Cross-React search
17       25 YTPATPAAP       1.711       Click here for PD Search       Click here for Cross-React search
85       93 GEPKGAAES       1.708       Click here for PD Search       Click here for Cross-React search
84       92 SGEPKGAAE       1.708       Click here for PD Search       Click here for Cross-React search
29       37 DAAGKATTE       1.69       Click here for PD Search       Click here for Cross-React search
106       114 AYKLAYKTA       1.657       Click here for PD Search       Click here for Cross-React search
105       113 AAYKLAYKT       1.657       Click here for PD Search       Click here for Cross-React search
179       187 NAAPANDKF       1.639       Click here for PD Search       Click here for Cross-React search
247       255 TAMSEAQKA       1.628       Click here for PD Search       Click here for Cross-React search
94       102 SSKAALTSK       1.608       Click here for PD Search       Click here for Cross-React search
110       118 AYKTAEGAT       1.586       Click here for PD Search       Click here for Cross-React search
253       261 QKAAKPAAA       1.55       Click here for PD Search       Click here for Cross-React search
252       260 AQKAAKPAA       1.55       Click here for PD Search       Click here for Cross-React search
194       202 FNDEIKAST       1.517       Click here for PD Search       Click here for Cross-React search
201       209 STGGAYESY       1.499       Click here for PD Search       Click here for Cross-React search
120       128 EAKYDAYVA       1.494       Click here for PD Search       Click here for Cross-React search
206       214 YESYKFIPA       1.486       Click here for PD Search       Click here for Cross-React search
205       213 AYESYKFIP       1.486       Click here for PD Search       Click here for Cross-React search
180       188 AAPANDKFT       1.471       Click here for PD Search       Click here for Cross-React search
56       64 AGVQPADKY       1.444       Click here for PD Search       Click here for Cross-React search
199       207 KASTGGAYE       1.442       Click here for PD Search       Click here for Cross-React search
147       155 KPAAEEVKV       1.434       Click here for PD Search       Click here for Cross-React search
146       154 VKPAAEEVK       1.434       Click here for PD Search       Click here for Cross-React search
73       81 PASNKAFAE       1.417       Click here for PD Search       Click here for Cross-React search
80       88 AEGLSGEPK       1.394       Click here for PD Search       Click here for Cross-React search
92       100 ESSSKAALT       1.392       Click here for PD Search       Click here for Cross-React search
231       239 PEVKYTVFE       1.376       Click here for PD Search       Click here for Cross-React search
191       199 EAAFNDEIK       1.372       Click here for PD Search       Click here for Cross-React search
81       89 EGLSGEPKG       1.366       Click here for PD Search       Click here for Cross-React search
113       121 TAEGATPEA       1.355       Click here for PD Search       Click here for Cross-React search
203       211 GGAYESYKF       1.342       Click here for PD Search       Click here for Cross-React search
101       109 SKLDAAYKL       1.338       Click here for PD Search       Click here for Cross-React search
229       237 TAPEVKYTV       1.337       Click here for PD Search       Click here for Cross-React search
61       69 ADKYRTFVA       1.334       Click here for PD Search       Click here for Cross-React search
144       152 HAVKPAAEE       1.328       Click here for PD Search       Click here for Cross-React search
243       251 KKAITAMSE       1.304       Click here for PD Search       Click here for Cross-React search
232       240 EVKYTVFET       1.284       Click here for PD Search       Click here for Cross-React search
121       129 AKYDAYVAT       1.245       Click here for PD Search       Click here for Cross-React search
96       104 KAALTSKLD       1.233       Click here for PD Search       Click here for Cross-React search
90       98 AAESSSKAA       1.194       Click here for PD Search       Click here for Cross-React search
5       13 YGPATPAAP       1.173       Click here for PD Search       Click here for Cross-React search
239       247 ETALKKAIT       1.17       Click here for PD Search       Click here for Cross-React search
89       97 GAAESSSKA       1.169       Click here for PD Search       Click here for Cross-React search
70       78 TFGPASNKA       1.157       Click here for PD Search       Click here for Cross-React search
69       77 ATFGPASNK       1.157       Click here for PD Search       Click here for Cross-React search
248       256 AMSEAQKAA       1.139       Click here for PD Search       Click here for Cross-React search
246       254 ITAMSEAQK       1.129       Click here for PD Search       Click here for Cross-React search
18       26 TPATPAAPA       1.103       Click here for PD Search       Click here for Cross-React search
16       24 GYTPATPAA       1.095       Click here for PD Search       Click here for Cross-React search
15       23 AGYTPATPA       1.095       Click here for PD Search       Click here for Cross-React search
14       22 AAGYTPATP       1.095       Click here for PD Search       Click here for Cross-React search
13       21 PAAGYTPAT       1.095       Click here for PD Search       Click here for Cross-React search
39       47 QKLIEKINA       1.086       Click here for PD Search       Click here for Cross-React search
181       189 APANDKFTV       1.081       Click here for PD Search       Click here for Cross-React search
