List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MKLFALLALVVLLAGVQSQKDPKLVPDESTLLRLFEWKFDDIADECERFLAPKGYAGVQV
SPVHKNLLYTATAPGLWERYQPMSYKLVSRSGDETAFRDMVRRCNAVGVRIYVDVVLNHM
SGNWDNAVGTGGSTADTYNYSYPGVPYDHSDFHPYCILNDYQDPEIVRNCELVGLHDLDQ
SQDYVREKLIDFLNHLVDAGVAGFRVDAAKHMWPADLEYIYGKVNNRNSDAGYCGDSSPS
RYQEVIDLGGEAVSKFEYNGFGRVTEFKHSEQIGYAFRGNNRLEWTYTYKPNWGLLPSGD
ALVFVDNHDNQRGGGNAILTYKTPKNYKMAIAFILAHPYGYPRVMSSFDFEAHDQGPPQD
SDKNILSPSINADGTCGNGWVCEHRWRQHANMVGFRNAVRGTEITNWWDNGNHQIGFCRG
DRGFVAFNVEDNDLKQTLQTCLPAGTYCDVISGSKNNRAHLGAELVVAPNGEAFSVRLIS
DDDGVLAIHLEEKL


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
320       328 TYKTPKNYK       10.713       Click here for PD Search       Click here for Cross-React search
321       329 YKTPKNYKM       7.346       Click here for PD Search       Click here for Cross-React search
78       86 ERYQPMSYK       6.23       Click here for PD Search       Click here for Cross-React search
236       244 DSSPSRYQE       6.026       Click here for PD Search       Click here for Cross-React search
355       363 QGPPQDSDK       5.587       Click here for PD Search       Click here for Cross-React search
180       188 QSQDYVREK       5.578       Click here for PD Search       Click here for Cross-React search
356       364 GPPQDSDKN       5.188       Click here for PD Search       Click here for Cross-React search
284       292 EWTYTYKPN       4.878       Click here for PD Search       Click here for Cross-React search
322       330 KTPKNYKMA       4.736       Click here for PD Search       Click here for Cross-React search
354       362 DQGPPQDSD       4.666       Click here for PD Search       Click here for Cross-React search
179       187 DQSQDYVRE       4.658       Click here for PD Search       Click here for Cross-React search
319       327 LTYKTPKNY       4.418       Click here for PD Search       Click here for Cross-React search
383       391 EHRWRQHAN       3.833       Click here for PD Search       Click here for Cross-React search
353       361 HDQGPPQDS       3.802       Click here for PD Search       Click here for Cross-React search
357       365 PPQDSDKNI       3.675       Click here for PD Search       Click here for Cross-React search
176       184 HDLDQSQDY       3.467       Click here for PD Search       Click here for Cross-React search
235       243 GDSSPSRYQ       3.443       Click here for PD Search       Click here for Cross-React search
306       314 DNHDNQRGG       3.434       Click here for PD Search       Click here for Cross-React search
135       143 ADTYNYSYP       3.288       Click here for PD Search       Click here for Cross-React search
77       85 WERYQPMSY       3.276       Click here for PD Search       Click here for Cross-React search
136       144 DTYNYSYPG       3.221       Click here for PD Search       Click here for Cross-React search
15       23 GVQSQKDPK       3.212       Click here for PD Search       Click here for Cross-React search
282       290 RLEWTYTYK       3.168       Click here for PD Search       Click here for Cross-React search
134       142 TADTYNYSY       3.069       Click here for PD Search       Click here for Cross-React search
225       233 NNRNSDAGY       3.008       Click here for PD Search       Click here for Cross-React search
20       28 KDPKLVPDE       2.978       Click here for PD Search       Click here for Cross-React search
19       27 QKDPKLVPD       2.978       Click here for PD Search       Click here for Cross-React search
351       359 EAHDQGPPQ       2.972       Click here for PD Search       Click here for Cross-React search
79       87 RYQPMSYKL       2.967       Click here for PD Search       Click here for Cross-React search
285       293 WTYTYKPNW       2.962       Click here for PD Search       Click here for Cross-React search
223       231 KVNNRNSDA       2.879       Click here for PD Search       Click here for Cross-React search
352       360 AHDQGPPQD       2.866       Click here for PD Search       Click here for Cross-React search
222       230 GKVNNRNSD       2.821       Click here for PD Search       Click here for Cross-React search
428       436 NVEDNDLKQ       2.789       Click here for PD Search       Click here for Cross-React search
286       294 TYTYKPNWG       2.787       Click here for PD Search       Click here for Cross-React search
