List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MARVSELAFLLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVN
LAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVSGAVPATLAEYTQSDQDYYDV
SLVDGFNIPLAINPTNAQCTAPACKADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAY
VDNCPATNYSKIFKNQCPQAYSYAKDDTATFACASGTDYSIVFCP


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
109       117 EYTQSDQDY       10.58       Click here for PD Search       Click here for Cross-React search
111       119 TQSDQDYYD       10.202       Click here for PD Search       Click here for Cross-React search
110       118 YTQSDQDYY       9.572       Click here for PD Search       Click here for Cross-React search
108       116 AEYTQSDQD       6.821       Click here for PD Search       Click here for Cross-React search
112       120 QSDQDYYDV       5.247       Click here for PD Search       Click here for Cross-React search
199       207 QAYSYAKDD       4.989       Click here for PD Search       Click here for Cross-React search
198       206 PQAYSYAKD       4.619       Click here for PD Search       Click here for Cross-React search
201       209 YSYAKDDTA       4.157       Click here for PD Search       Click here for Cross-React search
200       208 AYSYAKDDT       4.157       Click here for PD Search       Click here for Cross-React search
113       121 SDQDYYDVS       4.06       Click here for PD Search       Click here for Cross-React search
202       210 SYAKDDTAT       3.829       Click here for PD Search       Click here for Cross-React search
49       57 KRLDQGQTW       3.737       Click here for PD Search       Click here for Cross-React search
48       56 GKRLDQGQT       3.517       Click here for PD Search       Click here for Cross-React search
188       196 NYSKIFKNQ       3.511       Click here for PD Search       Click here for Cross-React search
107       115 LAEYTQSDQ       3.368       Click here for PD Search       Click here for Cross-React search
187       195 TNYSKIFKN       2.926       Click here for PD Search       Click here for Cross-React search
106       114 TLAEYTQSD       2.807       Click here for PD Search       Click here for Cross-React search
50       58 RLDQGQTWT       2.697       Click here for PD Search       Click here for Cross-React search
194       202 KNQCPQAYS       2.609       Click here for PD Search       Click here for Cross-React search
114       122 DQDYYDVSL       2.498       Click here for PD Search       Click here for Cross-React search
203       211 YAKDDTATF       2.474       Click here for PD Search       Click here for Cross-React search
47       55 GGKRLDQGQ       2.412       Click here for PD Search       Click here for Cross-React search
45       53 PGGGKRLDQ       2.153       Click here for PD Search       Click here for Cross-React search
195       203 NQCPQAYSY       2.044       Click here for PD Search       Click here for Cross-React search
183       191 NCPATNYSK       2.019       Click here for PD Search       Click here for Cross-React search
52       60 DQGQTWTVN       1.993       Click here for PD Search       Click here for Cross-React search
104       112 PATLAEYTQ       1.959       Click here for PD Search       Click here for Cross-React search
186       194 ATNYSKIFK       1.838       Click here for PD Search       Click here for Cross-React search
170       178 KTDQYCCRN       1.821       Click here for PD Search       Click here for Cross-React search
105       113 ATLAEYTQS       1.698       Click here for PD Search       Click here for Cross-React search
193       201 FKNQCPQAY       1.686       Click here for PD Search       Click here for Cross-React search
182       190 DNCPATNYS       1.686       Click here for PD Search       Click here for Cross-React search
204       212 AKDDTATFA       1.595       Click here for PD Search       Click here for Cross-React search
191       199 KIFKNQCPQ       1.493       Click here for PD Search       Click here for Cross-React search
197       205 CPQAYSYAK       1.483       Click here for PD Search       Click here for Cross-React search
185       193 PATNYSKIF       1.421       Click here for PD Search       Click here for Cross-React search
46       54 GGGKRLDQG       1.378       Click here for PD Search       Click here for Cross-React search
196       204 QCPQAYSYA       1.284       Click here for PD Search       Click here for Cross-React search
177       185 RNAYVDNCP       1.267       Click here for PD Search       Click here for Cross-React search
133       141 NPTNAQCTA       1.214       Click here for PD Search       Click here for Cross-React search
30       38 DIKNQCGYT       1.203       Click here for PD Search       Click here for Cross-React search
189       197 YSKIFKNQC       1.17       Click here for PD Search       Click here for Cross-React search
134       142 PTNAQCTAP       1.167       Click here for PD Search       Click here for Cross-React search
190       198 SKIFKNQCP       1.155       Click here for PD Search       Click here for Cross-React search
77       85 TFDASGKGS       1.141       Click here for PD Search       Click here for Cross-React search
167       175 NVFKTDQYC       1.115       Click here for PD Search       Click here for Cross-React search
166       174 CNVFKTDQY       1.115       Click here for PD Search       Click here for Cross-React search
115       123 QDYYDVSLV       1.11       Click here for PD Search       Click here for Cross-React search
153       161 PSELKVDGG       1.105       Click here for PD Search       Click here for Cross-React search
116       124 DYYDVSLVD       1.071       Click here for PD Search       Click here for Cross-React search
66       74 ASARFWGRT       1.049       Click here for PD Search       Click here for Cross-React search
