List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MEINKLVCFSFSLVLILGLVESFHYHERELESEEGFMGMYDRWREQHNIEMRSPERFNVF
KYNVRRIHESNKMDKPYKLKVNEFADMTNLEFVNTYANSKISHFQALRGSAPGSIDTDPN
KDFIYANVTKIPDKVDWREKNAVTDVKGQGGCGSCWAFAAVVALEGINAIRTGKLVKFSE
QQLVDCDMTNAGCDGGLMEPAFTYVIKHGGIAPEASYPYVGKRETCDKAKIKDVLKIDGR
QNVPGLDEEALRKAVAHQPVATGIQLSGHGLQFYSEGVYTGDCGTEPNHGVGIVGYGENE
KGIKFWTVKNSWGPTWGEKGYIHLQRGARKEGLCGVAMHSSFPIMNDPNPPKDDPNGPKD
DPDAPKDPKFKTTQRLQGIRTKLLEL


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
346       354 NDPNPPKDD       6.855       Click here for PD Search       Click here for Cross-React search
347       355 DPNPPKDDP       6.591       Click here for PD Search       Click here for Cross-React search
348       356 PNPPKDDPN       6.347       Click here for PD Search       Click here for Cross-React search
359       367 KDDPDAPKD       5.783       Click here for PD Search       Click here for Cross-React search
352       360 KDDPNGPKD       5.456       Click here for PD Search       Click here for Cross-React search
361       369 DPDAPKDPK       5.355       Click here for PD Search       Click here for Cross-React search
358       366 PKDDPDAPK       5.355       Click here for PD Search       Click here for Cross-React search
40       48 YDRWREQHN       5.332       Click here for PD Search       Click here for Cross-React search
70       78 SNKMDKPYK       5.313       Click here for PD Search       Click here for Cross-React search
351       359 PKDDPNGPK       5.051       Click here for PD Search       Click here for Cross-React search
366       374 KDPKFKTTQ       4.966       Click here for PD Search       Click here for Cross-React search
367       375 DPKFKTTQR       4.863       Click here for PD Search       Click here for Cross-React search
69       77 ESNKMDKPY       4.601       Click here for PD Search       Click here for Cross-React search
353       361 DDPNGPKDD       4.556       Click here for PD Search       Click here for Cross-React search
360       368 DDPDAPKDP       4.472       Click here for PD Search       Click here for Cross-React search
365       373 PKDPKFKTT       4.434       Click here for PD Search       Click here for Cross-React search
355       363 PNGPKDDPD       4.218       Click here for PD Search       Click here for Cross-React search
354       362 DPNGPKDDP       4.218       Click here for PD Search       Click here for Cross-React search
72       80 KMDKPYKLK       4.066       Click here for PD Search       Click here for Cross-React search
349       357 NPPKDDPNG       4.062       Click here for PD Search       Click here for Cross-React search
345       353 MNDPNPPKD       4.062       Click here for PD Search       Click here for Cross-React search
68       76 HESNKMDKP       3.995       Click here for PD Search       Click here for Cross-React search
350       358 PPKDDPNGP       3.906       Click here for PD Search       Click here for Cross-React search
133       141 DKVDWREKN       3.655       Click here for PD Search       Click here for Cross-React search
363       371 DAPKDPKFK       3.591       Click here for PD Search       Click here for Cross-React search
26       34 HERELESEE       3.532       Click here for PD Search       Click here for Cross-React search
132       140 PDKVDWREK       3.514       Click here for PD Search       Click here for Cross-React search
39       47 MYDRWREQH       3.281       Click here for PD Search       Click here for Cross-React search
71       79 NKMDKPYKL       3.269       Click here for PD Search       Click here for Cross-React search
25       33 YHERELESE       3.196       Click here for PD Search       Click here for Cross-React search
364       372 APKDPKFKT       3.103       Click here for PD Search       Click here for Cross-React search
362       370 PDAPKDPKF       2.777       Click here for PD Search       Click here for Cross-React search
356       364 NGPKDDPDA       2.756       Click here for PD Search       Click here for Cross-React search
222       230 KRETCDKAK       2.726       Click here for PD Search       Click here for Cross-React search
369       377 KFKTTQRLQ       2.69       Click here for PD Search       Click here for Cross-React search
357       365 GPKDDPDAP       2.65       Click here for PD Search       Click here for Cross-React search
21       29 ESFHYHERE       2.636       Click here for PD Search       Click here for Cross-React search
