List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

EFRGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNF
EIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFF
GADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLT
AMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTV
AKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKC
AQETAWDFALPKQ


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
16       24 KKISQEREK       7.844       Click here for PD Search       Click here for Cross-React search
96       104 RHRDRPTTG       5.584       Click here for PD Search       Click here for Cross-React search
95       103 MRHRDRPTT       5.584       Click here for PD Search       Click here for Cross-React search
20       28 QEREKFADE       5.282       Click here for PD Search       Click here for Cross-React search
98       106 RDRPTTGNT       4.863       Click here for PD Search       Click here for Cross-React search
184       192 RQLKKHFKE       4.685       Click here for PD Search       Click here for Cross-React search
183       191 QRQLKKHFK       4.685       Click here for PD Search       Click here for Cross-React search
97       105 HRDRPTTGN       4.585       Click here for PD Search       Click here for Cross-React search
19       27 SQEREKFAD       4.087       Click here for PD Search       Click here for Cross-React search
15       23 GKKISQERE       3.881       Click here for PD Search       Click here for Cross-React search
94       102 GMRHRDRPT       3.829       Click here for PD Search       Click here for Cross-React search
14       22 DGKKISQER       3.743       Click here for PD Search       Click here for Cross-React search
17       25 KISQEREKF       3.396       Click here for PD Search       Click here for Cross-React search
135       143 EFQRKLQHD       3.388       Click here for PD Search       Click here for Cross-React search
187       195 KKHFKEGKG       3.28       Click here for PD Search       Click here for Cross-React search
146       154 KLEFERHDP       3.025       Click here for PD Search       Click here for Cross-React search
21       29 EREKFADEG       3.018       Click here for PD Search       Click here for Cross-React search
150       158 ERHDPVDGR       2.938       Click here for PD Search       Click here for Cross-React search
280       288 RGLEKPKDM       2.903       Click here for PD Search       Click here for Cross-React search
279       287 MRGLEKPKD       2.903       Click here for PD Search       Click here for Cross-React search
180       188 TAMQRQLKK       2.869       Click here for PD Search       Click here for Cross-React search
177       185 KKLTAMQRQ       2.869       Click here for PD Search       Click here for Cross-React search
186       194 LKKHFKEGK       2.733       Click here for PD Search       Click here for Cross-React search
181       189 AMQRQLKKH       2.705       Click here for PD Search       Click here for Cross-React search
93       101 MGMRHRDRP       2.626       Click here for PD Search       Click here for Cross-React search
284       292 KPKDMGFTR       2.54       Click here for PD Search       Click here for Cross-React search
100       108 RPTTGNTLK       2.452       Click here for PD Search       Click here for Cross-React search
131       139 KNFLEFQRK       2.397       Click here for PD Search       Click here for Cross-React search
185       193 QLKKHFKEG       2.367       Click here for PD Search       Click here for Cross-React search
22       30 REKFADEGS       2.336       Click here for PD Search       Click here for Cross-React search
182       190 MQRQLKKHF       2.318       Click here for PD Search       Click here for Cross-React search
92       100 SMGMRHRDR       2.276       Click here for PD Search       Click here for Cross-React search
148       156 EFERHDPVD       2.273       Click here for PD Search       Click here for Cross-React search
283       291 EKPKDMGFT       2.246       Click here for PD Search       Click here for Cross-React search
176       184 SKKLTAMQR       2.22       Click here for PD Search       Click here for Cross-React search
11       19 KRFDGKKIS       2.161       Click here for PD Search       Click here for Cross-React search
53       61 LSTPQRNFE       2.07       Click here for PD Search       Click here for Cross-React search
99       107 DRPTTGNTL       2.047       Click here for PD Search       Click here for Cross-React search
175       183 QSKKLTAMQ       1.963       Click here for PD Search       Click here for Cross-React search
12       20 RFDGKKISQ       1.871       Click here for PD Search       Click here for Cross-React search
54       62 STPQRNFEI       1.76       Click here for PD Search       Click here for Cross-React search
90       98 QTSMGMRHR       1.739       Click here for PD Search       Click here for Cross-React search
261       269 GNGELSNKE       1.723       Click here for PD Search       Click here for Cross-React search
18       26 ISQEREKFA       1.716       Click here for PD Search       Click here for Cross-React search