431       439 DNDLKQTLQ       2.781       Click here for PD Search       Click here for Cross-React search
430       438 EDNDLKQTL       2.781       Click here for PD Search       Click here for Cross-React search
237       245 SSPSRYQEV       2.678       Click here for PD Search       Click here for Cross-React search
17       25 QSQKDPKLV       2.676       Click here for PD Search       Click here for Cross-React search
16       24 VQSQKDPKL       2.676       Click here for PD Search       Click here for Cross-React search
181       189 SQDYVREKL       2.656       Click here for PD Search       Click here for Cross-React search
221       229 YGKVNNRNS       2.647       Click here for PD Search       Click here for Cross-React search
133       141 STADTYNYS       2.625       Click here for PD Search       Click here for Cross-React search
280       288 NNRLEWTYT       2.615       Click here for PD Search       Click here for Cross-React search
452       460 SGSKNNRAH       2.607       Click here for PD Search       Click here for Cross-React search
305       313 VDNHDNQRG       2.576       Click here for PD Search       Click here for Cross-React search
281       289 NRLEWTYTY       2.548       Click here for PD Search       Click here for Cross-React search
429       437 VEDNDLKQT       2.503       Click here for PD Search       Click here for Cross-React search
283       291 LEWTYTYKP       2.501       Click here for PD Search       Click here for Cross-React search
432       440 NDLKQTLQT       2.404       Click here for PD Search       Click here for Cross-React search
147       155 YDHSDFHPY       2.396       Click here for PD Search       Click here for Cross-React search
18       26 SQKDPKLVP       2.39       Click here for PD Search       Click here for Cross-React search
146       154 PYDHSDFHP       2.365       Click here for PD Search       Click here for Cross-React search
304       312 FVDNHDNQR       2.254       Click here for PD Search       Click here for Cross-React search
278       286 RGNNRLEWT       2.241       Click here for PD Search       Click here for Cross-React search
178       186 LDQSQDYVR       2.218       Click here for PD Search       Click here for Cross-React search
384       392 HRWRQHANM       2.19       Click here for PD Search       Click here for Cross-React search
160       168 DYQDPEIVR       2.175       Click here for PD Search       Click here for Cross-React search
161       169 YQDPEIVRN       2.095       Click here for PD Search       Click here for Cross-React search
263       271 RVTEFKHSE       2.093       Click here for PD Search       Click here for Cross-React search
308       316 HDNQRGGGN       2.035       Click here for PD Search       Click here for Cross-React search
307       315 NHDNQRGGG       2.035       Click here for PD Search       Click here for Cross-React search
21       29 DPKLVPDES       1.995       Click here for PD Search       Click here for Cross-React search
74       82 PGLWERYQP       1.989       Click here for PD Search       Click here for Cross-React search
158       166 LNDYQDPEI       1.985       Click here for PD Search       Click here for Cross-React search
157       165 ILNDYQDPE       1.985       Click here for PD Search       Click here for Cross-React search
318       326 ILTYKTPKN       1.976       Click here for PD Search       Click here for Cross-React search
358       366 PQDSDKNIL       1.96       Click here for PD Search       Click here for Cross-React search
90       98 RSGDETAFR       1.957       Click here for PD Search       Click here for Cross-React search
132       140 GSTADTYNY       1.938       Click here for PD Search       Click here for Cross-React search
177       185 DLDQSQDYV       1.891       Click here for PD Search       Click here for Cross-React search
406       414 NWWDNGNHQ       1.886       Click here for PD Search       Click here for Cross-React search
264       272 VTEFKHSEQ       1.851       Click here for PD Search       Click here for Cross-React search
175       183 LHDLDQSQD       1.825       Click here for PD Search       Click here for Cross-React search
279       287 GNNRLEWTY       1.793       Click here for PD Search       Click here for Cross-React search
159       167 NDYQDPEIV       1.786       Click here for PD Search       Click here for Cross-React search
