List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MASSIKTVILFLLPLLLAYSVLAAPDITDGGDKPGPEIDDGGGDKPVPGNNDGASDYAKP
AFEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPINPDAN
NQPDCYAHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPKGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPKRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNQPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELTPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALETERTQIDPANTDAVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVQNGVITAVAPPSGQIAPPGYYIMFVSHLGIPGAGIWVHID


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
132       140 YDWKTSKYR       7.534       Click here for PD Search       Click here for Cross-React search
133       141 DWKTSKYRP       7.435       Click here for PD Search       Click here for Cross-React search
116       124 NPDANNQPD       5.597       Click here for PD Search       Click here for Cross-React search
226       234 PQMEFKPKR       5.553       Click here for PD Search       Click here for Cross-React search
371       379 PEQNMPSPR       5.343       Click here for PD Search       Click here for Cross-React search
135       143 KTSKYRPLT       5.04       Click here for PD Search       Click here for Cross-React search
372       380 EQNMPSPRT       4.987       Click here for PD Search       Click here for Cross-React search
195       203 DTRWYSSNQ       4.487       Click here for PD Search       Click here for Cross-React search
488       496 ETERTQIDP       4.424       Click here for PD Search       Click here for Cross-React search
225       233 PPQMEFKPK       4.384       Click here for PD Search       Click here for Cross-React search
419       427 TPYKPMGQR       4.144       Click here for PD Search       Click here for Cross-React search
131       139 AYDWKTSKY       3.886       Click here for PD Search       Click here for Cross-React search
134       142 WKTSKYRPL       3.672       Click here for PD Search       Click here for Cross-React search
422       430 KPMGQRFKE       3.554       Click here for PD Search       Click here for Cross-React search
181       189 DPKGDFTTK       3.551       Click here for PD Search       Click here for Cross-React search
341       349 DARHVTEKQ       3.332       Click here for PD Search       Click here for Cross-React search
418       426 YTPYKPMGQ       3.315       Click here for PD Search       Click here for Cross-React search
179       187 NDDPKGDFT       3.304       Click here for PD Search       Click here for Cross-React search
299       307 SRNYPPSGS       3.242       Click here for PD Search       Click here for Cross-React search
421       429 YKPMGQRFK       3.215       Click here for PD Search       Click here for Cross-React search
485       493 PALETERTQ       3.149       Click here for PD Search       Click here for Cross-React search
426       434 QRFKELTPT       3.117       Click here for PD Search       Click here for Cross-React search
227       235 QMEFKPKRF       3.11       Click here for PD Search       Click here for Cross-React search
32       40 DKPGPEIDD       3.086       Click here for PD Search       Click here for Cross-React search
484       492 DPALETERT       3.036       Click here for PD Search       Click here for Cross-React search
228       236 MEFKPKRFD       2.999       Click here for PD Search       Click here for Cross-React search
180       188 DDPKGDFTT       2.965       Click here for PD Search       Click here for Cross-React search
44       52 DKPVPGNND       2.922       Click here for PD Search       Click here for Cross-React search
490       498 ERTQIDPAN       2.876       Click here for PD Search       Click here for Cross-React search
373       381 QNMPSPRTM       2.85       Click here for PD Search       Click here for Cross-React search
214       222 GGRDSYSYE       2.822       Click here for PD Search       Click here for Cross-React search
296       304 PGGSRNYPP       2.762       Click here for PD Search       Click here for Cross-React search
399       407 KKGTSGWED       2.657       Click here for PD Search       Click here for Cross-React search
194       202 ADTRWYSSN       2.617       Click here for PD Search       Click here for Cross-React search
466       474 DTEFPTELR       2.603       Click here for PD Search       Click here for Cross-React search
427       435 RFKELTPTT       2.597       Click here for PD Search       Click here for Cross-React search
29       37 DGGDKPGPE       2.582       Click here for PD Search       Click here for Cross-React search
489       497 TERTQIDPA       2.581       Click here for PD Search       Click here for Cross-React search
239       247 FMQQTTEPP       2.557       Click here for PD Search       Click here for Cross-React search
238       246 PFMQQTTEP       2.557       Click here for PD Search       Click here for Cross-React search
