List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MEFPETNNNPIITLSFLLCMLSLAYASETCDFPAIFNFGDSNSDTGGKAAAFYPLNPPYG
ETFFHRSTGRYSDGRLIIDFIAESFNLPYLSPYLSSLGSNFKHGADFATAGSTIKLPTTI
IPAHGGFSPFYLDVQYSQFRQFIPRSQFIRETGGIFAELVPEEYYFEKALYTFDIGQNDL
TEGFLNLTVEEVNATVPDLVNSFSANVKKIYDLGARTFWIHNTGPIGCLSFILTYFPWAE
KDSAGCAKAYNEVAQHFNHKLKEIVAQLRKDLPLATFVHVDIYSVKYSLFSEPEKHGFEF
PLITCCGYGGKYNFSVTAPCGDTVTADDGTKIVVGSCACPSVRVNWDGAHYTEAANEYFF
DQISTGAFSDPPVPLNMACHKTESLRTLASV


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
2       10 EFPETNNNP       5.661       Click here for PD Search       Click here for Cross-React search
65       73 HRSTGRYSD       5.321       Click here for PD Search       Click here for Cross-React search
161       169 PEEYYFEKA       5.24       Click here for PD Search       Click here for Cross-React search
255       263 QHFNHKLKE       3.874       Click here for PD Search       Click here for Cross-React search
67       75 STGRYSDGR       3.87       Click here for PD Search       Click here for Cross-React search
66       74 RSTGRYSDG       3.87       Click here for PD Search       Click here for Cross-React search
160       168 VPEEYYFEK       3.849       Click here for PD Search       Click here for Cross-React search
291       299 SEPEKHGFE       3.812       Click here for PD Search       Click here for Cross-React search
1       9 MEFPETNNN       3.623       Click here for PD Search       Click here for Cross-React search
350       358 HYTEAANEY       3.605       Click here for PD Search       Click here for Cross-React search
133       141 DVQYSQFRQ       3.482       Click here for PD Search       Click here for Cross-React search
40       48 DSNSDTGGK       3.458       Click here for PD Search       Click here for Cross-React search
144       152 PRSQFIRET       3.172       Click here for PD Search       Click here for Cross-React search
53       61 YPLNPPYGE       3.134       Click here for PD Search       Click here for Cross-React search
54       62 PLNPPYGET       2.886       Click here for PD Search       Click here for Cross-React search
287       295 YSLFSEPEK       2.831       Click here for PD Search       Click here for Cross-React search
286       294 KYSLFSEPE       2.831       Click here for PD Search       Click here for Cross-React search
234       242 TYFPWAEKD       2.825       Click here for PD Search       Click here for Cross-React search
162       170 EEYYFEKAL       2.794       Click here for PD Search       Click here for Cross-React search
64       72 FHRSTGRYS       2.759       Click here for PD Search       Click here for Cross-React search
380       388 HKTESLRTL       2.661       Click here for PD Search       Click here for Cross-React search
235       243 YFPWAEKDS       2.624       Click here for PD Search       Click here for Cross-React search
163       171 EYYFEKALY       2.528       Click here for PD Search       Click here for Cross-React search
292       300 EPEKHGFEF       2.463       Click here for PD Search       Click here for Cross-React search
288       296 SLFSEPEKH       2.458       Click here for PD Search       Click here for Cross-React search
37       45 NFGDSNSDT       2.433       Click here for PD Search       Click here for Cross-React search
68       76 TGRYSDGRL       2.381       Click here for PD Search       Click here for Cross-React search
248       256 KAYNEVAQH       2.366       Click here for PD Search       Click here for Cross-React search
349       357 AHYTEAANE       2.324       Click here for PD Search       Click here for Cross-React search
351       359 YTEAANEYF       2.294       Click here for PD Search       Click here for Cross-React search
3       11 FPETNNNPI       2.291       Click here for PD Search       Click here for Cross-React search
345       353 NWDGAHYTE       2.285       Click here for PD Search       Click here for Cross-React search
254       262 AQHFNHKLK       2.26       Click here for PD Search       Click here for Cross-React search
293       301 PEKHGFEFP       2.199       Click here for PD Search       Click here for Cross-React search
164       172 YYFEKALYT       2.107       Click here for PD Search       Click here for Cross-React search
41       49 SNSDTGGKA       2.092       Click here for PD Search       Click here for Cross-React search
145       153 RSQFIRETG       2.03       Click here for PD Search       Click here for Cross-React search
381       389 KTESLRTLA       1.976       Click here for PD Search       Click here for Cross-React search
237       245 PWAEKDSAG       1.933       Click here for PD Search       Click here for Cross-React search
