List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MKPLMMQGHERAITQIKYNREGDLLFSCAKDHKPNVWFSLNGERLGTFNGHAGAVWCVDV
DWTTTKLITGSGDMSVRLWDVETGTSVACIPCKSSARTVGFSFSGNQAAYSTDRAMGHIC
ELFVIDSREPDSSLNDGDAILKIPISQSKITAMIWGTLDETIITGHENGQITLWDLRIGR
EINSVNDHMGAINDLQLSKDGTMFVSSSRDTTAKLFDSDSLMCLKTYKTERPVNSAAISP
LLEHVVLGGGQDAMEVTTTSARQGKFDSRFFHLIYEEEFARVKGHFGPINSLAFHPDGRS
YATGGEDGFVRLQTFDSSYYEYIFD


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
224       232 LKTYKTERP       7.416       Click here for PD Search       Click here for Cross-React search
225       233 KTYKTERPV       6.675       Click here for PD Search       Click here for Cross-React search
226       234 TYKTERPVN       5.367       Click here for PD Search       Click here for Cross-React search
227       235 YKTERPVNS       4.984       Click here for PD Search       Click here for Cross-React search
128       136 REPDSSLND       4.576       Click here for PD Search       Click here for Cross-React search
15       23 QIKYNREGD       4.505       Click here for PD Search       Click here for Cross-React search
206       214 SSSRDTTAK       4.351       Click here for PD Search       Click here for Cross-React search
14       22 TQIKYNREG       3.893       Click here for PD Search       Click here for Cross-React search
126       134 DSREPDSSL       3.814       Click here for PD Search       Click here for Cross-React search
106       114 NQAAYSTDR       3.701       Click here for PD Search       Click here for Cross-React search
127       135 SREPDSSLN       3.672       Click here for PD Search       Click here for Cross-React search
313       321 QTFDSSYYE       3.625       Click here for PD Search       Click here for Cross-React search
257       265 TTTSARQGK       3.589       Click here for PD Search       Click here for Cross-React search
261       269 ARQGKFDSR       3.381       Click here for PD Search       Click here for Cross-React search
314       322 TFDSSYYEY       3.28       Click here for PD Search       Click here for Cross-React search
125       133 IDSREPDSS       3.242       Click here for PD Search       Click here for Cross-React search
228       236 KTERPVNSA       3.213       Click here for PD Search       Click here for Cross-React search
262       270 RQGKFDSRF       2.898       Click here for PD Search       Click here for Cross-React search
13       21 ITQIKYNRE       2.758       Click here for PD Search       Click here for Cross-React search
295       303 HPDGRSYAT       2.739       Click here for PD Search       Click here for Cross-React search
275       283 YEEEFARVK       2.719       Click here for PD Search       Click here for Cross-React search
207       215 SSRDTTAKL       2.678       Click here for PD Search       Click here for Cross-React search
223       231 CLKTYKTER       2.571       Click here for PD Search       Click here for Cross-React search
17       25 KYNREGDLL       2.524       Click here for PD Search       Click here for Cross-React search
259       267 TSARQGKFD       2.492       Click here for PD Search       Click here for Cross-React search
29       37 AKDHKPNVW       2.341       Click here for PD Search       Click here for Cross-React search
255       263 EVTTTSARQ       2.331       Click here for PD Search       Click here for Cross-React search
107       115 QAAYSTDRA       2.325       Click here for PD Search       Click here for Cross-React search
260       268 SARQGKFDS       2.314       Click here for PD Search       Click here for Cross-React search
129       137 EPDSSLNDG       2.312       Click here for PD Search       Click here for Cross-React search
299       307 RSYATGGED       2.231       Click here for PD Search       Click here for Cross-React search
130       138 PDSSLNDGD       2.23       Click here for PD Search       Click here for Cross-React search
311       319 RLQTFDSSY       2.158       Click here for PD Search       Click here for Cross-React search
209       217 RDTTAKLFD       2.156       Click here for PD Search       Click here for Cross-React search
27       35 SCAKDHKPN       2.154       Click here for PD Search       Click here for Cross-React search
258       266 TTSARQGKF       2.153       Click here for PD Search       Click here for Cross-React search
16       24 IKYNREGDL       2.145       Click here for PD Search       Click here for Cross-React search