474       482 RVEKFSPPY       2.525       Click here for PD Search       Click here for Cross-React search
229       237 EFKPKRFDL       2.499       Click here for PD Search       Click here for Cross-React search
137       145 SKYRPLTLQ       2.494       Click here for PD Search       Click here for Cross-React search
420       428 PYKPMGQRF       2.486       Click here for PD Search       Click here for Cross-React search
537       545 THGFSQNQR       2.458       Click here for PD Search       Click here for Cross-React search
300       308 RNYPPSGSA       2.444       Click here for PD Search       Click here for Cross-React search
241       249 QQTTEPPLG       2.435       Click here for PD Search       Click here for Cross-React search
240       248 MQQTTEPPL       2.435       Click here for PD Search       Click here for Cross-React search
491       499 RTQIDPANT       2.397       Click here for PD Search       Click here for Cross-React search
298       306 GSRNYPPSG       2.394       Click here for PD Search       Click here for Cross-React search
297       305 GGSRNYPPS       2.394       Click here for PD Search       Click here for Cross-React search
476       484 EKFSPPYLD       2.392       Click here for PD Search       Click here for Cross-React search
487       495 LETERTQID       2.36       Click here for PD Search       Click here for Cross-React search
115       123 INPDANNQP       2.349       Click here for PD Search       Click here for Cross-React search
114       122 PINPDANNQ       2.349       Click here for PD Search       Click here for Cross-React search
252       260 RPVENNLYP       2.32       Click here for PD Search       Click here for Cross-React search
178       186 ANDDPKGDF       2.313       Click here for PD Search       Click here for Cross-React search
57       65 YAKPAFEPE       2.291       Click here for PD Search       Click here for Cross-React search
231       239 KPKRFDLPF       2.231       Click here for PD Search       Click here for Cross-React search
230       238 FKPKRFDLP       2.231       Click here for PD Search       Click here for Cross-React search
56       64 DYAKPAFEP       2.209       Click here for PD Search       Click here for Cross-React search
51       59 NDGASDYAK       2.194       Click here for PD Search       Click here for Cross-React search
242       250 QTTEPPLGP       2.174       Click here for PD Search       Click here for Cross-React search
28       36 TDGGDKPGP       2.152       Click here for PD Search       Click here for Cross-React search
330       338 GGNQPNAYE       2.145       Click here for PD Search       Click here for Cross-React search
425       433 GQRFKELTP       2.137       Click here for PD Search       Click here for Cross-React search
477       485 KFSPPYLDP       2.136       Click here for PD Search       Click here for Cross-React search
52       60 DGASDYAKP       2.11       Click here for PD Search       Click here for Cross-React search
136       144 TSKYRPLTL       2.078       Click here for PD Search       Click here for Cross-React search
492       500 TQIDPANTD       2.043       Click here for PD Search       Click here for Cross-React search
464       472 TFDTEFPTE       2.014       Click here for PD Search       Click here for Cross-React search
215       223 GRDSYSYEI       1.999       Click here for PD Search       Click here for Cross-React search
196       204 TRWYSSNQV       1.994       Click here for PD Search       Click here for Cross-React search
504       512 KYGKPFKIT       1.938       Click here for PD Search       Click here for Cross-React search
460       468 HQFYTFDTE       1.924       Click here for PD Search       Click here for Cross-React search
55       63 SDYAKPAFE       1.914       Click here for PD Search       Click here for Cross-React search
370       378 IPEQNMPSP       1.912       Click here for PD Search       Click here for Cross-React search
283       291 PATGKTVKE       1.909       Click here for PD Search       Click here for Cross-React search
282       290 EPATGKTVK       1.909       Click here for PD Search       Click here for Cross-React search
118       126 DANNQPDCY       1.89       Click here for PD Search       Click here for Cross-React search
177       185 IANDDPKGD       1.872       Click here for PD Search       Click here for Cross-React search
117       125 PDANNQPDC       1.866       Click here for PD Search       Click here for Cross-React search
415       423 PVLYTPYKP       1.85       Click here for PD Search       Click here for Cross-React search
138       146 KYRPLTLQG       1.842       Click here for PD Search       Click here for Cross-React search
33       41 KPGPEIDDG       1.829       Click here for PD Search       Click here for Cross-React search
31       39 GDKPGPEID       1.829       Click here for PD Search       Click here for Cross-React search