290       298 FSEPEKHGF       1.906       Click here for PD Search       Click here for Cross-React search
140       148 RQFIPRSQF       1.903       Click here for PD Search       Click here for Cross-React search
139       147 FRQFIPRSQ       1.903       Click here for PD Search       Click here for Cross-React search
138       146 QFRQFIPRS       1.903       Click here for PD Search       Click here for Cross-React search
137       145 SQFRQFIPR       1.903       Click here for PD Search       Click here for Cross-React search
323       331 TVTADDGTK       1.889       Click here for PD Search       Click here for Cross-React search
4       12 PETNNNPII       1.855       Click here for PD Search       Click here for Cross-React search
157       165 AELVPEEYY       1.852       Click here for PD Search       Click here for Cross-React search
201       209 NSFSANVKK       1.832       Click here for PD Search       Click here for Cross-React search
58       66 PYGETFFHR       1.819       Click here for PD Search       Click here for Cross-React search
289       297 LFSEPEKHG       1.815       Click here for PD Search       Click here for Cross-React search
134       142 VQYSQFRQF       1.806       Click here for PD Search       Click here for Cross-React search
204       212 SANVKKIYD       1.8       Click here for PD Search       Click here for Cross-React search
208       216 KKIYDLGAR       1.799       Click here for PD Search       Click here for Cross-React search
63       71 FFHRSTGRY       1.783       Click here for PD Search       Click here for Cross-React search
252       260 EVAQHFNHK       1.761       Click here for PD Search       Click here for Cross-React search
247       255 AKAYNEVAQ       1.757       Click here for PD Search       Click here for Cross-React search
5       13 ETNNNPIIT       1.731       Click here for PD Search       Click here for Cross-React search
379       387 CHKTESLRT       1.73       Click here for PD Search       Click here for Cross-React search
39       47 GDSNSDTGG       1.711       Click here for PD Search       Click here for Cross-React search
135       143 QYSQFRQFI       1.705       Click here for PD Search       Click here for Cross-React search
56       64 NPPYGETFF       1.697       Click here for PD Search       Click here for Cross-React search
236       244 FPWAEKDSA       1.691       Click here for PD Search       Click here for Cross-React search
174       182 DIGQNDLTE       1.687       Click here for PD Search       Click here for Cross-React search
132       140 LDVQYSQFR       1.658       Click here for PD Search       Click here for Cross-React search
62       70 TFFHRSTGR       1.642       Click here for PD Search       Click here for Cross-React search
250       258 YNEVAQHFN       1.631       Click here for PD Search       Click here for Cross-React search
55       63 LNPPYGETF       1.616       Click here for PD Search       Click here for Cross-React search
171       179 YTFDIGQND       1.602       Click here for PD Search       Click here for Cross-React search
51       59 AFYPLNPPY       1.599       Click here for PD Search       Click here for Cross-React search
159       167 LVPEEYYFE       1.587       Click here for PD Search       Click here for Cross-React search
158       166 ELVPEEYYF       1.587       Click here for PD Search       Click here for Cross-React search
322       330 DTVTADDGT       1.578       Click here for PD Search       Click here for Cross-React search
42       50 NSDTGGKAA       1.577       Click here for PD Search       Click here for Cross-React search
59       67 YGETFFHRS       1.576       Click here for PD Search       Click here for Cross-React search
256       264 HFNHKLKEI       1.568       Click here for PD Search       Click here for Cross-React search
52       60 FYPLNPPYG       1.567       Click here for PD Search       Click here for Cross-React search
262       270 KEIVAQLRK       1.547       Click here for PD Search       Click here for Cross-React search
143       151 IPRSQFIRE       1.541       Click here for PD Search       Click here for Cross-React search
136       144 YSQFRQFIP       1.523       Click here for PD Search       Click here for Cross-React search
190       198 EEVNATVPD       1.519       Click here for PD Search       Click here for Cross-React search
267       275 QLRKDLPLA       1.507       Click here for PD Search       Click here for Cross-React search
266       274 AQLRKDLPL       1.507       Click here for PD Search       Click here for Cross-React search