265       273 TEFKHSEQI       1.748       Click here for PD Search       Click here for Cross-React search
239       247 PSRYQEVID       1.746       Click here for PD Search       Click here for Cross-React search
76       84 LWERYQPMS       1.724       Click here for PD Search       Click here for Cross-React search
22       30 PKLVPDEST       1.724       Click here for PD Search       Click here for Cross-React search
359       367 QDSDKNILS       1.699       Click here for PD Search       Click here for Cross-React search
91       99 SGDETAFRD       1.668       Click here for PD Search       Click here for Cross-React search
323       331 TPKNYKMAI       1.66       Click here for PD Search       Click here for Cross-React search
14       22 AGVQSQKDP       1.622       Click here for PD Search       Click here for Cross-React search
349       357 DFEAHDQGP       1.605       Click here for PD Search       Click here for Cross-React search
454       462 SKNNRAHLG       1.604       Click here for PD Search       Click here for Cross-React search
453       461 GSKNNRAHL       1.604       Click here for PD Search       Click here for Cross-React search
287       295 YTYKPNWGL       1.593       Click here for PD Search       Click here for Cross-React search
140       148 YSYPGVPYD       1.593       Click here for PD Search       Click here for Cross-React search
405       413 TNWWDNGNH       1.572       Click here for PD Search       Click here for Cross-React search
139       147 NYSYPGVPY       1.534       Click here for PD Search       Click here for Cross-React search
138       146 YNYSYPGVP       1.534       Click here for PD Search       Click here for Cross-React search
360       368 DSDKNILSP       1.517       Click here for PD Search       Click here for Cross-React search
309       317 DNQRGGGNA       1.511       Click here for PD Search       Click here for Cross-React search
350       358 FEAHDQGPP       1.486       Click here for PD Search       Click here for Cross-React search
143       151 PGVPYDHSD       1.474       Click here for PD Search       Click here for Cross-React search
137       145 TYNYSYPGV       1.431       Click here for PD Search       Click here for Cross-React search
224       232 VNNRNSDAG       1.425       Click here for PD Search       Click here for Cross-React search
274       282 GYAFRGNNR       1.403       Click here for PD Search       Click here for Cross-React search
238       246 SPSRYQEVI       1.401       Click here for PD Search       Click here for Cross-React search
427       435 FNVEDNDLK       1.395       Click here for PD Search       Click here for Cross-React search
182       190 QDYVREKLI       1.389       Click here for PD Search       Click here for Cross-React search
251       259 EAVSKFEYN       1.385       Click here for PD Search       Click here for Cross-React search
220       228 IYGKVNNRN       1.384       Click here for PD Search       Click here for Cross-React search
142       150 YPGVPYDHS       1.383       Click here for PD Search       Click here for Cross-React search
141       149 SYPGVPYDH       1.383       Click here for PD Search       Click here for Cross-React search
118       126 NHMSGNWDN       1.374       Click here for PD Search       Click here for Cross-React search
335       343 LAHPYGYPR       1.359       Click here for PD Search       Click here for Cross-React search
219       227 YIYGKVNNR       1.349       Click here for PD Search       Click here for Cross-React search
277       285 FRGNNRLEW       1.345       Click here for PD Search       Click here for Cross-React search
451       459 ISGSKNNRA       1.343       Click here for PD Search       Click here for Cross-React search
183       191 DYVREKLID       1.34       Click here for PD Search       Click here for Cross-React search
89       97 SRSGDETAF       1.339       Click here for PD Search       Click here for Cross-React search
255       263 KFEYNGFGR       1.322       Click here for PD Search       Click here for Cross-React search
73       81 APGLWERYQ       1.3       Click here for PD Search       Click here for Cross-React search
86       94 KLVSRSGDE       1.298       Click here for PD Search       Click here for Cross-React search
33       41 RLFEWKFDD       1.296       Click here for PD Search       Click here for Cross-React search