463       471 YTFDTEFPT       1.822       Click here for PD Search       Click here for Cross-React search
536       544 TTHGFSQNQ       1.811       Click here for PD Search       Click here for Cross-React search
245       253 EPPLGPGRP       1.807       Click here for PD Search       Click here for Cross-React search
331       339 GNQPNAYEL       1.787       Click here for PD Search       Click here for Cross-React search
50       58 NNDGASDYA       1.764       Click here for PD Search       Click here for Cross-React search
249       257 GPGRPVENN       1.759       Click here for PD Search       Click here for Cross-React search
104       112 GYKLPEGTP       1.745       Click here for PD Search       Click here for Cross-React search
130       138 IAYDWKTSK       1.739       Click here for PD Search       Click here for Cross-React search
483       491 LDPALETER       1.735       Click here for PD Search       Click here for Cross-React search
45       53 KPVPGNNDG       1.732       Click here for PD Search       Click here for Cross-React search
43       51 GDKPVPGNN       1.732       Click here for PD Search       Click here for Cross-React search
49       57 GNNDGASDY       1.728       Click here for PD Search       Click here for Cross-React search
342       350 ARHVTEKQF       1.728       Click here for PD Search       Click here for Cross-React search
414       422 TPVLYTPYK       1.726       Click here for PD Search       Click here for Cross-React search
48       56 PGNNDGASD       1.706       Click here for PD Search       Click here for Cross-React search
402       410 TSGWEDATE       1.695       Click here for PD Search       Click here for Cross-React search
375       383 MPSPRTMGD       1.691       Click here for PD Search       Click here for Cross-React search
244       252 TEPPLGPGR       1.686       Click here for PD Search       Click here for Cross-React search
538       546 HGFSQNQRM       1.685       Click here for PD Search       Click here for Cross-React search
83       91 QLQLMPNDQ       1.675       Click here for PD Search       Click here for Cross-React search
175       183 RVIANDDPK       1.647       Click here for PD Search       Click here for Cross-React search
26       34 DITDGGDKP       1.646       Click here for PD Search       Click here for Cross-React search
25       33 PDITDGGDK       1.646       Click here for PD Search       Click here for Cross-React search
285       293 TGKTVKEFP       1.637       Click here for PD Search       Click here for Cross-React search
406       414 EDATEANLT       1.629       Click here for PD Search       Click here for Cross-React search
374       382 NMPSPRTMG       1.628       Click here for PD Search       Click here for Cross-React search
224       232 VPPQMEFKP       1.627       Click here for PD Search       Click here for Cross-React search
398       406 AKKGTSGWE       1.608       Click here for PD Search       Click here for Cross-React search
280       288 TFEPATGKT       1.608       Click here for PD Search       Click here for Cross-React search
470       478 PTELRVEKF       1.603       Click here for PD Search       Click here for Cross-React search
469       477 FPTELRVEK       1.603       Click here for PD Search       Click here for Cross-React search
417       425 LYTPYKPMG       1.578       Click here for PD Search       Click here for Cross-React search
120       128 NNQPDCYAH       1.54       Click here for PD Search       Click here for Cross-React search
139       147 YRPLTLQGD       1.538       Click here for PD Search       Click here for Cross-React search
103       111 SGYKLPEGT       1.512       Click here for PD Search       Click here for Cross-React search
216       224 RDSYSYEIV       1.499       Click here for PD Search       Click here for Cross-React search
182       190 PKGDFTTKI       1.49       Click here for PD Search       Click here for Cross-React search
472       480 ELRVEKFSP       1.488       Click here for PD Search       Click here for Cross-React search
251       259 GRPVENNLY       1.485       Click here for PD Search       Click here for Cross-React search
295       303 LPGGSRNYP       1.473       Click here for PD Search       Click here for Cross-React search
250       258 PGRPVENNL       1.466       Click here for PD Search       Click here for Cross-React search
423       431 PMGQRFKEL       1.465       Click here for PD Search       Click here for Cross-React search
407       415 DATEANLTP       1.454       Click here for PD Search       Click here for Cross-React search
493       501 QIDPANTDA       1.43       Click here for PD Search       Click here for Cross-React search
199       207 YSSNQVLPD       1.429       Click here for PD Search       Click here for Cross-React search
340       348 VDARHVTEK       1.428       Click here for PD Search       Click here for Cross-React search