30       38 KDHKPNVWF       2.006       Click here for PD Search       Click here for Cross-React search
296       304 PDGRSYATG       1.992       Click here for PD Search       Click here for Cross-React search
105       113 GNQAAYSTD       1.87       Click here for PD Search       Click here for Cross-React search
193       201 NDLQLSKDG       1.84       Click here for PD Search       Click here for Cross-React search
7       15 QGHERAITQ       1.839       Click here for PD Search       Click here for Cross-React search
180       188 REINSVNDH       1.826       Click here for PD Search       Click here for Cross-React search
124       132 VIDSREPDS       1.795       Click here for PD Search       Click here for Cross-React search
110       118 YSTDRAMGH       1.753       Click here for PD Search       Click here for Cross-React search
10       18 ERAITQIKY       1.732       Click here for PD Search       Click here for Cross-React search
208       216 SRDTTAKLF       1.73       Click here for PD Search       Click here for Cross-React search
312       320 LQTFDSSYY       1.726       Click here for PD Search       Click here for Cross-React search
276       284 EEEFARVKG       1.717       Click here for PD Search       Click here for Cross-React search
194       202 DLQLSKDGT       1.652       Click here for PD Search       Click here for Cross-React search
294       302 FHPDGRSYA       1.643       Click here for PD Search       Click here for Cross-React search
293       301 AFHPDGRSY       1.643       Click here for PD Search       Click here for Cross-React search
229       237 TERPVNSAA       1.623       Click here for PD Search       Click here for Cross-React search
205       213 VSSSRDTTA       1.615       Click here for PD Search       Click here for Cross-React search
12       20 AITQIKYNR       1.609       Click here for PD Search       Click here for Cross-React search
11       19 RAITQIKYN       1.609       Click here for PD Search       Click here for Cross-React search
317       325 SSYYEYIFD       1.593       Click here for PD Search       Click here for Cross-React search
316       324 DSSYYEYIF       1.593       Click here for PD Search       Click here for Cross-React search
315       323 FDSSYYEYI       1.593       Click here for PD Search       Click here for Cross-React search
9       17 HERAITQIK       1.504       Click here for PD Search       Click here for Cross-React search
104       112 SGNQAAYST       1.501       Click here for PD Search       Click here for Cross-React search
211       219 TTAKLFDSD       1.475       Click here for PD Search       Click here for Cross-React search
210       218 DTTAKLFDS       1.475       Click here for PD Search       Click here for Cross-React search
251       259 QDAMEVTTT       1.468       Click here for PD Search       Click here for Cross-React search
131       139 DSSLNDGDA       1.457       Click here for PD Search       Click here for Cross-React search
59       67 DVDWTTTKL       1.417       Click here for PD Search       Click here for Cross-React search
204       212 FVSSSRDTT       1.384       Click here for PD Search       Click here for Cross-React search
212       220 TAKLFDSDS       1.37       Click here for PD Search       Click here for Cross-React search
277       285 EEFARVKGH       1.349       Click here for PD Search       Click here for Cross-React search
31       39 DHKPNVWFS       1.344       Click here for PD Search       Click here for Cross-React search
256       264 VTTTSARQG       1.332       Click here for PD Search       Click here for Cross-React search
254       262 MEVTTTSAR       1.332       Click here for PD Search       Click here for Cross-React search
108       116 AAYSTDRAM       1.329       Click here for PD Search       Click here for Cross-React search
179       187 GREINSVND       1.328       Click here for PD Search       Click here for Cross-React search
2       10 KPLMMQGHE       1.325       Click here for PD Search       Click here for Cross-React search
298       306 GRSYATGGE       1.322       Click here for PD Search       Click here for Cross-React search
192       200 INDLQLSKD       1.304       Click here for PD Search       Click here for Cross-React search