38       46 FGDSNSDTG       1.497       Click here for PD Search       Click here for Cross-React search
311       319 KYNFSVTAP       1.486       Click here for PD Search       Click here for Cross-React search
354       362 AANEYFFDQ       1.467       Click here for PD Search       Click here for Cross-React search
353       361 EAANEYFFD       1.467       Click here for PD Search       Click here for Cross-React search
36       44 FNFGDSNSD       1.46       Click here for PD Search       Click here for Cross-React search
88       96 PYLSPYLSS       1.459       Click here for PD Search       Click here for Cross-React search
61       69 ETFFHRSTG       1.452       Click here for PD Search       Click here for Cross-React search
60       68 GETFFHRST       1.452       Click here for PD Search       Click here for Cross-React search
57       65 PPYGETFFH       1.436       Click here for PD Search       Click here for Cross-React search
346       354 WDGAHYTEA       1.435       Click here for PD Search       Click here for Cross-React search
251       259 NEVAQHFNH       1.416       Click here for PD Search       Click here for Cross-React search
233       241 LTYFPWAEK       1.395       Click here for PD Search       Click here for Cross-React search
347       355 DGAHYTEAA       1.379       Click here for PD Search       Click here for Cross-React search
364       372 STGAFSDPP       1.361       Click here for PD Search       Click here for Cross-React search
265       273 VAQLRKDLP       1.357       Click here for PD Search       Click here for Cross-React search
356       364 NEYFFDQIS       1.35       Click here for PD Search       Click here for Cross-React search
307       315 GYGGKYNFS       1.349       Click here for PD Search       Click here for Cross-React search
343       351 RVNWDGAHY       1.329       Click here for PD Search       Click here for Cross-React search
348       356 GAHYTEAAN       1.328       Click here for PD Search       Click here for Cross-React search
131       139 YLDVQYSQF       1.327       Click here for PD Search       Click here for Cross-React search
130       138 FYLDVQYSQ       1.327       Click here for PD Search       Click here for Cross-React search
382       390 TESLRTLAS       1.324       Click here for PD Search       Click here for Cross-React search
269       277 RKDLPLATF       1.319       Click here for PD Search       Click here for Cross-React search
209       217 KIYDLGART       1.298       Click here for PD Search       Click here for Cross-React search
263       271 EIVAQLRKD       1.292       Click here for PD Search       Click here for Cross-React search
240       248 EKDSAGCAK       1.275       Click here for PD Search       Click here for Cross-React search
98       106 GSNFKHGAD       1.274       Click here for PD Search       Click here for Cross-React search
352       360 TEAANEYFF       1.268       Click here for PD Search       Click here for Cross-React search
268       276 LRKDLPLAT       1.256       Click here for PD Search       Click here for Cross-React search
166       174 FEKALYTFD       1.241       Click here for PD Search       Click here for Cross-React search
176       184 GQNDLTEGF       1.235       Click here for PD Search       Click here for Cross-React search
369       377 SDPPVPLNM       1.224       Click here for PD Search       Click here for Cross-React search
285       293 VKYSLFSEP       1.213       Click here for PD Search       Click here for Cross-React search
357       365 EYFFDQIST       1.212       Click here for PD Search       Click here for Cross-React search
378       386 ACHKTESLR       1.211       Click here for PD Search       Click here for Cross-React search
376       384 NMACHKTES       1.193       Click here for PD Search       Click here for Cross-React search
129       137 PFYLDVQYS       1.184       Click here for PD Search       Click here for Cross-React search
128       136 SPFYLDVQY       1.184       Click here for PD Search       Click here for Cross-React search
294       302 EKHGFEFPL       1.173       Click here for PD Search       Click here for Cross-React search
165       173 YFEKALYTF       1.164       Click here for PD Search       Click here for Cross-React search
69       77 GRYSDGRLI       1.157       Click here for PD Search       Click here for Cross-React search
85       93 FNLPYLSPY       1.132       Click here for PD Search       Click here for Cross-React search
95       103 SSLGSNFKH       1.13       Click here for PD Search       Click here for Cross-React search
99       107 SNFKHGADF       1.115       Click here for PD Search       Click here for Cross-React search