88       96 RSQTSMGMR       1.712       Click here for PD Search       Click here for Cross-React search
156       164 DGRITERQF       1.709       Click here for PD Search       Click here for Cross-React search
76       84 DMEEFEQVQ       1.698       Click here for PD Search       Click here for Cross-React search
74       82 EVDMEEFEQ       1.698       Click here for PD Search       Click here for Cross-React search
101       109 PTTGNTLKS       1.678       Click here for PD Search       Click here for Cross-React search
91       99 TSMGMRHRD       1.677       Click here for PD Search       Click here for Cross-React search
134       142 LEFQRKLQH       1.673       Click here for PD Search       Click here for Cross-React search
260       268 DGNGELSNK       1.661       Click here for PD Search       Click here for Cross-React search
13       21 FDGKKISQE       1.655       Click here for PD Search       Click here for Cross-React search
145       153 LKLEFERHD       1.613       Click here for PD Search       Click here for Cross-React search
138       146 RKLQHDVLK       1.597       Click here for PD Search       Click here for Cross-React search
276       284 QRLMRGLEK       1.573       Click here for PD Search       Click here for Cross-React search
275       283 KQRLMRGLE       1.573       Click here for PD Search       Click here for Cross-React search
262       270 NGELSNKEF       1.507       Click here for PD Search       Click here for Cross-React search
170       178 AYSGVQSKK       1.484       Click here for PD Search       Click here for Cross-React search
51       59 TVLSTPQRN       1.479       Click here for PD Search       Click here for Cross-React search
281       289 GLEKPKDMG       1.467       Click here for PD Search       Click here for Cross-React search
155       163 VDGRITERQ       1.465       Click here for PD Search       Click here for Cross-React search
136       144 FQRKLQHDV       1.452       Click here for PD Search       Click here for Cross-React search
278       286 LMRGLEKPK       1.434       Click here for PD Search       Click here for Cross-React search
277       285 RLMRGLEKP       1.404       Click here for PD Search       Click here for Cross-React search
137       145 QRKLQHDVL       1.383       Click here for PD Search       Click here for Cross-React search
77       85 MEEFEQVQS       1.363       Click here for PD Search       Click here for Cross-React search
188       196 KHFKEGKGL       1.353       Click here for PD Search       Click here for Cross-React search
55       63 TPQRNFEIA       1.327       Click here for PD Search       Click here for Cross-React search
50       58 TTVLSTPQR       1.327       Click here for PD Search       Click here for Cross-React search
154       162 PVDGRITER       1.308       Click here for PD Search       Click here for Cross-React search
149       157 FERHDPVDG       1.299       Click here for PD Search       Click here for Cross-React search
6       14 DQYIIKRFD       1.294       Click here for PD Search       Click here for Cross-React search
282       290 LEKPKDMGF       1.284       Click here for PD Search       Click here for Cross-React search
191       199 KEGKGLTFQ       1.242       Click here for PD Search       Click here for Cross-React search
171       179 YSGVQSKKL       1.211       Click here for PD Search       Click here for Cross-React search
227       235 SLDKVTMQQ       1.204       Click here for PD Search       Click here for Cross-React search
89       97 SQTSMGMRH       1.19       Click here for PD Search       Click here for Cross-React search
151       159 RHDPVDGRI       1.189       Click here for PD Search       Click here for Cross-React search
179       187 LTAMQRQLK       1.183       Click here for PD Search       Click here for Cross-React search
178       186 KLTAMQRQL       1.183       Click here for PD Search       Click here for Cross-React search
10       18 IKRFDGKKI       1.13       Click here for PD Search       Click here for Cross-React search
9       17 IIKRFDGKK       1.13       Click here for PD Search       Click here for Cross-React search
209       217 KNINDVDTA       1.123       Click here for PD Search       Click here for Cross-React search
147       155 LEFERHDPV       1.123       Click here for PD Search       Click here for Cross-React search
172       180 SGVQSKKLT       1.116       Click here for PD Search       Click here for Cross-React search
153       161 DPVDGRITE       1.115       Click here for PD Search       Click here for Cross-React search
192       200 EGKGLTFQE       1.076       Click here for PD Search       Click here for Cross-React search
102       110 TTGNTLKSG       1.074       Click here for PD Search       Click here for Cross-React search
71       79 GDGEVDMEE       1.069       Click here for PD Search       Click here for Cross-React search
133       141 FLEFQRKLQ       1.065       Click here for PD Search       Click here for Cross-React search
285       293 PKDMGFTRL       1.048       Click here for PD Search       Click here for Cross-React search