27       35 ERELESEEG       2.569       Click here for PD Search       Click here for Cross-React search
75       83 KPYKLKVNE       2.543       Click here for PD Search       Click here for Cross-React search
50       58 EMRSPERFN       2.529       Click here for PD Search       Click here for Cross-React search
24       32 HYHERELES       2.511       Click here for PD Search       Click here for Cross-React search
42       50 RWREQHNIE       2.474       Click here for PD Search       Click here for Cross-React search
74       82 DKPYKLKVN       2.452       Click here for PD Search       Click here for Cross-React search
114       122 SIDTDPNKD       2.417       Click here for PD Search       Click here for Cross-React search
368       376 PKFKTTQRL       2.402       Click here for PD Search       Click here for Cross-React search
38       46 GMYDRWREQ       2.386       Click here for PD Search       Click here for Cross-React search
41       49 DRWREQHNI       2.385       Click here for PD Search       Click here for Cross-React search
44       52 REQHNIEMR       2.328       Click here for PD Search       Click here for Cross-React search
134       142 KVDWREKNA       2.211       Click here for PD Search       Click here for Cross-React search
217       225 YPYVGKRET       2.101       Click here for PD Search       Click here for Cross-React search
65       73 RRIHESNKM       2.08       Click here for PD Search       Click here for Cross-React search
48       56 NIEMRSPER       2.047       Click here for PD Search       Click here for Cross-React search
323       331 HLQRGARKE       1.987       Click here for PD Search       Click here for Cross-React search
216       224 SYPYVGKRE       1.951       Click here for PD Search       Click here for Cross-React search
61       69 KYNVRRIHE       1.824       Click here for PD Search       Click here for Cross-React search
67       75 IHESNKMDK       1.811       Click here for PD Search       Click here for Cross-React search
66       74 RIHESNKMD       1.774       Click here for PD Search       Click here for Cross-React search
344       352 IMNDPNPPK       1.705       Click here for PD Search       Click here for Cross-React search
23       31 FHYHERELE       1.622       Click here for PD Search       Click here for Cross-React search
296       304 YGENEKGIK       1.597       Click here for PD Search       Click here for Cross-React search
137       145 WREKNAVTD       1.596       Click here for PD Search       Click here for Cross-React search
136       144 DWREKNAVT       1.596       Click here for PD Search       Click here for Cross-React search
45       53 EQHNIEMRS       1.593       Click here for PD Search       Click here for Cross-React search
116       124 DTDPNKDFI       1.562       Click here for PD Search       Click here for Cross-React search
115       123 IDTDPNKDF       1.562       Click here for PD Search       Click here for Cross-React search
64       72 VRRIHESNK       1.56       Click here for PD Search       Click here for Cross-React search
73       81 MDKPYKLKV       1.509       Click here for PD Search       Click here for Cross-React search
117       125 TDPNKDFIY       1.465       Click here for PD Search       Click here for Cross-React search
374       382 QRLQGIRTK       1.462       Click here for PD Search       Click here for Cross-React search
325       333 QRGARKEGL       1.445       Click here for PD Search       Click here for Cross-React search
324       332 LQRGARKEG       1.445       Click here for PD Search       Click here for Cross-React search
113       121 GSIDTDPNK       1.432       Click here for PD Search       Click here for Cross-React search
47       55 HNIEMRSPE       1.422       Click here for PD Search       Click here for Cross-React search
46       54 QHNIEMRSP       1.422       Click here for PD Search       Click here for Cross-React search
130       138 KIPDKVDWR       1.422       Click here for PD Search       Click here for Cross-React search
37       45 MGMYDRWRE       1.364       Click here for PD Search       Click here for Cross-React search
221       229 GKRETCDKA       1.349       Click here for PD Search       Click here for Cross-React search
370       378 FKTTQRLQG       1.331       Click here for PD Search       Click here for Cross-React search
343       351 PIMNDPNPP       1.318       Click here for PD Search       Click here for Cross-React search
