List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MKWVTFISLFFLFSSAYSRGLVRREAYKSEIAHRYNDLGEEHFRGLVLVAFSQYLQQCPF
EDHVKLAKEVTEFAKACAAEESGANCDKSLHTLFGDKLCTVASLRDKYGDMADCCEKQEP
DRNECFLAHKDDNPGFPPLVAPEPDALCAAFQDNEQLFLGKYLYEIARRHPYFYAPELLY
YAQQYKGVFAECCQAADKAACLGPKIEALREKVLLSSAKERFKCASLQKFGDRAFKAWSV
ARLSQRFPKADFAEISKVVTDLTKVHKECCHGDLLECADDRADLAKYMCENQDSISTKLK
ECCDKPVLEKSQCLAEVERDELPGDLPSLAADFVEDKEVCKNYQEAKDVFLGTFLYEYSR
RHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAKVLDEFKPLVDEPQNLVKTNCELFE
KLGEYGFQNALLVRYTKKAPQVSTPTLVEVSRKLGKVGTKCCKKPESERMSCADDFLSVV
LNRLCVLHEKTPVSERVTKCCSESLVNRRPCFSGLEVDETYVPKEFNAETFTFHADLCTL
PEAEKQVKKQTALVELLKHKPKATDEQLKTVMGDFGAFVEKCCAAENKEGCFSEEGPKLV
AAAQAALV


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
116       124 EKQEPDRNE       15.48       Click here for PD Search       Click here for Cross-React search
357       365 EYSRRHPEY       8.427       Click here for PD Search       Click here for Cross-React search
356       364 YEYSRRHPE       8.427       Click here for PD Search       Click here for Cross-React search
558       566 KHKPKATDE       7.507       Click here for PD Search       Click here for Cross-React search
463       471 KKPESERMS       6.831       Click here for PD Search       Click here for Cross-React search
358       366 YSRRHPEYS       6.521       Click here for PD Search       Click here for Cross-React search
559       567 HKPKATDEQ       6.501       Click here for PD Search       Click here for Cross-React search
542       550 EAEKQVKKQ       5.707       Click here for PD Search       Click here for Cross-React search
541       549 PEAEKQVKK       5.096       Click here for PD Search       Click here for Cross-React search
117       125 KQEPDRNEC       4.791       Click here for PD Search       Click here for Cross-React search
115       123 CEKQEPDRN       4.791       Click here for PD Search       Click here for Cross-React search
544       552 EKQVKKQTA       4.756       Click here for PD Search       Click here for Cross-React search
543       551 AEKQVKKQT       4.756       Click here for PD Search       Click here for Cross-React search
375       383 KEYEATLEK       4.141       Click here for PD Search       Click here for Cross-React search
355       363 LYEYSRRHP       4.013       Click here for PD Search       Click here for Cross-React search
341       349 KNYQEAKDV       4.004       Click here for PD Search       Click here for Cross-React search
561       569 PKATDEQLK       3.94       Click here for PD Search       Click here for Cross-React search
560       568 KPKATDEQL       3.94       Click here for PD Search       Click here for Cross-React search
22       30 VRREAYKSE       3.833       Click here for PD Search       Click here for Cross-React search
434       442 RYTKKAPQV       3.763       Click here for PD Search       Click here for Cross-React search
433       441 VRYTKKAPQ       3.763       Click here for PD Search       Click here for Cross-React search
488       496 HEKTPVSER       3.754       Click here for PD Search       Click here for Cross-React search
562       570 KATDEQLKT       3.677       Click here for PD Search       Click here for Cross-React search
23       31 RREAYKSEI       3.62       Click here for PD Search       Click here for Cross-React search
557       565 LKHKPKATD       3.575       Click here for PD Search       Click here for Cross-React search
290       298 ENQDSISTK       3.096       Click here for PD Search       Click here for Cross-React search
360       368 RRHPEYSVS       3.089       Click here for PD Search       Click here for Cross-React search
359       367 SRRHPEYSV       3.089       Click here for PD Search       Click here for Cross-React search
130       138 KDDNPGFPP       3.006       Click here for PD Search       Click here for Cross-React search
105       113 RDKYGDMAD       2.992       Click here for PD Search       Click here for Cross-React search
34       42 RYNDLGEEH       2.904       Click here for PD Search       Click here for Cross-React search
33       41 HRYNDLGEE       2.904       Click here for PD Search       Click here for Cross-React search
340       348 CKNYQEAKD       2.892       Click here for PD Search       Click here for Cross-React search
168       176 RRHPYFYAP       2.836       Click here for PD Search       Click here for Cross-React search
462       470 CKKPESERM       2.732       Click here for PD Search       Click here for Cross-React search
304       312 DKPVLEKSQ       2.688       Click here for PD Search       Click here for Cross-React search
129       137 HKDDNPGFP       2.645       Click here for PD Search       Click here for Cross-React search
435       443 YTKKAPQVS       2.575       Click here for PD Search       Click here for Cross-React search