109       117 AYSTDRAMG       1.301       Click here for PD Search       Click here for Cross-React search
222       230 MCLKTYKTE       1.299       Click here for PD Search       Click here for Cross-React search
3       11 PLMMQGHER       1.298       Click here for PD Search       Click here for Cross-React search
263       271 QGKFDSRFF       1.281       Click here for PD Search       Click here for Cross-React search
58       66 VDVDWTTTK       1.276       Click here for PD Search       Click here for Cross-React search
297       305 DGRSYATGG       1.275       Click here for PD Search       Click here for Cross-React search
164       172 TGHENGQIT       1.233       Click here for PD Search       Click here for Cross-React search
28       36 CAKDHKPNV       1.193       Click here for PD Search       Click here for Cross-React search
41       49 NGERLGTFN       1.163       Click here for PD Search       Click here for Cross-React search
26       34 FSCAKDHKP       1.16       Click here for PD Search       Click here for Cross-React search
123       131 FVIDSREPD       1.16       Click here for PD Search       Click here for Cross-React search
61       69 DWTTTKLIT       1.157       Click here for PD Search       Click here for Cross-React search
252       260 DAMEVTTTS       1.136       Click here for PD Search       Click here for Cross-React search
300       308 SYATGGEDG       1.127       Click here for PD Search       Click here for Cross-React search
18       26 YNREGDLLF       1.093       Click here for PD Search       Click here for Cross-React search
273       281 LIYEEEFAR       1.059       Click here for PD Search       Click here for Cross-React search
6       14 MQGHERAIT       1.051       Click here for PD Search       Click here for Cross-React search
196       204 QLSKDGTMF       1.028       Click here for PD Search       Click here for Cross-React search
141       149 LKIPISQSK       1.024       Click here for PD Search       Click here for Cross-React search
310       318 VRLQTFDSS       1.022       Click here for PD Search       Click here for Cross-React search
264       272 GKFDSRFFH       1.007       Click here for PD Search       Click here for Cross-React search
250       258 GQDAMEVTT       1.006       Click here for PD Search       Click here for Cross-React search
77       85 RLWDVETGT       0.987       Click here for PD Search       Click here for Cross-React search
43       51 ERLGTFNGH       0.984       Click here for PD Search       Click here for Cross-React search
195       203 LQLSKDGTM       0.979       Click here for PD Search       Click here for Cross-React search
306       314 EDGFVRLQT       0.976       Click here for PD Search       Click here for Cross-React search
274       282 IYEEEFARV       0.953       Click here for PD Search       Click here for Cross-React search
203       211 MFVSSSRDT       0.949       Click here for PD Search       Click here for Cross-React search
202       210 TMFVSSSRD       0.949       Click here for PD Search       Click here for Cross-React search
175       183 DLRIGREIN       0.94       Click here for PD Search       Click here for Cross-React search
19       27 NREGDLLFS       0.935       Click here for PD Search       Click here for Cross-React search
39       47 SLNGERLGT       0.923       Click here for PD Search       Click here for Cross-React search
181       189 EINSVNDHM       0.922       Click here for PD Search       Click here for Cross-React search
167       175 ENGQITLWD       0.919       Click here for PD Search       Click here for Cross-React search
159       167 DETIITGHE       0.907       Click here for PD Search       Click here for Cross-React search
144       152 PISQSKITA       0.905       Click here for PD Search       Click here for Cross-React search
103       111 FSGNQAAYS       0.9       Click here for PD Search       Click here for Cross-React search
102       110 SFSGNQAAY       0.9       Click here for PD Search       Click here for Cross-React search
186       194 NDHMGAIND       0.894       Click here for PD Search       Click here for Cross-React search
63       71 TTTKLITGS       0.874       Click here for PD Search       Click here for Cross-React search
160       168 ETIITGHEN       0.873       Click here for PD Search       Click here for Cross-React search