276       284 AFRGNNRLE       1.292       Click here for PD Search       Click here for Cross-React search
382       390 CEHRWRQHA       1.278       Click here for PD Search       Click here for Cross-React search
75       83 GLWERYQPM       1.273       Click here for PD Search       Click here for Cross-React search
402       410 TEITNWWDN       1.272       Click here for PD Search       Click here for Cross-React search
268       276 KHSEQIGYA       1.265       Click here for PD Search       Click here for Cross-React search
317       325 AILTYKTPK       1.242       Click here for PD Search       Click here for Cross-React search
47       55 ERFLAPKGY       1.236       Click here for PD Search       Click here for Cross-React search
92       100 GDETAFRDM       1.232       Click here for PD Search       Click here for Cross-React search
95       103 TAFRDMVRR       1.226       Click here for PD Search       Click here for Cross-React search
131       139 GGSTADTYN       1.224       Click here for PD Search       Click here for Cross-React search
336       344 AHPYGYPRV       1.223       Click here for PD Search       Click here for Cross-React search
361       369 SDKNILSPS       1.217       Click here for PD Search       Click here for Cross-React search
347       355 SFDFEAHDQ       1.217       Click here for PD Search       Click here for Cross-React search
455       463 KNNRAHLGA       1.209       Click here for PD Search       Click here for Cross-React search
266       274 EFKHSEQIG       1.199       Click here for PD Search       Click here for Cross-React search
337       345 HPYGYPRVM       1.198       Click here for PD Search       Click here for Cross-React search
262       270 GRVTEFKHS       1.196       Click here for PD Search       Click here for Cross-React search
385       393 RWRQHANMV       1.195       Click here for PD Search       Click here for Cross-React search
218       226 EYIYGKVNN       1.193       Click here for PD Search       Click here for Cross-React search
338       346 PYGYPRVMS       1.18       Click here for PD Search       Click here for Cross-React search
85       93 YKLVSRSGD       1.174       Click here for PD Search       Click here for Cross-React search
275       283 YAFRGNNRL       1.169       Click here for PD Search       Click here for Cross-React search
324       332 PKNYKMAIA       1.162       Click here for PD Search       Click here for Cross-React search
88       96 VSRSGDETA       1.148       Click here for PD Search       Click here for Cross-React search
145       153 VPYDHSDFH       1.135       Click here for PD Search       Click here for Cross-React search
80       88 YQPMSYKLV       1.124       Click here for PD Search       Click here for Cross-React search
210       218 KHMWPADLE       1.111       Click here for PD Search       Click here for Cross-React search
130       138 TGGSTADTY       1.099       Click here for PD Search       Click here for Cross-React search
37       45 WKFDDIADE       1.096       Click here for PD Search       Click here for Cross-React search
36       44 EWKFDDIAD       1.096       Click here for PD Search       Click here for Cross-React search
40       48 DDIADECER       1.094       Click here for PD Search       Click here for Cross-React search
82       90 PMSYKLVSR       1.087       Click here for PD Search       Click here for Cross-React search
94       102 ETAFRDMVR       1.084       Click here for PD Search       Click here for Cross-React search
267       275 FKHSEQIGY       1.084       Click here for PD Search       Click here for Cross-React search
72       80 TAPGLWERY       1.083       Click here for PD Search       Click here for Cross-React search
174       182 GLHDLDQSQ       1.081       Click here for PD Search       Click here for Cross-React search
234       242 CGDSSPSRY       1.066       Click here for PD Search       Click here for Cross-React search
233       241 YCGDSSPSR       1.066       Click here for PD Search       Click here for Cross-React search
456       464 NNRAHLGAE       1.047       Click here for PD Search       Click here for Cross-React search
395       403 FRNAVRGTE       1.044       Click here for PD Search       Click here for Cross-React search
64       72 HKNLLYTAT       1.034       Click here for PD Search       Click here for Cross-React search
339       347 YGYPRVMSS       1.022       Click here for PD Search       Click here for Cross-React search