205       213 ANVKKIYDL       1.108       Click here for PD Search       Click here for Cross-React search
206       214 NVKKIYDLG       1.085       Click here for PD Search       Click here for Cross-React search
83       91 ESFNLPYLS       1.084       Click here for PD Search       Click here for Cross-React search
321       329 GDTVTADDG       1.082       Click here for PD Search       Click here for Cross-React search
111       119 GSTIKLPTT       1.082       Click here for PD Search       Click here for Cross-React search
86       94 NLPYLSPYL       1.078       Click here for PD Search       Click here for Cross-React search
259       267 HKLKEIVAQ       1.075       Click here for PD Search       Click here for Cross-React search
368       376 FSDPPVPLN       1.071       Click here for PD Search       Click here for Cross-React search
284       292 SVKYSLFSE       1.051       Click here for PD Search       Click here for Cross-React search
50       58 AAFYPLNPP       1.031       Click here for PD Search       Click here for Cross-React search
177       185 QNDLTEGFL       1.029       Click here for PD Search       Click here for Cross-React search
146       154 SQFIRETGG       1.026       Click here for PD Search       Click here for Cross-React search
249       257 AYNEVAQHF       1.024       Click here for PD Search       Click here for Cross-React search
156       164 FAELVPEEY       1.023       Click here for PD Search       Click here for Cross-React search
355       363 ANEYFFDQI       1.018       Click here for PD Search       Click here for Cross-React search
308       316 YGGKYNFSV       1.012       Click here for PD Search       Click here for Cross-React search
167       175 EKALYTFDI       1.005       Click here for PD Search       Click here for Cross-React search
175       183 IGQNDLTEG       1.0       Click here for PD Search       Click here for Cross-React search
258       266 NHKLKEIVA       0.998       Click here for PD Search       Click here for Cross-React search
43       51 SDTGGKAAA       0.991       Click here for PD Search       Click here for Cross-React search
344       352 VNWDGAHYT       0.979       Click here for PD Search       Click here for Cross-React search
84       92 SFNLPYLSP       0.968       Click here for PD Search       Click here for Cross-React search
25       33 YASETCDFP       0.965       Click here for PD Search       Click here for Cross-React search
281       289 DIYSVKYSL       0.96       Click here for PD Search       Click here for Cross-React search
92       100 PYLSSLGSN       0.959       Click here for PD Search       Click here for Cross-React search
178       186 NDLTEGFLN       0.955       Click here for PD Search       Click here for Cross-React search
310       318 GKYNFSVTA       0.951       Click here for PD Search       Click here for Cross-React search
283       291 YSVKYSLFS       0.951       Click here for PD Search       Click here for Cross-React search
340       348 PSVRVNWDG       0.949       Click here for PD Search       Click here for Cross-React search
203       211 FSANVKKIY       0.934       Click here for PD Search       Click here for Cross-React search
309       317 GGKYNFSVT       0.932       Click here for PD Search       Click here for Cross-React search
370       378 DPPVPLNMA       0.923       Click here for PD Search       Click here for Cross-React search
325       333 TADDGTKIV       0.918       Click here for PD Search       Click here for Cross-React search
324       332 VTADDGTKI       0.918       Click here for PD Search       Click here for Cross-React search
87       95 LPYLSPYLS       0.898       Click here for PD Search       Click here for Cross-React search
102       110 KHGADFATA       0.88       Click here for PD Search       Click here for Cross-React search
279       287 HVDIYSVKY       0.877       Click here for PD Search       Click here for Cross-React search
215       223 ARTFWIHNT       0.874       Click here for PD Search       Click here for Cross-React search
48       56 KAAAFYPLN       0.871       Click here for PD Search       Click here for Cross-React search
280       288 VDIYSVKYS       0.864       Click here for PD Search       Click here for Cross-React search
216       224 RTFWIHNTG       0.856       Click here for PD Search       Click here for Cross-React search
257       265 FNHKLKEIV       0.855       Click here for PD Search       Click here for Cross-React search
211       219 YDLGARTFW       0.843       Click here for PD Search       Click here for Cross-React search