164       172 YEIARRHPY       2.571       Click here for PD Search       Click here for Cross-React search
279       287 DDRADLAKY       2.545       Click here for PD Search       Click here for Cross-React search
437       445 KKAPQVSTP       2.541       Click here for PD Search       Click here for Cross-React search
169       177 RHPYFYAPE       2.508       Click here for PD Search       Click here for Cross-React search
402       410 KPLVDEPQN       2.494       Click here for PD Search       Click here for Cross-React search
353       361 TFLYEYSRR       2.383       Click here for PD Search       Click here for Cross-React search
518       526 DETYVPKEF       2.381       Click here for PD Search       Click here for Cross-React search
436       444 TKKAPQVST       2.371       Click here for PD Search       Click here for Cross-React search
372       380 RLAKEYEAT       2.366       Click here for PD Search       Click here for Cross-React search
28       36 KSEIAHRYN       2.335       Click here for PD Search       Click here for Cross-React search
406       414 DEPQNLVKT       2.328       Click here for PD Search       Click here for Cross-React search
519       527 ETYVPKEFN       2.293       Click here for PD Search       Click here for Cross-React search
27       35 YKSEIAHRY       2.275       Click here for PD Search       Click here for Cross-React search
545       553 KQVKKQTAL       2.265       Click here for PD Search       Click here for Cross-React search
354       362 FLYEYSRRH       2.247       Click here for PD Search       Click here for Cross-React search
204       212 PKIEALREK       2.245       Click here for PD Search       Click here for Cross-React search
407       415 EPQNLVKTN       2.242       Click here for PD Search       Click here for Cross-React search
337       345 KEVCKNYQE       2.203       Click here for PD Search       Click here for Cross-React search
336       344 DKEVCKNYQ       2.125       Click here for PD Search       Click here for Cross-React search
335       343 EDKEVCKNY       2.125       Click here for PD Search       Click here for Cross-React search
260       268 TDLTKVHKE       2.123       Click here for PD Search       Click here for Cross-React search
555       563 ELLKHKPKA       2.118       Click here for PD Search       Click here for Cross-React search
540       548 LPEAEKQVK       2.101       Click here for PD Search       Click here for Cross-React search
242       250 RLSQRFPKA       2.101       Click here for PD Search       Click here for Cross-React search
241       249 ARLSQRFPK       2.101       Click here for PD Search       Click here for Cross-React search
374       382 AKEYEATLE       2.092       Click here for PD Search       Click here for Cross-React search
118       126 QEPDRNECF       2.075       Click here for PD Search       Click here for Cross-React search
489       497 EKTPVSERV       2.048       Click here for PD Search       Click here for Cross-React search
517       525 VDETYVPKE       2.041       Click here for PD Search       Click here for Cross-React search
516       524 EVDETYVPK       2.041       Click here for PD Search       Click here for Cross-React search
161       169 KYLYEIARR       2.015       Click here for PD Search       Click here for Cross-React search
179       187 LYYAQQYKG       2.013       Click here for PD Search       Click here for Cross-React search
102       110 ASLRDKYGD       2.001       Click here for PD Search       Click here for Cross-React search
103       111 SLRDKYGDM       1.96       Click here for PD Search       Click here for Cross-React search
29       37 SEIAHRYND       1.95       Click here for PD Search       Click here for Cross-React search
502       510 SESLVNRRP       1.921       Click here for PD Search       Click here for Cross-React search
286       294 KYMCENQDS       1.898       Click here for PD Search       Click here for Cross-React search
244       252 SQRFPKADF       1.881       Click here for PD Search       Click here for Cross-React search
24       32 REAYKSEIA       1.867       Click here for PD Search       Click here for Cross-React search
215       223 LSSAKERFK       1.859       Click here for PD Search       Click here for Cross-React search
167       175 ARRHPYFYA       1.853       Click here for PD Search       Click here for Cross-React search
438       446 KAPQVSTPT       1.834       Click here for PD Search       Click here for Cross-React search
293       301 DSISTKLKE       1.833       Click here for PD Search       Click here for Cross-React search
292       300 QDSISTKLK       1.833       Click here for PD Search       Click here for Cross-React search
464       472 KPESERMSC       1.831       Click here for PD Search       Click here for Cross-React search