486       494 ALETERTQI       1.427       Click here for PD Search       Click here for Cross-React search
404       412 GWEDATEAN       1.424       Click here for PD Search       Click here for Cross-React search
219       227 YSYEIVPPQ       1.416       Click here for PD Search       Click here for Cross-React search
343       351 RHVTEKQFL       1.411       Click here for PD Search       Click here for Cross-React search
376       384 PSPRTMGDL       1.409       Click here for PD Search       Click here for Cross-React search
396       404 NGAKKGTSG       1.405       Click here for PD Search       Click here for Cross-React search
333       341 QPNAYELVD       1.392       Click here for PD Search       Click here for Cross-React search
471       479 TELRVEKFS       1.389       Click here for PD Search       Click here for Cross-React search
482       490 YLDPALETE       1.388       Click here for PD Search       Click here for Cross-React search
468       476 EFPTELRVE       1.388       Click here for PD Search       Click here for Cross-React search
275       283 NNRAITFEP       1.385       Click here for PD Search       Click here for Cross-React search
424       432 MGQRFKELT       1.368       Click here for PD Search       Click here for Cross-React search
237       245 LPFMQQTTE       1.364       Click here for PD Search       Click here for Cross-React search
213       221 LGGRDSYSY       1.344       Click here for PD Search       Click here for Cross-React search
400       408 KGTSGWEDA       1.342       Click here for PD Search       Click here for Cross-React search
193       201 LADTRWYSS       1.342       Click here for PD Search       Click here for Cross-React search
332       340 NQPNAYELV       1.34       Click here for PD Search       Click here for Cross-React search
473       481 LRVEKFSPP       1.329       Click here for PD Search       Click here for Cross-React search
480       488 PPYLDPALE       1.328       Click here for PD Search       Click here for Cross-React search
236       244 DLPFMQQTT       1.315       Click here for PD Search       Click here for Cross-React search
369       377 WIPEQNMPS       1.3       Click here for PD Search       Click here for Cross-React search
512       520 TAALMEKQP       1.286       Click here for PD Search       Click here for Cross-React search
53       61 GASDYAKPA       1.276       Click here for PD Search       Click here for Cross-React search
58       66 AKPAFEPEF       1.266       Click here for PD Search       Click here for Cross-React search
37       45 EIDDGGGDK       1.264       Click here for PD Search       Click here for Cross-React search
301       309 NYPPSGSAA       1.261       Click here for PD Search       Click here for Cross-React search
243       251 TTEPPLGPG       1.242       Click here for PD Search       Click here for Cross-React search
59       67 KPAFEPEFM       1.24       Click here for PD Search       Click here for Cross-React search
481       489 PYLDPALET       1.239       Click here for PD Search       Click here for Cross-React search
233       241 KRFDLPFMQ       1.237       Click here for PD Search       Click here for Cross-React search
458       466 NMHQFYTFD       1.225       Click here for PD Search       Click here for Cross-React search
461       469 QFYTFDTEF       1.224       Click here for PD Search       Click here for Cross-React search
39       47 DDGGGDKPV       1.195       Click here for PD Search       Click here for Cross-React search
405       413 WEDATEANL       1.187       Click here for PD Search       Click here for Cross-React search
403       411 SGWEDATEA       1.187       Click here for PD Search       Click here for Cross-React search
416       424 VLYTPYKPM       1.184       Click here for PD Search       Click here for Cross-React search
217       225 DSYSYEIVP       1.183       Click here for PD Search       Click here for Cross-React search
502       510 VLKYGKPFK       1.173       Click here for PD Search       Click here for Cross-React search
395       403 LNGAKKGTS       1.171       Click here for PD Search       Click here for Cross-React search
541       549 SQNQRMIVP       1.163       Click here for PD Search       Click here for Cross-React search
467       475 TEFPTELRV       1.157       Click here for PD Search       Click here for Cross-React search
221       229 YEIVPPQME       1.156       Click here for PD Search       Click here for Cross-React search
432       440 TPTTIARMY       1.153       Click here for PD Search       Click here for Cross-React search
465       473 FDTEFPTEL       1.151       Click here for PD Search       Click here for Cross-React search
358       366 NRIQPMAAD       1.15       Click here for PD Search       Click here for Cross-React search