28       36 RELESEEGF       1.284       Click here for PD Search       Click here for Cross-React search
63       71 NVRRIHESN       1.255       Click here for PD Search       Click here for Cross-React search
22       30 SFHYHEREL       1.255       Click here for PD Search       Click here for Cross-React search
43       51 WREQHNIEM       1.25       Click here for PD Search       Click here for Cross-React search
131       139 IPDKVDWRE       1.232       Click here for PD Search       Click here for Cross-React search
62       70 YNVRRIHES       1.223       Click here for PD Search       Click here for Cross-React search
55       63 ERFNVFKYN       1.178       Click here for PD Search       Click here for Cross-React search
139       147 EKNAVTDVK       1.15       Click here for PD Search       Click here for Cross-React search
94       102 NTYANSKIS       1.145       Click here for PD Search       Click here for Cross-React search
58       66 NVFKYNVRR       1.141       Click here for PD Search       Click here for Cross-React search
215       223 ASYPYVGKR       1.138       Click here for PD Search       Click here for Cross-React search
240       248 RQNVPGLDE       1.137       Click here for PD Search       Click here for Cross-React search
174       182 KLVKFSEQQ       1.136       Click here for PD Search       Click here for Cross-React search
54       62 PERFNVFKY       1.132       Click here for PD Search       Click here for Cross-React search
20       28 VESFHYHER       1.13       Click here for PD Search       Click here for Cross-React search
138       146 REKNAVTDV       1.126       Click here for PD Search       Click here for Cross-React search
236       244 KIDGRQNVP       1.116       Click here for PD Search       Click here for Cross-React search
112       120 PGSIDTDPN       1.107       Click here for PD Search       Click here for Cross-React search
318       326 EKGYIHLQR       1.103       Click here for PD Search       Click here for Cross-React search
49       57 IEMRSPERF       1.102       Click here for PD Search       Click here for Cross-React search
76       84 PYKLKVNEF       1.101       Click here for PD Search       Click here for Cross-React search
51       59 MRSPERFNV       1.084       Click here for PD Search       Click here for Cross-React search
371       379 KTTQRLQGI       1.077       Click here for PD Search       Click here for Cross-React search
373       381 TQRLQGIRT       1.055       Click here for PD Search       Click here for Cross-React search
372       380 TTQRLQGIR       1.055       Click here for PD Search       Click here for Cross-React search
246       254 LDEEALRKA       1.048       Click here for PD Search       Click here for Cross-React search
129       137 TKIPDKVDW       1.048       Click here for PD Search       Click here for Cross-React search
245       253 GLDEEALRK       1.027       Click here for PD Search       Click here for Cross-React search
118       126 DPNKDFIYA       1.026       Click here for PD Search       Click here for Cross-React search
241       249 QNVPGLDEE       1.006       Click here for PD Search       Click here for Cross-React search
214       222 EASYPYVGK       1.006       Click here for PD Search       Click here for Cross-React search
220       228 VGKRETCDK       0.991       Click here for PD Search       Click here for Cross-React search
119       127 PNKDFIYAN       0.988       Click here for PD Search       Click here for Cross-React search
224       232 ETCDKAKIK       0.975       Click here for PD Search       Click here for Cross-React search
126       134 ANVTKIPDK       0.97       Click here for PD Search       Click here for Cross-React search
95       103 TYANSKISH       0.969       Click here for PD Search       Click here for Cross-React search
53       61 SPERFNVFK       0.968       Click here for PD Search       Click here for Cross-React search
223       231 RETCDKAKI       0.955       Click here for PD Search       Click here for Cross-React search
313       321 GPTWGEKGY       0.95       Click here for PD Search       Click here for Cross-React search
52       60 RSPERFNVF       0.948       Click here for PD Search       Click here for Cross-React search
177       185 KFSEQQLVD       0.948       Click here for PD Search       Click here for Cross-React search
247       255 DEEALRKAV       0.943       Click here for PD Search       Click here for Cross-React search