272       280 SIMKQRLMR       1.034       Click here for PD Search       Click here for Cross-React search
84       92 QSIIRSQTS       1.029       Click here for PD Search       Click here for Cross-React search
57       65 QRNFEIAFK       1.029       Click here for PD Search       Click here for Cross-React search
158       166 RITERQFGG       1.013       Click here for PD Search       Click here for Cross-React search
157       165 GRITERQFG       1.013       Click here for PD Search       Click here for Cross-React search
70       78 NGDGEVDME       0.993       Click here for PD Search       Click here for Cross-React search
132       140 NFLEFQRKL       0.989       Click here for PD Search       Click here for Cross-React search
234       242 QQVARTVAK       0.978       Click here for PD Search       Click here for Cross-React search
189       197 HFKEGKGLT       0.976       Click here for PD Search       Click here for Cross-React search
73       81 GEVDMEEFE       0.97       Click here for PD Search       Click here for Cross-React search
78       86 EEFEQVQSI       0.965       Click here for PD Search       Click here for Cross-React search
230       238 KVTMQQVAR       0.958       Click here for PD Search       Click here for Cross-React search
125       133 KGKLTIKNF       0.944       Click here for PD Search       Click here for Cross-React search
264       272 ELSNKEFVS       0.942       Click here for PD Search       Click here for Cross-React search
72       80 DGEVDMEEF       0.936       Click here for PD Search       Click here for Cross-React search
123       131 DLKGKLTIK       0.933       Click here for PD Search       Click here for Cross-React search
208       216 LKNINDVDT       0.916       Click here for PD Search       Click here for Cross-React search
274       282 MKQRLMRGL       0.899       Click here for PD Search       Click here for Cross-React search
124       132 LKGKLTIKN       0.899       Click here for PD Search       Click here for Cross-React search
52       60 VLSTPQRNF       0.887       Click here for PD Search       Click here for Cross-React search
8       16 YIIKRFDGK       0.886       Click here for PD Search       Click here for Cross-React search
143       151 DVLKLEFER       0.88       Click here for PD Search       Click here for Cross-React search
152       160 HDPVDGRIT       0.876       Click here for PD Search       Click here for Cross-React search
291       299 TRLMQAMWK       0.862       Click here for PD Search       Click here for Cross-React search
299       307 KCAQETAWD       0.853       Click here for PD Search       Click here for Cross-React search
174       182 VQSKKLTAM       0.841       Click here for PD Search       Click here for Cross-React search
173       181 GVQSKKLTA       0.841       Click here for PD Search       Click here for Cross-React search
130       138 IKNFLEFQR       0.84       Click here for PD Search       Click here for Cross-React search
23       31 EKFADEGSI       0.836       Click here for PD Search       Click here for Cross-React search
229       237 DKVTMQQVA       0.817       Click here for PD Search       Click here for Cross-React search
194       202 KGLTFQEVE       0.807       Click here for PD Search       Click here for Cross-React search
68       76 DLNGDGEVD       0.798       Click here for PD Search       Click here for Cross-React search
56       64 PQRNFEIAF       0.796       Click here for PD Search       Click here for Cross-React search
1       9 EFRGLDQYI       0.781       Click here for PD Search       Click here for Cross-React search
7       15 QYIIKRFDG       0.767       Click here for PD Search       Click here for Cross-React search
273       281 IMKQRLMRG       0.764       Click here for PD Search       Click here for Cross-React search
268       276 KEFVSIMKQ       0.735       Click here for PD Search       Click here for Cross-React search
4       12 GLDQYIIKR       0.73       Click here for PD Search       Click here for Cross-React search
3       11 RGLDQYIIK       0.73       Click here for PD Search       Click here for Cross-React search
75       83 VDMEEFEQV       0.728       Click here for PD Search       Click here for Cross-React search
269       277 EFVSIMKQR       0.72       Click here for PD Search       Click here for Cross-React search
144       152 VLKLEFERH       0.717       Click here for PD Search       Click here for Cross-React search
202       210 ENFFTFLKN       0.71       Click here for PD Search       Click here for Cross-React search
305       313 AWDFALPKQ       0.703       Click here for PD Search       Click here for Cross-React search
226       234 ASLDKVTMQ       0.702       Click here for PD Search       Click here for Cross-React search
301       309 AQETAWDFA       0.696       Click here for PD Search       Click here for Cross-React search
263       271 GELSNKEFV       0.696       Click here for PD Search       Click here for Cross-React search