93       101 SSSKAALTS       1.077       Click here for PD Search       Click here for Cross-React search
196       204 DEIKASTGG       1.067       Click here for PD Search       Click here for Cross-React search
236       244 TVFETALKK       1.062       Click here for PD Search       Click here for Cross-React search
193       201 AFNDEIKAS       1.062       Click here for PD Search       Click here for Cross-React search
184       192 NDKFTVFEA       1.038       Click here for PD Search       Click here for Cross-React search
183       191 ANDKFTVFE       1.038       Click here for PD Search       Click here for Cross-React search
122       130 KYDAYVATL       1.016       Click here for PD Search       Click here for Cross-React search
2       10 DLGYGPATP       1.013       Click here for PD Search       Click here for Cross-React search
102       110 KLDAAYKLA       1.009       Click here for PD Search       Click here for Cross-React search
216       224 EAAVKQAYA       0.999       Click here for PD Search       Click here for Cross-React search
95       103 SKAALTSKL       0.989       Click here for PD Search       Click here for Cross-React search
63       71 KYRTFVATF       0.988       Click here for PD Search       Click here for Cross-React search
28       36 ADAAGKATT       0.986       Click here for PD Search       Click here for Cross-React search
91       99 AESSSKAAL       0.975       Click here for PD Search       Click here for Cross-React search
200       208 ASTGGAYES       0.967       Click here for PD Search       Click here for Cross-React search
177       185 AANAAPAND       0.966       Click here for PD Search       Click here for Cross-React search
99       107 LTSKLDAAY       0.966       Click here for PD Search       Click here for Cross-React search
204       212 GAYESYKFI       0.951       Click here for PD Search       Click here for Cross-React search
43       51 EKINAGFKA       0.939       Click here for PD Search       Click here for Cross-React search
227       235 VATAPEVKY       0.936       Click here for PD Search       Click here for Cross-React search
257       265 KPAAAATAT       0.932       Click here for PD Search       Click here for Cross-React search
182       190 PANDKFTVF       0.927       Click here for PD Search       Click here for Cross-React search
55       63 GAGVQPADK       0.912       Click here for PD Search       Click here for Cross-React search
74       82 ASNKAFAEG       0.907       Click here for PD Search       Click here for Cross-React search
277       285 ATAATGGYK       0.906       Click here for PD Search       Click here for Cross-React search
109       117 LAYKTAEGA       0.906       Click here for PD Search       Click here for Cross-React search
254       262 KAAKPAAAA       0.904       Click here for PD Search       Click here for Cross-React search
226       234 TVATAPEVK       0.862       Click here for PD Search       Click here for Cross-React search
176       184 TAANAAPAN       0.835       Click here for PD Search       Click here for Cross-React search
220       228 KQAYAATVA       0.833       Click here for PD Search       Click here for Cross-React search
218       226 AVKQAYAAT       0.833       Click here for PD Search       Click here for Cross-React search
235       243 YTVFETALK       0.832       Click here for PD Search       Click here for Cross-React search
234       242 KYTVFETAL       0.832       Click here for PD Search       Click here for Cross-React search
21       29 TPAAPAGAD       0.817       Click here for PD Search       Click here for Cross-React search
215       223 LEAAVKQAY       0.816       Click here for PD Search       Click here for Cross-React search
83       91 LSGEPKGAA       0.813       Click here for PD Search       Click here for Cross-React search
72       80 GPASNKAFA       0.81       Click here for PD Search       Click here for Cross-React search
213       221 PALEAAVKQ       0.805       Click here for PD Search       Click here for Cross-React search
230       238 APEVKYTVF       0.802       Click here for PD Search       Click here for Cross-React search
192       200 AAFNDEIKA       0.8       Click here for PD Search       Click here for Cross-React search
82       90 GLSGEPKGA       0.797       Click here for PD Search       Click here for Cross-React search
103       111 LDAAYKLAY       0.791       Click here for PD Search       Click here for Cross-React search
208       216 SYKFIPALE       0.782       Click here for PD Search       Click here for Cross-React search
207       215 ESYKFIPAL       0.782       Click here for PD Search       Click here for Cross-React search
165       173 EKVDAAFKV       0.774       Click here for PD Search       Click here for Cross-React search
7       15 PATPAAPAA       0.772       Click here for PD Search       Click here for Cross-React search
12       20 APAAGYTPA       0.766       Click here for PD Search       Click here for Cross-React search
11       19 AAPAAGYTP       0.766       Click here for PD Search       Click here for Cross-React search
10       18 PAAPAAGYT       0.766       Click here for PD Search       Click here for Cross-React search
9       17 TPAAPAAGY       0.766       Click here for PD Search       Click here for Cross-React search
160       168 ELQVIEKVD       0.76       Click here for PD Search       Click here for Cross-React search
6       14 GPATPAAPA       0.756       Click here for PD Search       Click here for Cross-React search
19       27 PATPAAPAG       0.756       Click here for PD Search       Click here for Cross-React search