21       29 LVRREAYKS       1.825       Click here for PD Search       Click here for Cross-React search
180       188 YYAQQYKGV       1.811       Click here for PD Search       Click here for Cross-React search
318       326 ERDELPGDL       1.804       Click here for PD Search       Click here for Cross-React search
228       236 QKFGDRAFK       1.797       Click here for PD Search       Click here for Cross-React search
432       440 LVRYTKKAP       1.792       Click here for PD Search       Click here for Cross-React search
243       251 LSQRFPKAD       1.792       Click here for PD Search       Click here for Cross-React search
61       69 EDHVKLAKE       1.783       Click here for PD Search       Click here for Cross-React search
556       564 LLKHKPKAT       1.765       Click here for PD Search       Click here for Cross-React search
17       25 YSRGLVRRE       1.751       Click here for PD Search       Click here for Cross-React search
342       350 NYQEAKDVF       1.734       Click here for PD Search       Click here for Cross-React search
388       396 DDPPTCYAK       1.728       Click here for PD Search       Click here for Cross-React search
128       136 AHKDDNPGF       1.728       Click here for PD Search       Click here for Cross-React search
523       531 PKEFNAETF       1.725       Click here for PD Search       Click here for Cross-React search
315       323 AEVERDELP       1.719       Click here for PD Search       Click here for Cross-React search
491       499 TPVSERVTK       1.706       Click here for PD Search       Click here for Cross-React search
490       498 KTPVSERVT       1.706       Click here for PD Search       Click here for Cross-React search
32       40 AHRYNDLGE       1.694       Click here for PD Search       Click here for Cross-React search
316       324 EVERDELPG       1.684       Click here for PD Search       Click here for Cross-React search
178       186 LLYYAQQYK       1.677       Click here for PD Search       Click here for Cross-React search
127       135 LAHKDDNPG       1.646       Click here for PD Search       Click here for Cross-React search
278       286 ADDRADLAK       1.641       Click here for PD Search       Click here for Cross-React search
317       325 VERDELPGD       1.623       Click here for PD Search       Click here for Cross-React search
319       327 RDELPGDLP       1.611       Click here for PD Search       Click here for Cross-React search
524       532 KEFNAETFT       1.61       Click here for PD Search       Click here for Cross-React search
521       529 YVPKEFNAE       1.605       Click here for PD Search       Click here for Cross-React search
36       44 NDLGEEHFR       1.605       Click here for PD Search       Click here for Cross-React search
114       122 CCEKQEPDR       1.597       Click here for PD Search       Click here for Cross-React search
487       495 LHEKTPVSE       1.581       Click here for PD Search       Click here for Cross-React search
554       562 VELLKHKPK       1.556       Click here for PD Search       Click here for Cross-React search
539       547 TLPEAEKQV       1.516       Click here for PD Search       Click here for Cross-React search
460       468 KCCKKPESE       1.511       Click here for PD Search       Click here for Cross-React search
280       288 DRADLAKYM       1.508       Click here for PD Search       Click here for Cross-React search
461       469 CCKKPESER       1.48       Click here for PD Search       Click here for Cross-React search
522       530 VPKEFNAET       1.479       Click here for PD Search       Click here for Cross-React search
104       112 LRDKYGDMA       1.477       Click here for PD Search       Click here for Cross-React search
291       299 NQDSISTKL       1.474       Click here for PD Search       Click here for Cross-React search
26       34 AYKSEIAHR       1.467       Click here for PD Search       Click here for Cross-React search
177       185 ELLYYAQQY       1.452       Click here for PD Search       Click here for Cross-React search
399       407 DEFKPLVDE       1.45       Click here for PD Search       Click here for Cross-React search
126       134 FLAHKDDNP       1.44       Click here for PD Search       Click here for Cross-React search
452       460 RKLGKVGTK       1.434       Click here for PD Search       Click here for Cross-React search
176       184 PELLYYAQQ       1.433       Click here for PD Search       Click here for Cross-React search
285       293 AKYMCENQD       1.431       Click here for PD Search       Click here for Cross-React search
165       173 EIARRHPYF       1.421       Click here for PD Search       Click here for Cross-React search
246       254 RFPKADFAE       1.418       Click here for PD Search       Click here for Cross-React search