119       127 ANNQPDCYA       1.144       Click here for PD Search       Click here for Cross-React search
500       508 DAVLKYGKP       1.142       Click here for PD Search       Click here for Cross-React search
197       205 RWYSSNQVL       1.14       Click here for PD Search       Click here for Cross-React search
38       46 IDDGGGDKP       1.129       Click here for PD Search       Click here for Cross-React search
456       464 GSNMHQFYT       1.123       Click here for PD Search       Click here for Cross-React search
54       62 ASDYAKPAF       1.117       Click here for PD Search       Click here for Cross-React search
344       352 HVTEKQFLP       1.114       Click here for PD Search       Click here for Cross-React search
503       511 LKYGKPFKI       1.107       Click here for PD Search       Click here for Cross-React search
40       48 DGGGDKPVP       1.107       Click here for PD Search       Click here for Cross-React search
232       240 PKRFDLPFM       1.104       Click here for PD Search       Click here for Cross-React search
347       355 EKQFLPALQ       1.102       Click here for PD Search       Click here for Cross-React search
459       467 MHQFYTFDT       1.099       Click here for PD Search       Click here for Cross-React search
218       226 SYSYEIVPP       1.096       Click here for PD Search       Click here for Cross-React search
462       470 FYTFDTEFP       1.093       Click here for PD Search       Click here for Cross-React search
433       441 PTTIARMYH       1.087       Click here for PD Search       Click here for Cross-React search
429       437 KELTPTTIA       1.084       Click here for PD Search       Click here for Cross-React search
30       38 GGDKPGPEI       1.084       Click here for PD Search       Click here for Cross-React search
366       374 DAAWIPEQN       1.081       Click here for PD Search       Click here for Cross-React search
478       486 FSPPYLDPA       1.079       Click here for PD Search       Click here for Cross-React search
564       572 PPSGQIAPP       1.073       Click here for PD Search       Click here for Cross-React search
234       242 RFDLPFMQQ       1.071       Click here for PD Search       Click here for Cross-React search
284       292 ATGKTVKEF       1.069       Click here for PD Search       Click here for Cross-React search
499       507 TDAVLKYGK       1.066       Click here for PD Search       Click here for Cross-React search
42       50 GGDKPVPGN       1.066       Click here for PD Search       Click here for Cross-React search
475       483 VEKFSPPYL       1.063       Click here for PD Search       Click here for Cross-React search
348       356 KQFLPALQD       1.063       Click here for PD Search       Click here for Cross-React search
430       438 ELTPTTIAR       1.062       Click here for PD Search       Click here for Cross-React search
102       110 ASGYKLPEG       1.058       Click here for PD Search       Click here for Cross-React search
101       109 GASGYKLPE       1.058       Click here for PD Search       Click here for Cross-React search
355       363 QDCNRIQPM       1.046       Click here for PD Search       Click here for Cross-React search
335       343 NAYELVDAR       1.029       Click here for PD Search       Click here for Cross-React search
479       487 SPPYLDPAL       1.028       Click here for PD Search       Click here for Cross-React search
253       261 PVENNLYPF       1.026       Click here for PD Search       Click here for Cross-React search
192       200 ALADTRWYS       1.012       Click here for PD Search       Click here for Cross-React search
140       148 RPLTLQGDA       0.991       Click here for PD Search       Click here for Cross-React search
457       465 SNMHQFYTF       0.983       Click here for PD Search       Click here for Cross-React search
368       376 AWIPEQNMP       0.98       Click here for PD Search       Click here for Cross-React search
505       513 YGKPFKITA       0.979       Click here for PD Search       Click here for Cross-React search
36       44 PEIDDGGGD       0.977       Click here for PD Search       Click here for Cross-React search
27       35 ITDGGDKPG       0.975       Click here for PD Search       Click here for Cross-React search
401       409 GTSGWEDAT       0.969       Click here for PD Search       Click here for Cross-React search
313       321 LKLTADNAP       0.96       Click here for PD Search       Click here for Cross-React search
312       320 PLKLTADNA       0.96       Click here for PD Search       Click here for Cross-React search
82       90 MQLQLMPND       0.957       Click here for PD Search       Click here for Cross-React search
183       191 KGDFTTKIG       0.954       Click here for PD Search       Click here for Cross-React search
121       129 NQPDCYAHG       0.948       Click here for PD Search       Click here for Cross-React search
