List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MQSIKRTLLLLGAILPAVLGAPVQETRRAAEKLPGKYIVTFKPGIDEAKIQEHTTWATNI
HQRSLERRGATGGDLPVGIERNYKINKFAAYAGSFDDATIEEIRKNEDVAYVEEDQIYYL
DGLTTQKSAPWGLGSISHKGQQSTDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAY
NAAGGQHVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGESSSTSVILDGFNWAAND
IVSKKRTSKAAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAGQTSPASAPDA
ITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSMATPHIVGLSL
YLAALENLDGPAAVTKRIKELATKDVVKDVKGSPNLLAYNGNA


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
24       32 QETRRAAEK       7.04       Click here for PD Search       Click here for Cross-React search
243       251 SKKRTSKAA       4.97       Click here for PD Search       Click here for Cross-React search
138       146 HKGQQSTDY       4.903       Click here for PD Search       Click here for Cross-React search
137       145 SHKGQQSTD       4.193       Click here for PD Search       Click here for Cross-React search
61       69 HQRSLERRG       4.022       Click here for PD Search       Click here for Cross-React search
80       88 ERNYKINKF       4.002       Click here for PD Search       Click here for Cross-React search
242       250 VSKKRTSKA       3.651       Click here for PD Search       Click here for Cross-React search
101       109 EEIRKNEDV       3.41       Click here for PD Search       Click here for Cross-React search
25       33 ETRRAAEKL       3.352       Click here for PD Search       Click here for Cross-React search
141       149 QQSTDYIYD       3.339       Click here for PD Search       Click here for Cross-React search
307       315 QKSNNRASF       3.305       Click here for PD Search       Click here for Cross-React search
79       87 IERNYKINK       3.24       Click here for PD Search       Click here for Cross-React search
100       108 IEEIRKNED       3.22       Click here for PD Search       Click here for Cross-React search
284       292 NENSDAGQT       3.004       Click here for PD Search       Click here for Cross-React search
26       34 TRRAAEKLP       2.993       Click here for PD Search       Click here for Cross-React search
62       70 QRSLERRGA       2.986       Click here for PD Search       Click here for Cross-React search
46       54 DEAKIQEHT       2.893       Click here for PD Search       Click here for Cross-React search
60       68 IHQRSLERR       2.849       Click here for PD Search       Click here for Cross-React search
170       178 EEFEGRASK       2.831       Click here for PD Search       Click here for Cross-React search
142       150 QSTDYIYDT       2.783       Click here for PD Search       Click here for Cross-React search
99       107 TIEEIRKNE       2.783       Click here for PD Search       Click here for Cross-React search
173       181 EGRASKAYN       2.775       Click here for PD Search       Click here for Cross-React search
376       384 KRIKELATK       2.743       Click here for PD Search       Click here for Cross-React search
306       314 IQKSNNRAS       2.676       Click here for PD Search       Click here for Cross-React search
23       31 VQETRRAAE       2.613       Click here for PD Search       Click here for Cross-React search
244       252 KKRTSKAAI       2.6       Click here for PD Search       Click here for Cross-React search
308       316 KSNNRASFS       2.558       Click here for PD Search       Click here for Cross-React search
239       247 NDIVSKKRT       2.539       Click here for PD Search       Click here for Cross-React search
241       249 IVSKKRTSK       2.534       Click here for PD Search       Click here for Cross-React search
139       147 KGQQSTDYI       2.526       Click here for PD Search       Click here for Cross-React search
51       59 QEHTTWATN       2.513       Click here for PD Search       Click here for Cross-React search
285       293 ENSDAGQTS       2.503       Click here for PD Search       Click here for Cross-React search
47       55 EAKIQEHTT       2.5       Click here for PD Search       Click here for Cross-React search
63       71 RSLERRGAT       2.489       Click here for PD Search       Click here for Cross-React search
113       121 EEDQIYYLD       2.466       Click here for PD Search       Click here for Cross-React search
168       176 DHEEFEGRA       2.4       Click here for PD Search       Click here for Cross-React search
59       67 NIHQRSLER       2.339       Click here for PD Search       Click here for Cross-React search
81       89 RNYKINKFA       2.334       Click here for PD Search       Click here for Cross-React search
22       30 PVQETRRAA       2.333       Click here for PD Search       Click here for Cross-React search
21       29 APVQETRRA       2.333       Click here for PD Search       Click here for Cross-React search
377       385 RIKELATKD       2.29       Click here for PD Search       Click here for Cross-React search
20       28 GAPVQETRR       2.285       Click here for PD Search       Click here for Cross-React search
286       294 NSDAGQTSP       2.235       Click here for PD Search       Click here for Cross-React search