232       240 TMQQVARTV       0.691       Click here for PD Search       Click here for Cross-React search
231       239 VTMQQVART       0.691       Click here for PD Search       Click here for Cross-React search
82       90 QVQSIIRSQ       0.684       Click here for PD Search       Click here for Cross-React search
81       89 EQVQSIIRS       0.684       Click here for PD Search       Click here for Cross-React search
267       275 NKEFVSIMK       0.683       Click here for PD Search       Click here for Cross-React search
127       135 KLTIKNFLE       0.681       Click here for PD Search       Click here for Cross-React search
139       147 KLQHDVLKL       0.672       Click here for PD Search       Click here for Cross-React search
286       294 KDMGFTRLM       0.67       Click here for PD Search       Click here for Cross-React search
228       236 LDKVTMQQV       0.667       Click here for PD Search       Click here for Cross-React search
121       129 GADLKGKLT       0.666       Click here for PD Search       Click here for Cross-React search
195       203 GLTFQEVEN       0.649       Click here for PD Search       Click here for Cross-React search
5       13 LDQYIIKRF       0.639       Click here for PD Search       Click here for Cross-React search
65       73 KMFDLNGDG       0.637       Click here for PD Search       Click here for Cross-React search
190       198 FKEGKGLTF       0.621       Click here for PD Search       Click here for Cross-React search
129       137 TIKNFLEFQ       0.619       Click here for PD Search       Click here for Cross-React search
238       246 RTVAKVELS       0.618       Click here for PD Search       Click here for Cross-React search
103       111 TGNTLKSGL       0.614       Click here for PD Search       Click here for Cross-React search
87       95 IRSQTSMGM       0.613       Click here for PD Search       Click here for Cross-React search
169       177 LAYSGVQSK       0.612       Click here for PD Search       Click here for Cross-React search
142       150 HDVLKLEFE       0.611       Click here for PD Search       Click here for Cross-React search
141       149 QHDVLKLEF       0.611       Click here for PD Search       Click here for Cross-React search
295       303 QAMWKCAQE       0.607       Click here for PD Search       Click here for Cross-React search
160       168 TERQFGGML       0.602       Click here for PD Search       Click here for Cross-React search
199       207 QEVENFFTF       0.596       Click here for PD Search       Click here for Cross-React search
198       206 FQEVENFFT       0.596       Click here for PD Search       Click here for Cross-React search
197       205 TFQEVENFF       0.596       Click here for PD Search       Click here for Cross-React search
85       93 SIIRSQTSM       0.588       Click here for PD Search       Click here for Cross-React search
58       66 RNFEIAFKM       0.588       Click here for PD Search       Click here for Cross-React search
304       312 TAWDFALPK       0.586       Click here for PD Search       Click here for Cross-React search
140       148 LQHDVLKLE       0.582       Click here for PD Search       Click here for Cross-React search
287       295 DMGFTRLMQ       0.581       Click here for PD Search       Click here for Cross-React search
83       91 VQSIIRSQT       0.57       Click here for PD Search       Click here for Cross-React search
302       310 QETAWDFAL       0.568       Click here for PD Search       Click here for Cross-React search
196       204 LTFQEVENF       0.568       Click here for PD Search       Click here for Cross-React search
49       57 LTTVLSTPQ       0.559       Click here for PD Search       Click here for Cross-React search
64       72 FKMFDLNGD       0.557       Click here for PD Search       Click here for Cross-React search
205       213 FTFLKNIND       0.554       Click here for PD Search       Click here for Cross-React search
66       74 MFDLNGDGE       0.552       Click here for PD Search       Click here for Cross-React search
207       215 FLKNINDVD       0.55       Click here for PD Search       Click here for Cross-React search
26       34 ADEGSIFYT       0.546       Click here for PD Search       Click here for Cross-React search
298       306 WKCAQETAW       0.537       Click here for PD Search       Click here for Cross-React search
239       247 TVAKVELSD       0.527       Click here for PD Search       Click here for Cross-React search
222       230 HMAGASLDK       0.515       Click here for PD Search       Click here for Cross-React search
159       167 ITERQFGGM       0.512       Click here for PD Search       Click here for Cross-React search
303       311 ETAWDFALP       0.508       Click here for PD Search       Click here for Cross-React search
297       305 MWKCAQETA       0.506       Click here for PD Search       Click here for Cross-React search
296       304 AMWKCAQET       0.506       Click here for PD Search       Click here for Cross-React search
215       223 DTALSFYHM       0.504       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database