105       113 YKLPEGTPC       0.945       Click here for PD Search       Click here for Cross-React search
434       442 TTIARMYHS       0.942       Click here for PD Search       Click here for Cross-React search
106       114 KLPEGTPCP       0.933       Click here for PD Search       Click here for Cross-React search
428       436 FKELTPTTI       0.93       Click here for PD Search       Click here for Cross-React search
517       525 EKQPLVLGE       0.926       Click here for PD Search       Click here for Cross-React search
397       405 GAKKGTSGW       0.919       Click here for PD Search       Click here for Cross-React search
346       354 TEKQFLPAL       0.919       Click here for PD Search       Click here for Cross-React search
532       540 YPPFTTHGF       0.909       Click here for PD Search       Click here for Cross-React search
535       543 FTTHGFSQN       0.905       Click here for PD Search       Click here for Cross-React search
34       42 PGPEIDDGG       0.905       Click here for PD Search       Click here for Cross-React search
274       282 ANNRAITFE       0.905       Click here for PD Search       Click here for Cross-React search
248       256 LGPGRPVEN       0.902       Click here for PD Search       Click here for Cross-React search
202       210 NQVLPDGSS       0.902       Click here for PD Search       Click here for Cross-React search
201       209 SNQVLPDGS       0.902       Click here for PD Search       Click here for Cross-React search
200       208 SSNQVLPDG       0.902       Click here for PD Search       Click here for Cross-React search
164       172 TGGTFSGDK       0.902       Click here for PD Search       Click here for Cross-React search
198       206 WYSSNQVLP       0.9       Click here for PD Search       Click here for Cross-React search
220       228 SYEIVPPQM       0.894       Click here for PD Search       Click here for Cross-React search
167       175 TFSGDKAIR       0.886       Click here for PD Search       Click here for Cross-React search
542       550 QNQRMIVPA       0.876       Click here for PD Search       Click here for Cross-React search
497       505 ANTDAVLKY       0.875       Click here for PD Search       Click here for Cross-React search
46       54 PVPGNNDGA       0.875       Click here for PD Search       Click here for Cross-React search
128       136 HGIAYDWKT       0.874       Click here for PD Search       Click here for Cross-React search
354       362 LQDCNRIQP       0.872       Click here for PD Search       Click here for Cross-React search
534       542 PFTTHGFSQ       0.871       Click here for PD Search       Click here for Cross-React search
336       344 AYELVDARH       0.87       Click here for PD Search       Click here for Cross-React search
276       284 NRAITFEPA       0.87       Click here for PD Search       Click here for Cross-React search
539       547 GFSQNQRMI       0.868       Click here for PD Search       Click here for Cross-React search
247       255 PLGPGRPVE       0.867       Click here for PD Search       Click here for Cross-React search
531       539 LYPPFTTHG       0.866       Click here for PD Search       Click here for Cross-React search
394       402 MLNGAKKGT       0.865       Click here for PD Search       Click here for Cross-React search
496       504 PANTDAVLK       0.864       Click here for PD Search       Click here for Cross-React search
314       322 KLTADNAPV       0.864       Click here for PD Search       Click here for Cross-React search
129       137 GIAYDWKTS       0.86       Click here for PD Search       Click here for Cross-React search
498       506 NTDAVLKYG       0.857       Click here for PD Search       Click here for Cross-React search
152       160 SGNLWPNGN       0.844       Click here for PD Search       Click here for Cross-React search
286       294 GKTVKEFPV       0.842       Click here for PD Search       Click here for Cross-React search
176       184 VIANDDPKG       0.832       Click here for PD Search       Click here for Cross-React search
24       32 APDITDGGD       0.831       Click here for PD Search       Click here for Cross-React search
345       353 VTEKQFLPA       0.827       Click here for PD Search       Click here for Cross-React search
281       289 FEPATGKTV       0.827       Click here for PD Search       Click here for Cross-React search
311       319 FPLKLTADN       0.823       Click here for PD Search       Click here for Cross-React search
567       575 GQIAPPGYY       0.813       Click here for PD Search       Click here for Cross-React search
334       342 PNAYELVDA       0.812       Click here for PD Search       Click here for Cross-React search
235       243 FDLPFMQQT       0.789       Click here for PD Search       Click here for Cross-React search
455       463 AGSNMHQFY       0.786       Click here for PD Search       Click here for Cross-React search