245       253 QRFPKADFA       1.418       Click here for PD Search       Click here for Cross-React search
162       170 YLYEIARRH       1.371       Click here for PD Search       Click here for Cross-React search
563       571 ATDEQLKTV       1.365       Click here for PD Search       Click here for Cross-React search
113       121 DCCEKQEPD       1.362       Click here for PD Search       Click here for Cross-React search
163       171 LYEIARRHP       1.353       Click here for PD Search       Click here for Cross-React search
371       379 LRLAKEYEA       1.352       Click here for PD Search       Click here for Cross-React search
20       28 GLVRREAYK       1.348       Click here for PD Search       Click here for Cross-React search
401       409 FKPLVDEPQ       1.343       Click here for PD Search       Click here for Cross-React search
400       408 EFKPLVDEP       1.343       Click here for PD Search       Click here for Cross-React search
520       528 TYVPKEFNA       1.338       Click here for PD Search       Click here for Cross-React search
564       572 TDEQLKTVM       1.337       Click here for PD Search       Click here for Cross-React search
19       27 RGLVRREAY       1.32       Click here for PD Search       Click here for Cross-React search
361       369 RHPEYSVSL       1.301       Click here for PD Search       Click here for Cross-React search
25       33 EAYKSEIAH       1.297       Click here for PD Search       Click here for Cross-React search
100       108 TVASLRDKY       1.297       Click here for PD Search       Click here for Cross-React search
166       174 IARRHPYFY       1.286       Click here for PD Search       Click here for Cross-React search
339       347 VCKNYQEAK       1.285       Click here for PD Search       Click here for Cross-React search
35       43 YNDLGEEHF       1.284       Click here for PD Search       Click here for Cross-React search
459       467 TKCCKKPES       1.259       Click here for PD Search       Click here for Cross-React search
387       395 TDDPPTCYA       1.247       Click here for PD Search       Click here for Cross-React search
386       394 ATDDPPTCY       1.247       Click here for PD Search       Click here for Cross-React search
131       139 DDNPGFPPL       1.24       Click here for PD Search       Click here for Cross-React search
80       88 EESGANCDK       1.224       Click here for PD Search       Click here for Cross-React search
216       224 SSAKERFKC       1.209       Click here for PD Search       Click here for Cross-React search
420       428 EKLGEYGFQ       1.204       Click here for PD Search       Click here for Cross-React search
352       360 GTFLYEYSR       1.204       Click here for PD Search       Click here for Cross-React search
68       76 KEVTEFAKA       1.201       Click here for PD Search       Click here for Cross-React search
67       75 AKEVTEFAK       1.201       Click here for PD Search       Click here for Cross-React search
30       38 EIAHRYNDL       1.2       Click here for PD Search       Click here for Cross-React search
405       413 VDEPQNLVK       1.197       Click here for PD Search       Click here for Cross-React search
330       338 AADFVEDKE       1.161       Click here for PD Search       Click here for Cross-React search
226       234 SLQKFGDRA       1.147       Click here for PD Search       Click here for Cross-React search
225       233 ASLQKFGDR       1.147       Click here for PD Search       Click here for Cross-React search
18       26 SRGLVRREA       1.129       Click here for PD Search       Click here for Cross-React search
413       421 KTNCELFEK       1.127       Click here for PD Search       Click here for Cross-React search
421       429 KLGEYGFQN       1.118       Click here for PD Search       Click here for Cross-React search
338       346 EVCKNYQEA       1.113       Click here for PD Search       Click here for Cross-React search
203       211 GPKIEALRE       1.111       Click here for PD Search       Click here for Cross-React search
376       384 EYEATLEKC       1.11       Click here for PD Search       Click here for Cross-React search
183       191 QQYKGVFAE       1.106       Click here for PD Search       Click here for Cross-React search
370       378 LLRLAKEYE       1.103       Click here for PD Search       Click here for Cross-React search
320       328 DELPGDLPS       1.102       Click here for PD Search       Click here for Cross-React search
538       546 CTLPEAEKQ       1.095       Click here for PD Search       Click here for Cross-React search
587       595 NKEGCFSEE       1.088       Click here for PD Search       Click here for Cross-React search
586       594 ENKEGCFSE       1.088       Click here for PD Search       Click here for Cross-React search