124       132 DAYVATLSE       0.753       Click here for PD Search       Click here for Cross-React search
4       12 GYGPATPAA       0.751       Click here for PD Search       Click here for Cross-React search
233       241 VKYTVFETA       0.749       Click here for PD Search       Click here for Cross-React search
237       245 VFETALKKA       0.743       Click here for PD Search       Click here for Cross-React search
76       84 NKAFAEGLS       0.74       Click here for PD Search       Click here for Cross-React search
75       83 SNKAFAEGL       0.74       Click here for PD Search       Click here for Cross-React search
164       172 IEKVDAAFK       0.731       Click here for PD Search       Click here for Cross-React search
25       33 PAGADAAGK       0.724       Click here for PD Search       Click here for Cross-React search
145       153 AVKPAAEEV       0.724       Click here for PD Search       Click here for Cross-React search
238       246 FETALKKAI       0.702       Click here for PD Search       Click here for Cross-React search
71       79 FGPASNKAF       0.694       Click here for PD Search       Click here for Cross-React search
240       248 TALKKAITA       0.683       Click here for PD Search       Click here for Cross-React search
123       131 YDAYVATLS       0.681       Click here for PD Search       Click here for Cross-React search
27       35 GADAAGKAT       0.676       Click here for PD Search       Click here for Cross-React search
278       286 TAATGGYKV       0.666       Click here for PD Search       Click here for Cross-React search
140       148 TLEVHAVKP       0.664       Click here for PD Search       Click here for Cross-React search
1       9 ADLGYGPAT       0.662       Click here for PD Search       Click here for Cross-React search
244       252 KAITAMSEA       0.659       Click here for PD Search       Click here for Cross-React search
256       264 AKPAAAATA       0.652       Click here for PD Search       Click here for Cross-React search
255       263 AAKPAAAAT       0.652       Click here for PD Search       Click here for Cross-React search
185       193 DKFTVFEAA       0.652       Click here for PD Search       Click here for Cross-React search
42       50 IEKINAGFK       0.651       Click here for PD Search       Click here for Cross-React search
197       205 EIKASTGGA       0.645       Click here for PD Search       Click here for Cross-React search
189       197 VFEAAFNDE       0.629       Click here for PD Search       Click here for Cross-React search
98       106 ALTSKLDAA       0.623       Click here for PD Search       Click here for Cross-React search
97       105 AALTSKLDA       0.623       Click here for PD Search       Click here for Cross-React search
242       250 LKKAITAMS       0.621       Click here for PD Search       Click here for Cross-React search
40       48 KLIEKINAG       0.62       Click here for PD Search       Click here for Cross-React search
3       11 LGYGPATPA       0.613       Click here for PD Search       Click here for Cross-React search
158       166 AGELQVIEK       0.613       Click here for PD Search       Click here for Cross-React search
219       227 VKQAYAATV       0.612       Click here for PD Search       Click here for Cross-React search
79       87 FAEGLSGEP       0.604       Click here for PD Search       Click here for Cross-React search
221       229 QAYAATVAT       0.601       Click here for PD Search       Click here for Cross-React search
190       198 FEAAFNDEI       0.594       Click here for PD Search       Click here for Cross-React search
224       232 AATVATAPE       0.593       Click here for PD Search       Click here for Cross-React search
209       217 YKFIPALEA       0.589       Click here for PD Search       Click here for Cross-React search
198       206 IKASTGGAY       0.584       Click here for PD Search       Click here for Cross-React search
217       225 AAVKQAYAA       0.583       Click here for PD Search       Click here for Cross-React search
22       30 PAAPAGADA       0.572       Click here for PD Search       Click here for Cross-React search
245       253 AITAMSEAQ       0.57       Click here for PD Search       Click here for Cross-React search
143       151 VHAVKPAAE       0.569       Click here for PD Search       Click here for Cross-React search
142       150 EVHAVKPAA       0.569       Click here for PD Search       Click here for Cross-React search
44       52 KINAGFKAA       0.548       Click here for PD Search       Click here for Cross-React search
154       162 KVIPAGELQ       0.547       Click here for PD Search       Click here for Cross-React search
162       170 QVIEKVDAA       0.543       Click here for PD Search       Click here for Cross-React search
223       231 YAATVATAP       0.536       Click here for PD Search       Click here for Cross-React search
214       222 ALEAAVKQA       0.526       Click here for PD Search       Click here for Cross-React search
175       183 ATAANAAPA       0.525       Click here for PD Search       Click here for Cross-React search
174       182 AATAANAAP       0.525       Click here for PD Search       Click here for Cross-React search
188       196 TVFEAAFND       0.524       Click here for PD Search       Click here for Cross-React search
150       158 AEEVKVIPA       0.503       Click here for PD Search       Click here for Cross-React search
149       157 AAEEVKVIP       0.503       Click here for PD Search       Click here for Cross-React search
148       156 PAAEEVKVI       0.503       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database