279       287 ITFEPATGK       0.781       Click here for PD Search       Click here for Cross-React search
277       285 RAITFEPAT       0.781       Click here for PD Search       Click here for Cross-React search
533       541 PPFTTHGFS       0.777       Click here for PD Search       Click here for Cross-React search
246       254 PPLGPGRPV       0.774       Click here for PD Search       Click here for Cross-React search
529       537 TLLYPPFTT       0.765       Click here for PD Search       Click here for Cross-React search
98       106 TSLGASGYK       0.764       Click here for PD Search       Click here for Cross-React search
47       55 VPGNNDGAS       0.758       Click here for PD Search       Click here for Cross-React search
191       199 GALADTRWY       0.747       Click here for PD Search       Click here for Cross-React search
223       231 IVPPQMEFK       0.738       Click here for PD Search       Click here for Cross-React search
513       521 AALMEKQPL       0.735       Click here for PD Search       Click here for Cross-React search
412       420 NLTPVLYTP       0.731       Click here for PD Search       Click here for Cross-React search
113       121 CPINPDANN       0.727       Click here for PD Search       Click here for Cross-React search
359       367 RIQPMAADA       0.723       Click here for PD Search       Click here for Cross-React search
530       538 LLYPPFTTH       0.721       Click here for PD Search       Click here for Cross-React search
495       503 DPANTDAVL       0.721       Click here for PD Search       Click here for Cross-React search
413       421 LTPVLYTPY       0.712       Click here for PD Search       Click here for Cross-React search
294       302 VLPGGSRNY       0.707       Click here for PD Search       Click here for Cross-React search
151       159 SSGNLWPNG       0.704       Click here for PD Search       Click here for Cross-React search
563       571 APPSGQIAP       0.701       Click here for PD Search       Click here for Cross-React search
287       295 KTVKEFPVL       0.701       Click here for PD Search       Click here for Cross-React search
112       120 PCPINPDAN       0.699       Click here for PD Search       Click here for Cross-React search
293       301 PVLPGGSRN       0.698       Click here for PD Search       Click here for Cross-React search
566       574 SGQIAPPGY       0.696       Click here for PD Search       Click here for Cross-React search
560       568 TAVAPPSGQ       0.693       Click here for PD Search       Click here for Cross-React search
565       573 PSGQIAPPG       0.686       Click here for PD Search       Click here for Cross-React search
317       325 ADNAPVIPE       0.681       Click here for PD Search       Click here for Cross-React search
365       373 ADAAWIPEQ       0.679       Click here for PD Search       Click here for Cross-React search
84       92 LQLMPNDQI       0.678       Click here for PD Search       Click here for Cross-React search
510       518 KITAALMEK       0.673       Click here for PD Search       Click here for Cross-React search
329       337 CGGNQPNAY       0.664       Click here for PD Search       Click here for Cross-React search
88       96 PNDQIVWFD       0.656       Click here for PD Search       Click here for Cross-React search
41       49 GGGDKPVPG       0.656       Click here for PD Search       Click here for Cross-React search
540       548 FSQNQRMIV       0.651       Click here for PD Search       Click here for Cross-React search
378       386 PRTMGDLIH       0.649       Click here for PD Search       Click here for Cross-React search
408       416 ATEANLTPV       0.646       Click here for PD Search       Click here for Cross-React search
302       310 YPPSGSAAL       0.646       Click here for PD Search       Click here for Cross-React search
367       375 AAWIPEQNM       0.64       Click here for PD Search       Click here for Cross-React search
377       385 SPRTMGDLI       0.639       Click here for PD Search       Click here for Cross-React search
337       345 YELVDARHV       0.639       Click here for PD Search       Click here for Cross-React search
222       230 EIVPPQMEF       0.639       Click here for PD Search       Click here for Cross-React search
255       263 ENNLYPFLF       0.638       Click here for PD Search       Click here for Cross-React search
109       117 EGTPCPINP       0.637       Click here for PD Search       Click here for Cross-React search
108       116 PEGTPCPIN       0.637       Click here for PD Search       Click here for Cross-React search
212       220 VLGGRDSYS       0.636       Click here for PD Search       Click here for Cross-React search
189       197 KIGALADTR       0.636       Click here for PD Search       Click here for Cross-React search
165       173 GGTFSGDKA       0.632       Click here for PD Search       Click here for Cross-React search