291       299 QTSPASAPD       2.194       Click here for PD Search       Click here for Cross-React search
143       151 STDYIYDTS       2.153       Click here for PD Search       Click here for Cross-React search
240       248 DIVSKKRTS       2.116       Click here for PD Search       Click here for Cross-React search
28       36 RAAEKLPGK       2.096       Click here for PD Search       Click here for Cross-React search
245       253 KRTSKAAIN       2.09       Click here for PD Search       Click here for Cross-React search
111       119 YVEEDQIYY       2.082       Click here for PD Search       Click here for Cross-React search
283       291 GNENSDAGQ       2.06       Click here for PD Search       Click here for Cross-React search
309       317 SNNRASFSN       2.057       Click here for PD Search       Click here for Cross-React search
27       35 RRAAEKLPG       2.052       Click here for PD Search       Click here for Cross-React search
305       313 AIQKSNNRA       2.017       Click here for PD Search       Click here for Cross-React search
304       312 AAIQKSNNR       2.017       Click here for PD Search       Click here for Cross-React search
102       110 EIRKNEDVA       1.989       Click here for PD Search       Click here for Cross-React search
375       383 TKRIKELAT       1.979       Click here for PD Search       Click here for Cross-React search
140       148 GQQSTDYIY       1.979       Click here for PD Search       Click here for Cross-React search
169       177 HEEFEGRAS       1.926       Click here for PD Search       Click here for Cross-React search
104       112 RKNEDVAYV       1.905       Click here for PD Search       Click here for Cross-React search
124       132 TTQKSAPWG       1.885       Click here for PD Search       Click here for Cross-React search
66       74 ERRGATGGD       1.88       Click here for PD Search       Click here for Cross-React search
103       111 IRKNEDVAY       1.799       Click here for PD Search       Click here for Cross-React search
238       246 ANDIVSKKR       1.777       Click here for PD Search       Click here for Cross-React search
167       175 VDHEEFEGR       1.764       Click here for PD Search       Click here for Cross-React search
136       144 ISHKGQQST       1.76       Click here for PD Search       Click here for Cross-React search
58       66 TNIHQRSLE       1.724       Click here for PD Search       Click here for Cross-React search
97       105 DATIEEIRK       1.686       Click here for PD Search       Click here for Cross-React search
105       113 KNEDVAYVE       1.685       Click here for PD Search       Click here for Cross-React search
29       37 AAEKLPGKY       1.676       Click here for PD Search       Click here for Cross-React search
175       183 RASKAYNAA       1.652       Click here for PD Search       Click here for Cross-React search
171       179 EFEGRASKA       1.651       Click here for PD Search       Click here for Cross-React search
135       143 SISHKGQQS       1.634       Click here for PD Search       Click here for Cross-React search
76       84 PVGIERNYK       1.632       Click here for PD Search       Click here for Cross-React search
144       152 TDYIYDTSA       1.623       Click here for PD Search       Click here for Cross-React search
98       106 ATIEEIRKN       1.623       Click here for PD Search       Click here for Cross-React search
174       182 GRASKAYNA       1.619       Click here for PD Search       Click here for Cross-React search
388       396 KDVKGSPNL       1.617       Click here for PD Search       Click here for Cross-React search
78       86 GIERNYKIN       1.603       Click here for PD Search       Click here for Cross-React search
121       129 DGLTTQKSA       1.596       Click here for PD Search       Click here for Cross-React search
383       391 TKDVVKDVK       1.579       Click here for PD Search       Click here for Cross-React search
123       131 LTTQKSAPW       1.571       Click here for PD Search       Click here for Cross-React search
204       212 KTYGIAKKA       1.536       Click here for PD Search       Click here for Cross-React search
119       127 YLDGLTTQK       1.524       Click here for PD Search       Click here for Cross-React search
49       57 KIQEHTTWA       1.518       Click here for PD Search       Click here for Cross-React search
48       56 AKIQEHTTW       1.518       Click here for PD Search       Click here for Cross-React search
108       116 DVAYVEEDQ       1.515       Click here for PD Search       Click here for Cross-React search
107       115 EDVAYVEED       1.515       Click here for PD Search       Click here for Cross-React search
203       211 GKTYGIAKK       1.504       Click here for PD Search       Click here for Cross-React search
149       157 DTSAGEGTY       1.501       Click here for PD Search       Click here for Cross-React search
148       156 YDTSAGEGT       1.501       Click here for PD Search       Click here for Cross-React search
172       180 FEGRASKAY       1.494       Click here for PD Search       Click here for Cross-React search
122       130 GLTTQKSAP       1.478       Click here for PD Search       Click here for Cross-React search