137       145 PPLVAPEPD       1.082       Click here for PD Search       Click here for Cross-React search
205       213 KIEALREKV       1.077       Click here for PD Search       Click here for Cross-React search
149       157 AAFQDNEQL       1.076       Click here for PD Search       Click here for Cross-React search
170       178 HPYFYAPEL       1.056       Click here for PD Search       Click here for Cross-React search
229       237 KFGDRAFKA       1.048       Click here for PD Search       Click here for Cross-React search
403       411 PLVDEPQNL       1.028       Click here for PD Search       Click here for Cross-React search
394       402 YAKVLDEFK       1.027       Click here for PD Search       Click here for Cross-React search
16       24 AYSRGLVRR       1.021       Click here for PD Search       Click here for Cross-React search
160       168 GKYLYEIAR       1.018       Click here for PD Search       Click here for Cross-React search
249       257 KADFAEISK       1.016       Click here for PD Search       Click here for Cross-React search
395       403 AKVLDEFKP       1.013       Click here for PD Search       Click here for Cross-React search
334       342 VEDKEVCKN       1.006       Click here for PD Search       Click here for Cross-React search
417       425 ELFEKLGEY       1.004       Click here for PD Search       Click here for Cross-React search
181       189 YAQQYKGVF       1.001       Click here for PD Search       Click here for Cross-React search
466       474 ESERMSCAD       0.999       Click here for PD Search       Click here for Cross-React search
373       381 LAKEYEATL       0.996       Click here for PD Search       Click here for Cross-React search
153       161 DNEQLFLGK       0.993       Click here for PD Search       Click here for Cross-React search
37       45 DLGEEHFRG       0.988       Click here for PD Search       Click here for Cross-React search
119       127 EPDRNECFL       0.988       Click here for PD Search       Click here for Cross-React search
65       73 KLAKEVTEF       0.981       Click here for PD Search       Click here for Cross-React search
445       453 PTLVEVSRK       0.975       Click here for PD Search       Click here for Cross-React search
513       521 SGLEVDETY       0.973       Click here for PD Search       Click here for Cross-React search
467       475 SERMSCADD       0.963       Click here for PD Search       Click here for Cross-React search
451       459 SRKLGKVGT       0.961       Click here for PD Search       Click here for Cross-React search
431       439 LLVRYTKKA       0.956       Click here for PD Search       Click here for Cross-React search
430       438 ALLVRYTKK       0.956       Click here for PD Search       Click here for Cross-React search
81       89 ESGANCDKS       0.947       Click here for PD Search       Click here for Cross-React search
548       556 KKQTALVEL       0.934       Click here for PD Search       Click here for Cross-React search
154       162 NEQLFLGKY       0.932       Click here for PD Search       Click here for Cross-React search
458       466 GTKCCKKPE       0.93       Click here for PD Search       Click here for Cross-React search
465       473 PESERMSCA       0.925       Click here for PD Search       Click here for Cross-React search
150       158 AFQDNEQLF       0.922       Click here for PD Search       Click here for Cross-React search
566       574 EQLKTVMGD       0.917       Click here for PD Search       Click here for Cross-React search
565       573 DEQLKTVMG       0.917       Click here for PD Search       Click here for Cross-React search
314       322 LAEVERDEL       0.917       Click here for PD Search       Click here for Cross-React search
218       226 AKERFKCAS       0.911       Click here for PD Search       Click here for Cross-React search
217       225 SAKERFKCA       0.911       Click here for PD Search       Click here for Cross-React search
259       267 VTDLTKVHK       0.91       Click here for PD Search       Click here for Cross-React search
298       306 KLKECCDKP       0.897       Click here for PD Search       Click here for Cross-React search
256       264 SKVVTDLTK       0.896       Click here for PD Search       Click here for Cross-React search
60       68 FEDHVKLAK       0.892       Click here for PD Search       Click here for Cross-React search
343       351 YQEAKDVFL       0.889       Click here for PD Search       Click here for Cross-React search
101       109 VASLRDKYG       0.889       Click here for PD Search       Click here for Cross-React search
53       61 QYLQQCPFE       0.883       Click here for PD Search       Click here for Cross-React search
449       457 EVSRKLGKV       0.865       Click here for PD Search       Click here for Cross-React search
448       456 VEVSRKLGK       0.865       Click here for PD Search       Click here for Cross-React search