506       514 GKPFKITAA       0.631       Click here for PD Search       Click here for Cross-React search
111       119 TPCPINPDA       0.627       Click here for PD Search       Click here for Cross-React search
110       118 GTPCPINPD       0.615       Click here for PD Search       Click here for Cross-React search
60       68 PAFEPEFMG       0.614       Click here for PD Search       Click here for Cross-React search
89       97 NDQIVWFDT       0.613       Click here for PD Search       Click here for Cross-React search
494       502 IDPANTDAV       0.613       Click here for PD Search       Click here for Cross-React search
127       135 AHGIAYDWK       0.611       Click here for PD Search       Click here for Cross-React search
85       93 QLMPNDQIV       0.61       Click here for PD Search       Click here for Cross-React search
356       364 DCNRIQPMA       0.61       Click here for PD Search       Click here for Cross-React search
431       439 LTPTTIARM       0.607       Click here for PD Search       Click here for Cross-React search
351       359 LPALQDCNR       0.598       Click here for PD Search       Click here for Cross-React search
501       509 AVLKYGKPF       0.592       Click here for PD Search       Click here for Cross-React search
339       347 LVDARHVTE       0.589       Click here for PD Search       Click here for Cross-React search
338       346 ELVDARHVT       0.589       Click here for PD Search       Click here for Cross-React search
96       104 DTTSLGASG       0.588       Click here for PD Search       Click here for Cross-React search
73       81 DNPNAGVAA       0.583       Click here for PD Search       Click here for Cross-React search
511       519 ITAALMEKQ       0.583       Click here for PD Search       Click here for Cross-React search
81       89 AMQLQLMPN       0.579       Click here for PD Search       Click here for Cross-React search
35       43 GPEIDDGGG       0.579       Click here for PD Search       Click here for Cross-React search
174       182 IRVIANDDP       0.577       Click here for PD Search       Click here for Cross-React search
568       576 QIAPPGYYI       0.576       Click here for PD Search       Click here for Cross-React search
444       452 SALLPDTRV       0.575       Click here for PD Search       Click here for Cross-React search
410       418 EANLTPVLY       0.573       Click here for PD Search       Click here for Cross-React search
156       164 WPNGNLMAT       0.571       Click here for PD Search       Click here for Cross-React search
353       361 ALQDCNRIQ       0.57       Click here for PD Search       Click here for Cross-React search
316       324 TADNAPVIP       0.568       Click here for PD Search       Click here for Cross-React search
361       369 QPMAADAAW       0.559       Click here for PD Search       Click here for Cross-React search
97       105 TTSLGASGY       0.552       Click here for PD Search       Click here for Cross-React search
90       98 DQIVWFDTT       0.55       Click here for PD Search       Click here for Cross-React search
254       262 VENNLYPFL       0.547       Click here for PD Search       Click here for Cross-React search
527       535 KVTLLYPPF       0.545       Click here for PD Search       Click here for Cross-React search
288       296 TVKEFPVLP       0.542       Click here for PD Search       Click here for Cross-React search
514       522 ALMEKQPLV       0.54       Click here for PD Search       Click here for Cross-React search
157       165 PNGNLMATG       0.538       Click here for PD Search       Click here for Cross-React search
141       149 PLTLQGDAW       0.532       Click here for PD Search       Click here for Cross-React search
516       524 MEKQPLVLG       0.529       Click here for PD Search       Click here for Cross-React search
409       417 TEANLTPVL       0.528       Click here for PD Search       Click here for Cross-React search
507       515 KPFKITAAL       0.526       Click here for PD Search       Click here for Cross-React search
525       533 EVKVTLLYP       0.523       Click here for PD Search       Click here for Cross-React search
154       162 NLWPNGNLM       0.52       Click here for PD Search       Click here for Cross-React search
153       161 GNLWPNGNL       0.52       Click here for PD Search       Click here for Cross-React search
95       103 FDTTSLGAS       0.514       Click here for PD Search       Click here for Cross-React search
352       360 PALQDCNRI       0.509       Click here for PD Search       Click here for Cross-React search
100       108 LGASGYKLP       0.504       Click here for PD Search       Click here for Cross-React search
23       31 AAPDITDGG       0.503       Click here for PD Search       Click here for Cross-React search
549       557 PAITSVQNG       0.5       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database