142       150 KIPISQSKI       0.87       Click here for PD Search       Click here for Cross-React search
292       300 LAFHPDGRS       0.865       Click here for PD Search       Click here for Cross-React search
291       299 SLAFHPDGR       0.865       Click here for PD Search       Click here for Cross-React search
93       101 KSSARTVGF       0.857       Click here for PD Search       Click here for Cross-React search
4       12 LMMQGHERA       0.848       Click here for PD Search       Click here for Cross-React search
265       273 KFDSRFFHL       0.839       Click here for PD Search       Click here for Cross-React search
91       99 PCKSSARTV       0.829       Click here for PD Search       Click here for Cross-React search
69       77 TGSGDMSVR       0.801       Click here for PD Search       Click here for Cross-React search
191       199 AINDLQLSK       0.789       Click here for PD Search       Click here for Cross-React search
230       238 ERPVNSAAI       0.788       Click here for PD Search       Click here for Cross-React search
33       41 KPNVWFSLN       0.785       Click here for PD Search       Click here for Cross-React search
111       119 STDRAMGHI       0.784       Click here for PD Search       Click here for Cross-React search
90       98 IPCKSSART       0.783       Click here for PD Search       Click here for Cross-React search
213       221 AKLFDSDSL       0.783       Click here for PD Search       Click here for Cross-React search
214       222 KLFDSDSLM       0.767       Click here for PD Search       Click here for Cross-React search
183       191 NSVNDHMGA       0.76       Click here for PD Search       Click here for Cross-React search
1       9 MKPLMMQGH       0.757       Click here for PD Search       Click here for Cross-React search
176       184 LRIGREINS       0.754       Click here for PD Search       Click here for Cross-React search
166       174 HENGQITLW       0.748       Click here for PD Search       Click here for Cross-React search
8       16 GHERAITQI       0.744       Click here for PD Search       Click here for Cross-React search
272       280 HLIYEEEFA       0.736       Click here for PD Search       Click here for Cross-React search
301       309 YATGGEDGF       0.728       Click here for PD Search       Click here for Cross-React search
173       181 LWDLRIGRE       0.723       Click here for PD Search       Click here for Cross-React search
5       13 MMQGHERAI       0.721       Click here for PD Search       Click here for Cross-React search
42       50 GERLGTFNG       0.716       Click here for PD Search       Click here for Cross-React search
199       207 KDGTMFVSS       0.716       Click here for PD Search       Click here for Cross-React search
198       206 SKDGTMFVS       0.716       Click here for PD Search       Click here for Cross-React search
269       277 RFFHLIYEE       0.713       Click here for PD Search       Click here for Cross-React search
290       298 NSLAFHPDG       0.71       Click here for PD Search       Click here for Cross-React search
283       291 KGHFGPINS       0.708       Click here for PD Search       Click here for Cross-React search
165       173 GHENGQITL       0.704       Click here for PD Search       Click here for Cross-React search
65       73 TKLITGSGD       0.693       Click here for PD Search       Click here for Cross-React search
249       257 GGQDAMEVT       0.69       Click here for PD Search       Click here for Cross-React search
280       288 ARVKGHFGP       0.688       Click here for PD Search       Click here for Cross-React search
75       83 SVRLWDVET       0.687       Click here for PD Search       Click here for Cross-React search
253       261 AMEVTTTSA       0.687       Click here for PD Search       Click here for Cross-React search
62       70 WTTTKLITG       0.686       Click here for PD Search       Click here for Cross-React search
177       185 RIGREINSV       0.679       Click here for PD Search       Click here for Cross-React search
78       86 LWDVETGTS       0.675       Click here for PD Search       Click here for Cross-React search
278       286 EFARVKGHF       0.675       Click here for PD Search       Click here for Cross-React search
305       313 GEDGFVRLQ       0.669       Click here for PD Search       Click here for Cross-React search