65       73 TASARFWGR       1.049       Click here for PD Search       Click here for Cross-React search
67       75 SARFWGRTG       1.028       Click here for PD Search       Click here for Cross-React search
44       52 LPGGGKRLD       1.025       Click here for PD Search       Click here for Cross-React search
51       59 LDQGQTWTV       1.022       Click here for PD Search       Click here for Cross-React search
172       180 DQYCCRNAY       0.999       Click here for PD Search       Click here for Cross-React search
53       61 QGQTWTVNL       0.984       Click here for PD Search       Click here for Cross-React search
169       177 FKTDQYCCR       0.98       Click here for PD Search       Click here for Cross-React search
26       34 VVKFDIKNQ       0.957       Click here for PD Search       Click here for Cross-React search
181       189 VDNCPATNY       0.934       Click here for PD Search       Click here for Cross-React search
180       188 YVDNCPATN       0.934       Click here for PD Search       Click here for Cross-React search
28       36 KFDIKNQCG       0.921       Click here for PD Search       Click here for Cross-React search
171       179 TDQYCCRNA       0.92       Click here for PD Search       Click here for Cross-React search
130       138 LAINPTNAQ       0.907       Click here for PD Search       Click here for Cross-React search
82       90 GKGSCQTGD       0.894       Click here for PD Search       Click here for Cross-React search
184       192 CPATNYSKI       0.88       Click here for PD Search       Click here for Cross-React search
79       87 DASGKGSCQ       0.847       Click here for PD Search       Click here for Cross-React search
205       213 KDDTATFAC       0.846       Click here for PD Search       Click here for Cross-React search
132       140 INPTNAQCT       0.842       Click here for PD Search       Click here for Cross-React search
103       111 VPATLAEYT       0.84       Click here for PD Search       Click here for Cross-React search
129       137 PLAINPTNA       0.81       Click here for PD Search       Click here for Cross-React search
32       40 KNQCGYTVW       0.802       Click here for PD Search       Click here for Cross-React search
135       143 TNAQCTAPA       0.762       Click here for PD Search       Click here for Cross-React search
192       200 IFKNQCPQA       0.754       Click here for PD Search       Click here for Cross-React search
42       50 AGLPGGGKR       0.744       Click here for PD Search       Click here for Cross-React search
22       30 QEAGVVKFD       0.735       Click here for PD Search       Click here for Cross-React search
80       88 ASGKGSCQT       0.732       Click here for PD Search       Click here for Cross-React search
29       37 FDIKNQCGY       0.722       Click here for PD Search       Click here for Cross-React search
165       173 ACNVFKTDQ       0.719       Click here for PD Search       Click here for Cross-React search
81       89 SGKGSCQTG       0.717       Click here for PD Search       Click here for Cross-React search
27       35 VKFDIKNQC       0.691       Click here for PD Search       Click here for Cross-React search
20       28 HMQEAGVVK       0.684       Click here for PD Search       Click here for Cross-React search
178       186 NAYVDNCPA       0.653       Click here for PD Search       Click here for Cross-React search
73       81 RTGCTFDAS       0.652       Click here for PD Search       Click here for Cross-React search
117       125 YYDVSLVDG       0.635       Click here for PD Search       Click here for Cross-React search
43       51 GLPGGGKRL       0.608       Click here for PD Search       Click here for Cross-React search
152       160 CPSELKVDG       0.599       Click here for PD Search       Click here for Cross-React search
131       139 AINPTNAQC       0.59       Click here for PD Search       Click here for Cross-React search
149       157 NAVCPSELK       0.588       Click here for PD Search       Click here for Cross-React search
102       110 AVPATLAEY       0.588       Click here for PD Search       Click here for Cross-React search
69       77 RFWGRTGCT       0.587       Click here for PD Search       Click here for Cross-React search
55       63 QTWTVNLAA       0.586       Click here for PD Search       Click here for Cross-React search
179       187 AYVDNCPAT       0.586       Click here for PD Search       Click here for Cross-React search
54       62 GQTWTVNLA       0.574       Click here for PD Search       Click here for Cross-React search
212       220 ACASGTDYS       0.565       Click here for PD Search       Click here for Cross-React search
128       136 IPLAINPTN       0.562       Click here for PD Search       Click here for Cross-React search
127       135 NIPLAINPT       0.562       Click here for PD Search       Click here for Cross-React search
164       172 SACNVFKTD       0.556       Click here for PD Search       Click here for Cross-React search
25       33 GVVKFDIKN       0.547       Click here for PD Search       Click here for Cross-React search
214       222 ASGTDYSIV       0.543       Click here for PD Search       Click here for Cross-React search
63       71 AGTASARFW       0.541       Click here for PD Search       Click here for Cross-React search
31       39 IKNQCGYTV       0.535       Click here for PD Search       Click here for Cross-React search
163       171 NSACNVFKT       0.535       Click here for PD Search       Click here for Cross-React search
64       72 GTASARFWG       0.53       Click here for PD Search       Click here for Cross-React search
62       70 AAGTASARF       0.52       Click here for PD Search       Click here for Cross-React search
18       26 SLHMQEAGV       0.509       Click here for PD Search       Click here for Cross-React search
71       79 WGRTGCTFD       0.501       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database