173       181 FDIGQNDLT       0.843       Click here for PD Search       Click here for Cross-React search
172       180 TFDIGQNDL       0.843       Click here for PD Search       Click here for Cross-React search
100       108 NFKHGADFA       0.841       Click here for PD Search       Click here for Cross-React search
253       261 VAQHFNHKL       0.839       Click here for PD Search       Click here for Cross-React search
96       104 SLGSNFKHG       0.835       Click here for PD Search       Click here for Cross-React search
6       14 TNNNPIITL       0.824       Click here for PD Search       Click here for Cross-React search
70       78 RYSDGRLII       0.819       Click here for PD Search       Click here for Cross-React search
82       90 AESFNLPYL       0.817       Click here for PD Search       Click here for Cross-React search
366       374 GAFSDPPVP       0.807       Click here for PD Search       Click here for Cross-React search
91       99 SPYLSSLGS       0.799       Click here for PD Search       Click here for Cross-React search
202       210 SFSANVKKI       0.798       Click here for PD Search       Click here for Cross-React search
170       178 LYTFDIGQN       0.791       Click here for PD Search       Click here for Cross-React search
186       194 NLTVEEVNA       0.78       Click here for PD Search       Click here for Cross-React search
89       97 YLSPYLSSL       0.778       Click here for PD Search       Click here for Cross-React search
150       158 RETGGIFAE       0.773       Click here for PD Search       Click here for Cross-React search
142       150 FIPRSQFIR       0.77       Click here for PD Search       Click here for Cross-React search
112       120 STIKLPTTI       0.767       Click here for PD Search       Click here for Cross-React search
7       15 NNNPIITLS       0.765       Click here for PD Search       Click here for Cross-React search
110       118 AGSTIKLPT       0.758       Click here for PD Search       Click here for Cross-React search
109       117 TAGSTIKLP       0.758       Click here for PD Search       Click here for Cross-React search
365       373 TGAFSDPPV       0.754       Click here for PD Search       Click here for Cross-React search
101       109 FKHGADFAT       0.754       Click here for PD Search       Click here for Cross-React search
241       249 KDSAGCAKA       0.744       Click here for PD Search       Click here for Cross-React search
21       29 LSLAYASET       0.741       Click here for PD Search       Click here for Cross-React search
375       383 LNMACHKTE       0.734       Click here for PD Search       Click here for Cross-React search
244       252 AGCAKAYNE       0.725       Click here for PD Search       Click here for Cross-React search
191       199 EVNATVPDL       0.723       Click here for PD Search       Click here for Cross-React search
187       195 LTVEEVNAT       0.7       Click here for PD Search       Click here for Cross-React search
71       79 YSDGRLIID       0.699       Click here for PD Search       Click here for Cross-React search
81       89 IAESFNLPY       0.695       Click here for PD Search       Click here for Cross-React search
358       366 YFFDQISTG       0.692       Click here for PD Search       Click here for Cross-React search
362       370 QISTGAFSD       0.691       Click here for PD Search       Click here for Cross-React search
361       369 DQISTGAFS       0.691       Click here for PD Search       Click here for Cross-React search
94       102 LSSLGSNFK       0.685       Click here for PD Search       Click here for Cross-React search
207       215 VKKIYDLGA       0.682       Click here for PD Search       Click here for Cross-React search
383       391 ESLRTLASV       0.681       Click here for PD Search       Click here for Cross-React search
141       149 QFIPRSQFI       0.681       Click here for PD Search       Click here for Cross-React search
200       208 VNSFSANVK       0.68       Click here for PD Search       Click here for Cross-React search
217       225 TFWIHNTGP       0.676       Click here for PD Search       Click here for Cross-React search
189       197 VEEVNATVP       0.675       Click here for PD Search       Click here for Cross-React search
49       57 AAAFYPLNP       0.674       Click here for PD Search       Click here for Cross-React search
367       375 AFSDPPVPL       0.673       Click here for PD Search       Click here for Cross-React search
193       201 NATVPDLVN       0.672       Click here for PD Search       Click here for Cross-React search