303       311 TGGEDGFVR       0.669       Click here for PD Search       Click here for Cross-React search
32       40 HKPNVWFSL       0.664       Click here for PD Search       Click here for Cross-React search
309       317 FVRLQTFDS       0.661       Click here for PD Search       Click here for Cross-React search
121       129 ELFVIDSRE       0.642       Click here for PD Search       Click here for Cross-React search
271       279 FHLIYEEEF       0.631       Click here for PD Search       Click here for Cross-React search
270       278 FFHLIYEEE       0.631       Click here for PD Search       Click here for Cross-React search
143       151 IPISQSKIT       0.628       Click here for PD Search       Click here for Cross-React search
25       33 LFSCAKDHK       0.619       Click here for PD Search       Click here for Cross-React search
221       229 LMCLKTYKT       0.619       Click here for PD Search       Click here for Cross-React search
174       182 WDLRIGREI       0.615       Click here for PD Search       Click here for Cross-React search
132       140 SSLNDGDAI       0.611       Click here for PD Search       Click here for Cross-React search
231       239 RPVNSAAIS       0.61       Click here for PD Search       Click here for Cross-React search
79       87 WDVETGTSV       0.608       Click here for PD Search       Click here for Cross-React search
72       80 GDMSVRLWD       0.606       Click here for PD Search       Click here for Cross-React search
172       180 TLWDLRIGR       0.602       Click here for PD Search       Click here for Cross-React search
64       72 TTKLITGSG       0.599       Click here for PD Search       Click here for Cross-React search
163       171 ITGHENGQI       0.599       Click here for PD Search       Click here for Cross-React search
162       170 IITGHENGQ       0.599       Click here for PD Search       Click here for Cross-React search
40       48 LNGERLGTF       0.596       Click here for PD Search       Click here for Cross-React search
60       68 VDWTTTKLI       0.595       Click here for PD Search       Click here for Cross-React search
37       45 WFSLNGERL       0.588       Click here for PD Search       Click here for Cross-React search
80       88 DVETGTSVA       0.584       Click here for PD Search       Click here for Cross-React search
146       154 SQSKITAMI       0.579       Click here for PD Search       Click here for Cross-React search
145       153 ISQSKITAM       0.579       Click here for PD Search       Click here for Cross-React search
94       102 SSARTVGFS       0.574       Click here for PD Search       Click here for Cross-React search
44       52 RLGTFNGHA       0.574       Click here for PD Search       Click here for Cross-React search
220       228 SLMCLKTYK       0.574       Click here for PD Search       Click here for Cross-React search
122       130 LFVIDSREP       0.573       Click here for PD Search       Click here for Cross-React search
201       209 GTMFVSSSR       0.562       Click here for PD Search       Click here for Cross-React search
134       142 LNDGDAILK       0.562       Click here for PD Search       Click here for Cross-React search
178       186 IGREINSVN       0.557       Click here for PD Search       Click here for Cross-React search
38       46 FSLNGERLG       0.554       Click here for PD Search       Click here for Cross-React search
268       276 SRFFHLIYE       0.552       Click here for PD Search       Click here for Cross-React search
169       177 GQITLWDLR       0.533       Click here for PD Search       Click here for Cross-React search
267       275 DSRFFHLIY       0.532       Click here for PD Search       Click here for Cross-React search
92       100 CKSSARTVG       0.53       Click here for PD Search       Click here for Cross-React search
36       44 VWFSLNGER       0.53       Click here for PD Search       Click here for Cross-React search
182       190 INSVNDHMG       0.527       Click here for PD Search       Click here for Cross-React search
247       255 LGGGQDAME       0.526       Click here for PD Search       Click here for Cross-React search
76       84 VRLWDVETG       0.508       Click here for PD Search       Click here for Cross-React search
289       297 INSLAFHPD       0.503       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database