305       313 KPVLEKSQC       0.863       Click here for PD Search       Click here for Cross-React search
152       160 QDNEQLFLG       0.86       Click here for PD Search       Click here for Cross-React search
331       339 ADFVEDKEV       0.853       Click here for PD Search       Click here for Cross-React search
231       239 GDRAFKAWS       0.853       Click here for PD Search       Click here for Cross-React search
54       62 YLQQCPFED       0.851       Click here for PD Search       Click here for Cross-React search
515       523 LEVDETYVP       0.842       Click here for PD Search       Click here for Cross-React search
64       72 VKLAKEVTE       0.841       Click here for PD Search       Click here for Cross-React search
547       555 VKKQTALVE       0.841       Click here for PD Search       Click here for Cross-React search
546       554 QVKKQTALV       0.841       Click here for PD Search       Click here for Cross-React search
297       305 TKLKECCDK       0.837       Click here for PD Search       Click here for Cross-React search
175       183 APELLYYAQ       0.836       Click here for PD Search       Click here for Cross-React search
303       311 CDKPVLEKS       0.832       Click here for PD Search       Click here for Cross-React search
289       297 CENQDSIST       0.83       Click here for PD Search       Click here for Cross-React search
396       404 KVLDEFKPL       0.827       Click here for PD Search       Click here for Cross-React search
112       120 ADCCEKQEP       0.824       Click here for PD Search       Click here for Cross-React search
238       246 WSVARLSQR       0.821       Click here for PD Search       Click here for Cross-React search
106       114 DKYGDMADC       0.819       Click here for PD Search       Click here for Cross-React search
593       601 SEEGPKLVA       0.805       Click here for PD Search       Click here for Cross-React search
261       269 DLTKVHKEC       0.788       Click here for PD Search       Click here for Cross-React search
248       256 PKADFAEIS       0.785       Click here for PD Search       Click here for Cross-React search
240       248 VARLSQRFP       0.78       Click here for PD Search       Click here for Cross-React search
409       417 QNLVKTNCE       0.777       Click here for PD Search       Click here for Cross-React search
57       65 QCPFEDHVK       0.768       Click here for PD Search       Click here for Cross-React search
503       511 ESLVNRRPC       0.768       Click here for PD Search       Click here for Cross-React search
429       437 NALLVRYTK       0.768       Click here for PD Search       Click here for Cross-React search
389       397 DPPTCYAKV       0.768       Click here for PD Search       Click here for Cross-React search
214       222 LLSSAKERF       0.767       Click here for PD Search       Click here for Cross-React search
62       70 DHVKLAKEV       0.764       Click here for PD Search       Click here for Cross-React search
439       447 APQVSTPTL       0.756       Click here for PD Search       Click here for Cross-React search
174       182 YAPELLYYA       0.756       Click here for PD Search       Click here for Cross-React search
276       284 ECADDRADL       0.754       Click here for PD Search       Click here for Cross-React search
275       283 LECADDRAD       0.754       Click here for PD Search       Click here for Cross-React search
151       159 FQDNEQLFL       0.753       Click here for PD Search       Click here for Cross-React search
221       229 RFKCASLQK       0.744       Click here for PD Search       Click here for Cross-React search
219       227 KERFKCASL       0.744       Click here for PD Search       Click here for Cross-React search
227       235 LQKFGDRAF       0.741       Click here for PD Search       Click here for Cross-React search
55       63 LQQCPFEDH       0.739       Click here for PD Search       Click here for Cross-React search
284       292 LAKYMCENQ       0.707       Click here for PD Search       Click here for Cross-React search
138       146 PLVAPEPDA       0.707       Click here for PD Search       Click here for Cross-React search
444       452 TPTLVEVSR       0.704       Click here for PD Search       Click here for Cross-React search
15       23 SAYSRGLVR       0.699       Click here for PD Search       Click here for Cross-React search
148       156 CAAFQDNEQ       0.699       Click here for PD Search       Click here for Cross-React search
525       533 EFNAETFTF       0.697       Click here for PD Search       Click here for Cross-React search
408       416 PQNLVKTNC       0.694       Click here for PD Search       Click here for Cross-React search
398       406 LDEFKPLVD       0.691       Click here for PD Search       Click here for Cross-React search