238       246 WAEKDSAGC       0.67       Click here for PD Search       Click here for Cross-React search
374       382 PLNMACHKT       0.656       Click here for PD Search       Click here for Cross-React search
127       135 FSPFYLDVQ       0.655       Click here for PD Search       Click here for Cross-React search
260       268 KLKEIVAQL       0.651       Click here for PD Search       Click here for Cross-React search
239       247 AEKDSAGCA       0.644       Click here for PD Search       Click here for Cross-React search
46       54 GGKAAAFYP       0.643       Click here for PD Search       Click here for Cross-React search
44       52 DTGGKAAAF       0.64       Click here for PD Search       Click here for Cross-React search
261       269 LKEIVAQLR       0.638       Click here for PD Search       Click here for Cross-React search
185       193 LNLTVEEVN       0.637       Click here for PD Search       Click here for Cross-React search
24       32 AYASETCDF       0.631       Click here for PD Search       Click here for Cross-React search
198       206 DLVNSFSAN       0.631       Click here for PD Search       Click here for Cross-React search
342       350 VRVNWDGAH       0.63       Click here for PD Search       Click here for Cross-React search
188       196 TVEEVNATV       0.63       Click here for PD Search       Click here for Cross-React search
97       105 LGSNFKHGA       0.629       Click here for PD Search       Click here for Cross-React search
105       113 ADFATAGST       0.625       Click here for PD Search       Click here for Cross-React search
26       34 ASETCDFPA       0.622       Click here for PD Search       Click here for Cross-React search
341       349 SVRVNWDGA       0.62       Click here for PD Search       Click here for Cross-React search
115       123 KLPTTIIPA       0.619       Click here for PD Search       Click here for Cross-React search
363       371 ISTGAFSDP       0.617       Click here for PD Search       Click here for Cross-React search
264       272 IVAQLRKDL       0.615       Click here for PD Search       Click here for Cross-React search
35       43 IFNFGDSNS       0.613       Click here for PD Search       Click here for Cross-React search
377       385 MACHKTESL       0.612       Click here for PD Search       Click here for Cross-React search
197       205 PDLVNSFSA       0.606       Click here for PD Search       Click here for Cross-React search
45       53 TGGKAAAFY       0.601       Click here for PD Search       Click here for Cross-React search
23       31 LAYASETCD       0.601       Click here for PD Search       Click here for Cross-React search
214       222 GARTFWIHN       0.599       Click here for PD Search       Click here for Cross-React search
320       328 CGDTVTADD       0.586       Click here for PD Search       Click here for Cross-React search
242       250 DSAGCAKAY       0.583       Click here for PD Search       Click here for Cross-React search
168       176 KALYTFDIG       0.574       Click here for PD Search       Click here for Cross-React search
210       218 IYDLGARTF       0.562       Click here for PD Search       Click here for Cross-React search
243       251 SAGCAKAYN       0.561       Click here for PD Search       Click here for Cross-React search
194       202 ATVPDLVNS       0.56       Click here for PD Search       Click here for Cross-React search
246       254 CAKAYNEVA       0.544       Click here for PD Search       Click here for Cross-React search
319       327 PCGDTVTAD       0.543       Click here for PD Search       Click here for Cross-React search
306       314 CGYGGKYNF       0.539       Click here for PD Search       Click here for Cross-React search
93       101 YLSSLGSNF       0.537       Click here for PD Search       Click here for Cross-React search
147       155 QFIRETGGI       0.537       Click here for PD Search       Click here for Cross-React search
47       55 GKAAAFYPL       0.536       Click here for PD Search       Click here for Cross-React search
245       253 GCAKAYNEV       0.533       Click here for PD Search       Click here for Cross-React search
107       115 FATAGSTIK       0.52       Click here for PD Search       Click here for Cross-React search
339       347 CPSVRVNWD       0.514       Click here for PD Search       Click here for Cross-React search
20       28 MLSLAYASE       0.508       Click here for PD Search       Click here for Cross-React search
117       125 PTTIIPAHG       0.506       Click here for PD Search       Click here for Cross-React search
270       278 KDLPLATFV       0.5       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database