226       234 NRNSDAGYC       1.003       Click here for PD Search       Click here for Cross-React search
26       34 PDESTLLRL       1.001       Click here for PD Search       Click here for Cross-React search
316       324 NAILTYKTP       0.998       Click here for PD Search       Click here for Cross-React search
450       458 VISGSKNNR       0.987       Click here for PD Search       Click here for Cross-React search
81       89 QPMSYKLVS       0.962       Click here for PD Search       Click here for Cross-React search
341       349 YPRVMSSFD       0.954       Click here for PD Search       Click here for Cross-React search
84       92 SYKLVSRSG       0.942       Click here for PD Search       Click here for Cross-React search
83       91 MSYKLVSRS       0.942       Click here for PD Search       Click here for Cross-React search
346       354 SSFDFEAHD       0.942       Click here for PD Search       Click here for Cross-React search
381       389 VCEHRWRQH       0.939       Click here for PD Search       Click here for Cross-React search
87       95 LVSRSGDET       0.937       Click here for PD Search       Click here for Cross-React search
240       248 SRYQEVIDL       0.931       Click here for PD Search       Click here for Cross-React search
93       101 DETAFRDMV       0.924       Click here for PD Search       Click here for Cross-React search
23       31 KLVPDESTL       0.92       Click here for PD Search       Click here for Cross-React search
400       408 RGTEITNWW       0.918       Click here for PD Search       Click here for Cross-React search
254       262 SKFEYNGFG       0.905       Click here for PD Search       Click here for Cross-React search
25       33 VPDESTLLR       0.901       Click here for PD Search       Click here for Cross-React search
348       356 FDFEAHDQG       0.899       Click here for PD Search       Click here for Cross-React search
289       297 YKPNWGLLP       0.898       Click here for PD Search       Click here for Cross-React search
403       411 EITNWWDNG       0.872       Click here for PD Search       Click here for Cross-React search
211       219 HMWPADLEY       0.871       Click here for PD Search       Click here for Cross-React search
13       21 LAGVQSQKD       0.865       Click here for PD Search       Click here for Cross-React search
215       223 ADLEYIYGK       0.864       Click here for PD Search       Click here for Cross-React search
119       127 HMSGNWDNA       0.863       Click here for PD Search       Click here for Cross-React search
303       311 VFVDNHDNQ       0.854       Click here for PD Search       Click here for Cross-React search
250       258 GEAVSKFEY       0.852       Click here for PD Search       Click here for Cross-React search
396       404 RNAVRGTEI       0.845       Click here for PD Search       Click here for Cross-React search
98       106 RDMVRRCNA       0.845       Click here for PD Search       Click here for Cross-React search
449       457 DVISGSKNN       0.841       Click here for PD Search       Click here for Cross-React search
288       296 TYKPNWGLL       0.838       Click here for PD Search       Click here for Cross-React search
144       152 GVPYDHSDF       0.826       Click here for PD Search       Click here for Cross-React search
407       415 WWDNGNHQI       0.822       Click here for PD Search       Click here for Cross-React search
148       156 DHSDFHPYC       0.82       Click here for PD Search       Click here for Cross-React search
258       266 YNGFGRVTE       0.818       Click here for PD Search       Click here for Cross-React search
257       265 EYNGFGRVT       0.818       Click here for PD Search       Click here for Cross-React search
62       70 PVHKNLLYT       0.814       Click here for PD Search       Click here for Cross-React search
404       412 ITNWWDNGN       0.81       Click here for PD Search       Click here for Cross-React search
433       441 DLKQTLQTC       0.801       Click here for PD Search       Click here for Cross-React search
367       375 SPSINADGT       0.795       Click here for PD Search       Click here for Cross-React search
208       216 AAKHMWPAD       0.794       Click here for PD Search       Click here for Cross-React search
207       215 DAAKHMWPA       0.794       Click here for PD Search       Click here for Cross-React search