225       233 TCDKAKIKD       0.941       Click here for PD Search       Click here for Cross-React search
298       306 ENEKGIKFW       0.938       Click here for PD Search       Click here for Cross-React search
60       68 FKYNVRRIH       0.912       Click here for PD Search       Click here for Cross-React search
228       236 KAKIKDVLK       0.891       Click here for PD Search       Click here for Cross-React search
297       305 GENEKGIKF       0.883       Click here for PD Search       Click here for Cross-React search
311       319 SWGPTWGEK       0.863       Click here for PD Search       Click here for Cross-React search
294       302 VGYGENEKG       0.837       Click here for PD Search       Click here for Cross-React search
307       315 TVKNSWGPT       0.825       Click here for PD Search       Click here for Cross-React search
135       143 VDWREKNAV       0.821       Click here for PD Search       Click here for Cross-React search
322       330 IHLQRGARK       0.804       Click here for PD Search       Click here for Cross-React search
309       317 KNSWGPTWG       0.802       Click here for PD Search       Click here for Cross-React search
244       252 PGLDEEALR       0.794       Click here for PD Search       Click here for Cross-React search
212       220 APEASYPYV       0.794       Click here for PD Search       Click here for Cross-React search
295       303 GYGENEKGI       0.79       Click here for PD Search       Click here for Cross-React search
92       100 FVNTYANSK       0.783       Click here for PD Search       Click here for Cross-React search
299       307 NEKGIKFWT       0.782       Click here for PD Search       Click here for Cross-React search
213       221 PEASYPYVG       0.778       Click here for PD Search       Click here for Cross-React search
219       227 YVGKRETCD       0.776       Click here for PD Search       Click here for Cross-React search
274       282 YSEGVYTGD       0.768       Click here for PD Search       Click here for Cross-React search
78       86 KLKVNEFAD       0.767       Click here for PD Search       Click here for Cross-React search
125       133 YANVTKIPD       0.76       Click here for PD Search       Click here for Cross-React search
211       219 IAPEASYPY       0.75       Click here for PD Search       Click here for Cross-React search
227       235 DKAKIKDVL       0.744       Click here for PD Search       Click here for Cross-React search
128       136 VTKIPDKVD       0.74       Click here for PD Search       Click here for Cross-React search
342       350 FPIMNDPNP       0.738       Click here for PD Search       Click here for Cross-React search
77       85 YKLKVNEFA       0.719       Click here for PD Search       Click here for Cross-React search
218       226 PYVGKRETC       0.719       Click here for PD Search       Click here for Cross-React search
232       240 KDVLKIDGR       0.714       Click here for PD Search       Click here for Cross-React search
127       135 NVTKIPDKV       0.712       Click here for PD Search       Click here for Cross-React search
272       280 QFYSEGVYT       0.697       Click here for PD Search       Click here for Cross-React search
375       383 RLQGIRTKL       0.696       Click here for PD Search       Click here for Cross-React search
111       119 APGSIDTDP       0.696       Click here for PD Search       Click here for Cross-React search
310       318 NSWGPTWGE       0.694       Click here for PD Search       Click here for Cross-React search
251       259 LRKAVAHQP       0.686       Click here for PD Search       Click here for Cross-React search
36       44 FMGMYDRWR       0.682       Click here for PD Search       Click here for Cross-React search
304       312 KFWTVKNSW       0.68       Click here for PD Search       Click here for Cross-React search
91       99 EFVNTYANS       0.678       Click here for PD Search       Click here for Cross-React search
314       322 PTWGEKGYI       0.673       Click here for PD Search       Click here for Cross-React search
80       88 KVNEFADMT       0.664       Click here for PD Search       Click here for Cross-React search
140       148 KNAVTDVKG       0.657       Click here for PD Search       Click here for Cross-React search
239       247 GRQNVPGLD       0.65       Click here for PD Search       Click here for Cross-React search