106       114 NEDVAYVEE       1.459       Click here for PD Search       Click here for Cross-React search
387       395 VKDVKGSPN       1.455       Click here for PD Search       Click here for Cross-React search
166       174 NVDHEEFEG       1.448       Click here for PD Search       Click here for Cross-React search
220       228 FQGESSSTS       1.435       Click here for PD Search       Click here for Cross-React search
114       122 EDQIYYLDG       1.409       Click here for PD Search       Click here for Cross-React search
96       104 DDATIEEIR       1.408       Click here for PD Search       Click here for Cross-React search
45       53 IDEAKIQEH       1.405       Click here for PD Search       Click here for Cross-React search
288       296 DAGQTSPAS       1.404       Click here for PD Search       Click here for Cross-React search
287       295 SDAGQTSPA       1.404       Click here for PD Search       Click here for Cross-React search
55       63 TWATNIHQR       1.381       Click here for PD Search       Click here for Cross-React search
110       118 AYVEEDQIY       1.343       Click here for PD Search       Click here for Cross-React search
310       318 NNRASFSNF       1.329       Click here for PD Search       Click here for Cross-React search
369       377 DGPAAVTKR       1.312       Click here for PD Search       Click here for Cross-React search
120       128 LDGLTTQKS       1.303       Click here for PD Search       Click here for Cross-React search
41       49 FKPGIDEAK       1.302       Click here for PD Search       Click here for Cross-React search
290       298 GQTSPASAP       1.3       Click here for PD Search       Click here for Cross-React search
56       64 WATNIHQRS       1.282       Click here for PD Search       Click here for Cross-React search
292       300 TSPASAPDA       1.28       Click here for PD Search       Click here for Cross-React search
64       72 SLERRGATG       1.257       Click here for PD Search       Click here for Cross-React search
372       380 AAVTKRIKE       1.247       Click here for PD Search       Click here for Cross-React search
221       229 QGESSSTSV       1.23       Click here for PD Search       Click here for Cross-React search
281       289 AAGNENSDA       1.227       Click here for PD Search       Click here for Cross-React search
134       142 GSISHKGQQ       1.207       Click here for PD Search       Click here for Cross-React search
82       90 NYKINKFAA       1.204       Click here for PD Search       Click here for Cross-React search
282       290 AGNENSDAG       1.202       Click here for PD Search       Click here for Cross-React search
118       126 YYLDGLTTQ       1.194       Click here for PD Search       Click here for Cross-React search
94       102 SFDDATIEE       1.19       Click here for PD Search       Click here for Cross-React search
259       267 GYSKAFNDA       1.183       Click here for PD Search       Click here for Cross-React search
262       270 KAFNDAVEN       1.177       Click here for PD Search       Click here for Cross-React search
83       91 YKINKFAAY       1.173       Click here for PD Search       Click here for Cross-React search
30       38 AEKLPGKYI       1.163       Click here for PD Search       Click here for Cross-React search
258       266 GGYSKAFND       1.159       Click here for PD Search       Click here for Cross-React search
146       154 YIYDTSAGE       1.154       Click here for PD Search       Click here for Cross-React search
371       379 PAAVTKRIK       1.113       Click here for PD Search       Click here for Cross-React search
145       153 DYIYDTSAG       1.113       Click here for PD Search       Click here for Cross-React search
218       226 KVFQGESSS       1.101       Click here for PD Search       Click here for Cross-React search
266       274 DAVENAFEQ       1.097       Click here for PD Search       Click here for Cross-React search
50       58 IQEHTTWAT       1.096       Click here for PD Search       Click here for Cross-React search
112       120 VEEDQIYYL       1.096       Click here for PD Search       Click here for Cross-React search
165       173 VNVDHEEFE       1.086       Click here for PD Search       Click here for Cross-React search
384       392 KDVVKDVKG       1.083       Click here for PD Search       Click here for Cross-React search
125       133 TQKSAPWGL       1.077       Click here for PD Search       Click here for Cross-React search
178       186 KAYNAAGGQ       1.057       Click here for PD Search       Click here for Cross-React search
42       50 KPGIDEAKI       1.054       Click here for PD Search       Click here for Cross-React search
246       254 RTSKAAINM       1.034       Click here for PD Search       Click here for Cross-React search
205       213 TYGIAKKAS       1.029       Click here for PD Search       Click here for Cross-React search
44       52 GIDEAKIQE       1.022       Click here for PD Search       Click here for Cross-React search
265       273 NDAVENAFE       1.019       Click here for PD Search       Click here for Cross-React search
374       382 VTKRIKELA       1.018       Click here for PD Search       Click here for Cross-React search