592       600 FSEEGPKLV       0.69       Click here for PD Search       Click here for Cross-React search
59       67 PFEDHVKLA       0.689       Click here for PD Search       Click here for Cross-React search
31       39 IAHRYNDLG       0.686       Click here for PD Search       Click here for Cross-React search
52       60 SQYLQQCPF       0.683       Click here for PD Search       Click here for Cross-React search
51       59 FSQYLQQCP       0.683       Click here for PD Search       Click here for Cross-React search
283       291 DLAKYMCEN       0.681       Click here for PD Search       Click here for Cross-React search
486       494 VLHEKTPVS       0.677       Click here for PD Search       Click here for Cross-React search
239       247 SVARLSQRF       0.676       Click here for PD Search       Click here for Cross-React search
212       220 KVLLSSAKE       0.671       Click here for PD Search       Click here for Cross-React search
211       219 EKVLLSSAK       0.671       Click here for PD Search       Click here for Cross-React search
588       596 KEGCFSEEG       0.669       Click here for PD Search       Click here for Cross-React search
84       92 ANCDKSLHT       0.668       Click here for PD Search       Click here for Cross-React search
501       509 CSESLVNRR       0.666       Click here for PD Search       Click here for Cross-React search
56       64 QQCPFEDHV       0.665       Click here for PD Search       Click here for Cross-React search
428       436 QNALLVRYT       0.665       Click here for PD Search       Click here for Cross-React search
287       295 YMCENQDSI       0.665       Click here for PD Search       Click here for Cross-React search
528       536 AETFTFHAD       0.664       Click here for PD Search       Click here for Cross-React search
382       390 EKCCATDDP       0.662       Click here for PD Search       Click here for Cross-React search
63       71 HVKLAKEVT       0.66       Click here for PD Search       Click here for Cross-React search
213       221 VLLSSAKER       0.657       Click here for PD Search       Click here for Cross-React search
210       218 REKVLLSSA       0.657       Click here for PD Search       Click here for Cross-React search
173       181 FYAPELLYY       0.648       Click here for PD Search       Click here for Cross-React search
172       180 YFYAPELLY       0.648       Click here for PD Search       Click here for Cross-React search
182       190 AQQYKGVFA       0.645       Click here for PD Search       Click here for Cross-React search
220       228 ERFKCASLQ       0.644       Click here for PD Search       Click here for Cross-React search
553       561 LVELLKHKP       0.642       Click here for PD Search       Click here for Cross-React search
232       240 DRAFKAWSV       0.64       Click here for PD Search       Click here for Cross-React search
171       179 PYFYAPELL       0.64       Click here for PD Search       Click here for Cross-React search
527       535 NAETFTFHA       0.639       Click here for PD Search       Click here for Cross-React search
585       593 AENKEGCFS       0.635       Click here for PD Search       Click here for Cross-React search
492       500 PVSERVTKC       0.634       Click here for PD Search       Click here for Cross-React search
468       476 ERMSCADDF       0.622       Click here for PD Search       Click here for Cross-React search
441       449 QVSTPTLVE       0.622       Click here for PD Search       Click here for Cross-React search
79       87 AEESGANCD       0.618       Click here for PD Search       Click here for Cross-React search
49       57 VAFSQYLQQ       0.618       Click here for PD Search       Click here for Cross-React search
273       281 DLLECADDR       0.616       Click here for PD Search       Click here for Cross-React search
594       602 EEGPKLVAA       0.607       Click here for PD Search       Click here for Cross-React search
122       130 RNECFLAHK       0.607       Click here for PD Search       Click here for Cross-React search
419       427 FEKLGEYGF       0.602       Click here for PD Search       Click here for Cross-React search
590       598 GCFSEEGPK       0.598       Click here for PD Search       Click here for Cross-React search
581       589 KCCAAENKE       0.598       Click here for PD Search       Click here for Cross-React search
580       588 EKCCAAENK       0.598       Click here for PD Search       Click here for Cross-React search
313       321 CLAEVERDE       0.596       Click here for PD Search       Click here for Cross-React search
312       320 QCLAEVERD       0.596       Click here for PD Search       Click here for Cross-React search
383       391 KCCATDDPP       0.591       Click here for PD Search       Click here for Cross-React search