238       246 DGRQNVPGL       0.65       Click here for PD Search       Click here for Cross-React search
29       37 ELESEEGFM       0.649       Click here for PD Search       Click here for Cross-React search
173       181 GKLVKFSEQ       0.649       Click here for PD Search       Click here for Cross-React search
98       106 NSKISHFQA       0.642       Click here for PD Search       Click here for Cross-React search
97       105 ANSKISHFQ       0.642       Click here for PD Search       Click here for Cross-React search
341       349 SFPIMNDPN       0.64       Click here for PD Search       Click here for Cross-React search
83       91 EFADMTNLE       0.639       Click here for PD Search       Click here for Cross-React search
312       320 WGPTWGEKG       0.637       Click here for PD Search       Click here for Cross-React search
93       101 VNTYANSKI       0.634       Click here for PD Search       Click here for Cross-React search
321       329 YIHLQRGAR       0.63       Click here for PD Search       Click here for Cross-React search
319       327 KGYIHLQRG       0.63       Click here for PD Search       Click here for Cross-React search
252       260 RKAVAHQPV       0.618       Click here for PD Search       Click here for Cross-React search
233       241 DVLKIDGRQ       0.618       Click here for PD Search       Click here for Cross-React search
377       385 QGIRTKLLE       0.616       Click here for PD Search       Click here for Cross-React search
171       179 RTGKLVKFS       0.612       Click here for PD Search       Click here for Cross-React search
280       288 TGDCGTEPN       0.605       Click here for PD Search       Click here for Cross-React search
110       118 SAPGSIDTD       0.603       Click here for PD Search       Click here for Cross-React search
308       316 VKNSWGPTW       0.601       Click here for PD Search       Click here for Cross-React search
306       314 WTVKNSWGP       0.601       Click here for PD Search       Click here for Cross-React search
88       96 TNLEFVNTY       0.596       Click here for PD Search       Click here for Cross-React search
235       243 LKIDGRQNV       0.595       Click here for PD Search       Click here for Cross-React search
234       242 VLKIDGRQN       0.595       Click here for PD Search       Click here for Cross-React search
82       90 NEFADMTNL       0.593       Click here for PD Search       Click here for Cross-React search
293       301 IVGYGENEK       0.593       Click here for PD Search       Click here for Cross-React search
315       323 TWGEKGYIH       0.592       Click here for PD Search       Click here for Cross-React search
279       287 YTGDCGTEP       0.59       Click here for PD Search       Click here for Cross-React search
242       250 NVPGLDEEA       0.587       Click here for PD Search       Click here for Cross-React search
96       104 YANSKISHF       0.581       Click here for PD Search       Click here for Cross-React search
282       290 DCGTEPNHG       0.571       Click here for PD Search       Click here for Cross-React search
281       289 GDCGTEPNH       0.571       Click here for PD Search       Click here for Cross-React search
248       256 EEALRKAVA       0.571       Click here for PD Search       Click here for Cross-React search
141       149 NAVTDVKGQ       0.569       Click here for PD Search       Click here for Cross-React search
34       42 EGFMGMYDR       0.567       Click here for PD Search       Click here for Cross-React search
317       325 GEKGYIHLQ       0.557       Click here for PD Search       Click here for Cross-React search
237       245 IDGRQNVPG       0.552       Click here for PD Search       Click here for Cross-React search
172       180 TGKLVKFSE       0.541       Click here for PD Search       Click here for Cross-React search
81       89 VNEFADMTN       0.534       Click here for PD Search       Click here for Cross-React search
340       348 SSFPIMNDP       0.533       Click here for PD Search       Click here for Cross-React search
230       238 KIKDVLKID       0.516       Click here for PD Search       Click here for Cross-React search
57       65 FNVFKYNVR       0.505       Click here for PD Search       Click here for Cross-React search
56       64 RFNVFKYNV       0.505       Click here for PD Search       Click here for Cross-React search
33       41 EEGFMGMYD       0.502       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database