373       381 AVTKRIKEL       1.018       Click here for PD Search       Click here for Cross-React search
54       62 TTWATNIHQ       1.017       Click here for PD Search       Click here for Cross-React search
52       60 EHTTWATNI       1.017       Click here for PD Search       Click here for Cross-React search
312       320 RASFSNFGK       1.017       Click here for PD Search       Click here for Cross-React search
57       65 ATNIHQRSL       1.006       Click here for PD Search       Click here for Cross-React search
151       159 SAGEGTYAY       0.986       Click here for PD Search       Click here for Cross-React search
261       269 SKAFNDAVE       0.981       Click here for PD Search       Click here for Cross-React search
19       27 LGAPVQETR       0.962       Click here for PD Search       Click here for Cross-React search
163       171 SGVNVDHEE       0.96       Click here for PD Search       Click here for Cross-React search
40       48 TFKPGIDEA       0.939       Click here for PD Search       Click here for Cross-React search
346       354 SGTSMATPH       0.934       Click here for PD Search       Click here for Cross-React search
65       73 LERRGATGG       0.929       Click here for PD Search       Click here for Cross-React search
162       170 DSGVNVDHE       0.926       Click here for PD Search       Click here for Cross-React search
380       388 ELATKDVVK       0.919       Click here for PD Search       Click here for Cross-React search
379       387 KELATKDVV       0.919       Click here for PD Search       Click here for Cross-React search
338       346 SSSATNTIS       0.918       Click here for PD Search       Click here for Cross-React search
237       245 AANDIVSKK       0.917       Click here for PD Search       Click here for Cross-React search
43       51 PGIDEAKIQ       0.913       Click here for PD Search       Click here for Cross-React search
150       158 TSAGEGTYA       0.908       Click here for PD Search       Click here for Cross-React search
280       288 VAAGNENSD       0.901       Click here for PD Search       Click here for Cross-React search
67       75 RRGATGGDL       0.895       Click here for PD Search       Click here for Cross-React search
260       268 YSKAFNDAV       0.887       Click here for PD Search       Click here for Cross-React search
91       99 YAGSFDDAT       0.886       Click here for PD Search       Click here for Cross-React search
381       389 LATKDVVKD       0.886       Click here for PD Search       Click here for Cross-React search
378       386 IKELATKDV       0.868       Click here for PD Search       Click here for Cross-React search
31       39 EKLPGKYIV       0.855       Click here for PD Search       Click here for Cross-React search
391       399 KGSPNLLAY       0.852       Click here for PD Search       Click here for Cross-React search
289       297 AGQTSPASA       0.849       Click here for PD Search       Click here for Cross-React search
176       184 ASKAYNAAG       0.835       Click here for PD Search       Click here for Cross-React search
394       402 PNLLAYNGN       0.822       Click here for PD Search       Click here for Cross-React search
311       319 NRASFSNFG       0.818       Click here for PD Search       Click here for Cross-React search
177       185 SKAYNAAGG       0.818       Click here for PD Search       Click here for Cross-React search
53       61 HTTWATNIH       0.799       Click here for PD Search       Click here for Cross-React search
382       390 ATKDVVKDV       0.797       Click here for PD Search       Click here for Cross-React search
232       240 DGFNWAAND       0.795       Click here for PD Search       Click here for Cross-React search
219       227 VFQGESSST       0.795       Click here for PD Search       Click here for Cross-React search
303       311 VAAIQKSNN       0.764       Click here for PD Search       Click here for Cross-React search
202       210 AGKTYGIAK       0.76       Click here for PD Search       Click here for Cross-React search
84       92 KINKFAAYA       0.756       Click here for PD Search       Click here for Cross-React search
36       44 KYIVTFKPG       0.748       Click here for PD Search       Click here for Cross-React search
35       43 GKYIVTFKP       0.748       Click here for PD Search       Click here for Cross-React search
34       42 PGKYIVTFK       0.748       Click here for PD Search       Click here for Cross-React search
210       218 KKASILSVK       0.747       Click here for PD Search       Click here for Cross-React search
1       9 MQSIKRTLL       0.742       Click here for PD Search       Click here for Cross-React search
77       85 VGIERNYKI       0.74       Click here for PD Search       Click here for Cross-React search
126       134 QKSAPWGLG       0.738       Click here for PD Search       Click here for Cross-React search
341       349 ATNTISGTS       0.73       Click here for PD Search       Click here for Cross-React search
340       348 SATNTISGT       0.73       Click here for PD Search       Click here for Cross-React search
147       155 IYDTSAGEG       0.729       Click here for PD Search       Click here for Cross-React search