252       260 AVSKFEYNG       0.792       Click here for PD Search       Click here for Cross-React search
186       194 REKLIDFLN       0.792       Click here for PD Search       Click here for Cross-React search
270       278 SEQIGYAFR       0.788       Click here for PD Search       Click here for Cross-React search
401       409 GTEITNWWD       0.783       Click here for PD Search       Click here for Cross-React search
408       416 WDNGNHQIG       0.774       Click here for PD Search       Click here for Cross-React search
261       269 FGRVTEFKH       0.773       Click here for PD Search       Click here for Cross-React search
290       298 KPNWGLLPS       0.768       Click here for PD Search       Click here for Cross-React search
65       73 KNLLYTATA       0.767       Click here for PD Search       Click here for Cross-React search
469       477 PNGEAFSVR       0.765       Click here for PD Search       Click here for Cross-React search
61       69 SPVHKNLLY       0.756       Click here for PD Search       Click here for Cross-React search
59       67 QVSPVHKNL       0.752       Click here for PD Search       Click here for Cross-React search
435       443 KQTLQTCLP       0.742       Click here for PD Search       Click here for Cross-React search
45       53 ECERFLAPK       0.74       Click here for PD Search       Click here for Cross-React search
475       483 SVRLISDDD       0.74       Click here for PD Search       Click here for Cross-React search
205       213 RVDAAKHMW       0.739       Click here for PD Search       Click here for Cross-React search
380       388 WVCEHRWRQ       0.725       Click here for PD Search       Click here for Cross-React search
97       105 FRDMVRRCN       0.725       Click here for PD Search       Click here for Cross-React search
48       56 RFLAPKGYA       0.721       Click here for PD Search       Click here for Cross-React search
163       171 DPEIVRNCE       0.717       Click here for PD Search       Click here for Cross-React search
162       170 QDPEIVRNC       0.717       Click here for PD Search       Click here for Cross-React search
213       221 WPADLEYIY       0.71       Click here for PD Search       Click here for Cross-React search
426       434 AFNVEDNDL       0.704       Click here for PD Search       Click here for Cross-React search
117       125 LNHMSGNWD       0.704       Click here for PD Search       Click here for Cross-React search
71       79 ATAPGLWER       0.698       Click here for PD Search       Click here for Cross-React search
184       192 YVREKLIDF       0.695       Click here for PD Search       Click here for Cross-React search
129       137 GTGGSTADT       0.694       Click here for PD Search       Click here for Cross-React search
241       249 RYQEVIDLG       0.688       Click here for PD Search       Click here for Cross-React search
253       261 VSKFEYNGF       0.678       Click here for PD Search       Click here for Cross-React search
58       66 VQVSPVHKN       0.676       Click here for PD Search       Click here for Cross-React search
214       222 PADLEYIYG       0.668       Click here for PD Search       Click here for Cross-React search
51       59 APKGYAGVQ       0.656       Click here for PD Search       Click here for Cross-React search
325       333 KNYKMAIAF       0.651       Click here for PD Search       Click here for Cross-React search
399       407 VRGTEITNW       0.648       Click here for PD Search       Click here for Cross-React search
209       217 AKHMWPADL       0.648       Click here for PD Search       Click here for Cross-React search
32       40 LRLFEWKFD       0.64       Click here for PD Search       Click here for Cross-React search
315       323 GNAILTYKT       0.639       Click here for PD Search       Click here for Cross-React search
409       417 DNGNHQIGF       0.637       Click here for PD Search       Click here for Cross-React search
362       370 DKNILSPSI       0.637       Click here for PD Search       Click here for Cross-React search
216       224 DLEYIYGKV       0.635       Click here for PD Search       Click here for Cross-React search
425       433 VAFNVEDND       0.634       Click here for PD Search       Click here for Cross-React search
310       318 NQRGGGNAI       0.634       Click here for PD Search       Click here for Cross-React search