294       302 SISTKLKEC       0.589       Click here for PD Search       Click here for Cross-React search
120       128 PDRNECFLA       0.576       Click here for PD Search       Click here for Cross-React search
418       426 LFEKLGEYG       0.573       Click here for PD Search       Click here for Cross-React search
288       296 MCENQDSIS       0.569       Click here for PD Search       Click here for Cross-React search
423       431 GEYGFQNAL       0.565       Click here for PD Search       Click here for Cross-React search
422       430 LGEYGFQNA       0.565       Click here for PD Search       Click here for Cross-React search
344       352 QEAKDVFLG       0.562       Click here for PD Search       Click here for Cross-React search
296       304 STKLKECCD       0.561       Click here for PD Search       Click here for Cross-React search
136       144 FPPLVAPEP       0.561       Click here for PD Search       Click here for Cross-React search
13       21 FSSAYSRGL       0.558       Click here for PD Search       Click here for Cross-React search
12       20 LFSSAYSRG       0.558       Click here for PD Search       Click here for Cross-React search
440       448 PQVSTPTLV       0.555       Click here for PD Search       Click here for Cross-React search
329       337 LAADFVEDK       0.553       Click here for PD Search       Click here for Cross-React search
508       516 RRPCFSGLE       0.552       Click here for PD Search       Click here for Cross-React search
230       238 FGDRAFKAW       0.551       Click here for PD Search       Click here for Cross-React search
132       140 DNPGFPPLV       0.551       Click here for PD Search       Click here for Cross-React search
526       534 FNAETFTFH       0.548       Click here for PD Search       Click here for Cross-React search
362       370 HPEYSVSLL       0.548       Click here for PD Search       Click here for Cross-React search
85       93 NCDKSLHTL       0.545       Click here for PD Search       Click here for Cross-React search
321       329 ELPGDLPSL       0.544       Click here for PD Search       Click here for Cross-React search
89       97 SLHTLFGDK       0.542       Click here for PD Search       Click here for Cross-React search
88       96 KSLHTLFGD       0.542       Click here for PD Search       Click here for Cross-React search
87       95 DKSLHTLFG       0.542       Click here for PD Search       Click here for Cross-React search
529       537 ETFTFHADL       0.542       Click here for PD Search       Click here for Cross-React search
333       341 FVEDKEVCK       0.542       Click here for PD Search       Click here for Cross-React search
308       316 LEKSQCLAE       0.542       Click here for PD Search       Click here for Cross-React search
514       522 GLEVDETYV       0.539       Click here for PD Search       Click here for Cross-React search
512       520 FSGLEVDET       0.538       Click here for PD Search       Click here for Cross-React search
124       132 ECFLAHKDD       0.538       Click here for PD Search       Click here for Cross-React search
209       217 LREKVLLSS       0.537       Click here for PD Search       Click here for Cross-React search
202       210 LGPKIEALR       0.529       Click here for PD Search       Click here for Cross-React search
111       119 MADCCEKQE       0.527       Click here for PD Search       Click here for Cross-React search
369       377 LLLRLAKEY       0.525       Click here for PD Search       Click here for Cross-React search
207       215 EALREKVLL       0.523       Click here for PD Search       Click here for Cross-React search
537       545 LCTLPEAEK       0.522       Click here for PD Search       Click here for Cross-React search
446       454 TLVEVSRKL       0.52       Click here for PD Search       Click here for Cross-React search
589       597 EGCFSEEGP       0.518       Click here for PD Search       Click here for Cross-React search
123       131 NECFLAHKD       0.518       Click here for PD Search       Click here for Cross-React search
456       464 KVGTKCCKK       0.515       Click here for PD Search       Click here for Cross-React search
495       503 ERVTKCCSE       0.513       Click here for PD Search       Click here for Cross-React search
507       515 NRRPCFSGL       0.512       Click here for PD Search       Click here for Cross-React search
247       255 FPKADFAEI       0.508       Click here for PD Search       Click here for Cross-React search
110       118 DMADCCEKQ       0.508       Click here for PD Search       Click here for Cross-React search
351       359 LGTFLYEYS       0.507       Click here for PD Search       Click here for Cross-React search
121       129 DRNECFLAH       0.507       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database