398       406 AVRGTEITN       0.622       Click here for PD Search       Click here for Cross-React search
397       405 NAVRGTEIT       0.622       Click here for PD Search       Click here for Cross-React search
155       163 YCILNDYQD       0.622       Click here for PD Search       Click here for Cross-React search
44       52 DECERFLAP       0.618       Click here for PD Search       Click here for Cross-React search
227       235 RNSDAGYCG       0.617       Click here for PD Search       Click here for Cross-React search
156       164 CILNDYQDP       0.614       Click here for PD Search       Click here for Cross-React search
363       371 KNILSPSIN       0.613       Click here for PD Search       Click here for Cross-React search
217       225 LEYIYGKVN       0.612       Click here for PD Search       Click here for Cross-React search
204       212 FRVDAAKHM       0.609       Click here for PD Search       Click here for Cross-React search
203       211 GFRVDAAKH       0.609       Click here for PD Search       Click here for Cross-React search
386       394 WRQHANMVG       0.604       Click here for PD Search       Click here for Cross-React search
394       402 GFRNAVRGT       0.596       Click here for PD Search       Click here for Cross-React search
66       74 NLLYTATAP       0.593       Click here for PD Search       Click here for Cross-React search
343       351 RVMSSFDFE       0.59       Click here for PD Search       Click here for Cross-React search
206       214 VDAAKHMWP       0.583       Click here for PD Search       Click here for Cross-React search
271       279 EQIGYAFRG       0.582       Click here for PD Search       Click here for Cross-React search
28       36 ESTLLRLFE       0.581       Click here for PD Search       Click here for Cross-React search
154       162 PYCILNDYQ       0.576       Click here for PD Search       Click here for Cross-React search
35       43 FEWKFDDIA       0.568       Click here for PD Search       Click here for Cross-React search
41       49 DIADECERF       0.567       Click here for PD Search       Click here for Cross-React search
340       348 GYPRVMSSF       0.565       Click here for PD Search       Click here for Cross-React search
260       268 GFGRVTEFK       0.562       Click here for PD Search       Click here for Cross-React search
27       35 DESTLLRLF       0.56       Click here for PD Search       Click here for Cross-React search
38       46 KFDDIADEC       0.559       Click here for PD Search       Click here for Cross-React search
345       353 MSSFDFEAH       0.558       Click here for PD Search       Click here for Cross-React search
187       195 EKLIDFLNH       0.55       Click here for PD Search       Click here for Cross-React search
269       277 HSEQIGYAF       0.548       Click here for PD Search       Click here for Cross-React search
477       485 RLISDDDGV       0.547       Click here for PD Search       Click here for Cross-React search
476       484 VRLISDDDG       0.547       Click here for PD Search       Click here for Cross-React search
272       280 QIGYAFRGN       0.541       Click here for PD Search       Click here for Cross-React search
249       257 GGEAVSKFE       0.538       Click here for PD Search       Click here for Cross-React search
232       240 GYCGDSSPS       0.538       Click here for PD Search       Click here for Cross-React search
457       465 NRAHLGAEL       0.537       Click here for PD Search       Click here for Cross-React search
63       71 VHKNLLYTA       0.532       Click here for PD Search       Click here for Cross-React search
342       350 PRVMSSFDF       0.527       Click here for PD Search       Click here for Cross-React search
30       38 TLLRLFEWK       0.527       Click here for PD Search       Click here for Cross-React search
228       236 NSDAGYCGD       0.526       Click here for PD Search       Click here for Cross-React search
70       78 TATAPGLWE       0.515       Click here for PD Search       Click here for Cross-React search
123       131 NWDNAVGTG       0.507       Click here for PD Search       Click here for Cross-React search
122       130 GNWDNAVGT       0.507       Click here for PD Search       Click here for Cross-React search
273       281 IGYAFRGNN       0.502       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database