198       206 SGTIAGKTY       0.728       Click here for PD Search       Click here for Cross-React search
385       393 DVVKDVKGS       0.725       Click here for PD Search       Click here for Cross-React search
179       187 AYNAAGGQH       0.719       Click here for PD Search       Click here for Cross-React search
74       82 DLPVGIERN       0.717       Click here for PD Search       Click here for Cross-React search
86       94 NKFAAYAGS       0.716       Click here for PD Search       Click here for Cross-React search
342       350 TNTISGTSM       0.715       Click here for PD Search       Click here for Cross-React search
32       40 KLPGKYIVT       0.712       Click here for PD Search       Click here for Cross-React search
247       255 TSKAAINMS       0.708       Click here for PD Search       Click here for Cross-React search
68       76 RGATGGDLP       0.707       Click here for PD Search       Click here for Cross-React search
39       47 VTFKPGIDE       0.69       Click here for PD Search       Click here for Cross-React search
257       265 GGGYSKAFN       0.687       Click here for PD Search       Click here for Cross-React search
302       310 TVAAIQKSN       0.686       Click here for PD Search       Click here for Cross-React search
393       401 SPNLLAYNG       0.685       Click here for PD Search       Click here for Cross-React search
392       400 GSPNLLAYN       0.685       Click here for PD Search       Click here for Cross-React search
93       101 GSFDDATIE       0.68       Click here for PD Search       Click here for Cross-React search
339       347 SSATNTISG       0.678       Click here for PD Search       Click here for Cross-React search
337       345 GSSSATNTI       0.678       Click here for PD Search       Click here for Cross-React search
336       344 IGSSSATNT       0.678       Click here for PD Search       Click here for Cross-React search
154       162 EGTYAYVVD       0.677       Click here for PD Search       Click here for Cross-React search
75       83 LPVGIERNY       0.673       Click here for PD Search       Click here for Cross-React search
386       394 VVKDVKGSP       0.672       Click here for PD Search       Click here for Cross-React search
115       123 DQIYYLDGL       0.671       Click here for PD Search       Click here for Cross-React search
294       302 PASAPDAIT       0.669       Click here for PD Search       Click here for Cross-React search
389       397 DVKGSPNLL       0.667       Click here for PD Search       Click here for Cross-React search
267       275 AVENAFEQG       0.65       Click here for PD Search       Click here for Cross-React search
109       117 VAYVEEDQI       0.636       Click here for PD Search       Click here for Cross-React search
95       103 FDDATIEEI       0.622       Click here for PD Search       Click here for Cross-React search
293       301 SPASAPDAI       0.622       Click here for PD Search       Click here for Cross-React search
90       98 AYAGSFDDA       0.621       Click here for PD Search       Click here for Cross-React search
89       97 AAYAGSFDD       0.621       Click here for PD Search       Click here for Cross-React search
164       172 GVNVDHEEF       0.621       Click here for PD Search       Click here for Cross-React search
2       10 QSIKRTLLL       0.619       Click here for PD Search       Click here for Cross-React search
217       225 VKVFQGESS       0.61       Click here for PD Search       Click here for Cross-React search
216       224 SVKVFQGES       0.61       Click here for PD Search       Click here for Cross-React search
263       271 AFNDAVENA       0.594       Click here for PD Search       Click here for Cross-React search
365       373 LENLDGPAA       0.592       Click here for PD Search       Click here for Cross-React search
364       372 ALENLDGPA       0.592       Click here for PD Search       Click here for Cross-React search
363       371 AALENLDGP       0.592       Click here for PD Search       Click here for Cross-React search
116       124 QIYYLDGLT       0.58       Click here for PD Search       Click here for Cross-React search
133       141 LGSISHKGQ       0.575       Click here for PD Search       Click here for Cross-React search
127       135 KSAPWGLGS       0.571       Click here for PD Search       Click here for Cross-React search
181       189 NAAGGQHVD       0.563       Click here for PD Search       Click here for Cross-React search
368       376 LDGPAAVTK       0.553       Click here for PD Search       Click here for Cross-React search
370       378 GPAAVTKRI       0.551       Click here for PD Search       Click here for Cross-React search
152       160 AGEGTYAYV       0.546       Click here for PD Search       Click here for Cross-React search
255       263 SLGGGYSKA       0.545       Click here for PD Search       Click here for Cross-React search
395       403 NLLAYNGNA       0.537       Click here for PD Search       Click here for Cross-React search
199       207 GTIAGKTYG       0.537       Click here for PD Search       Click here for Cross-React search
254       262 MSLGGGYSK       0.534       Click here for PD Search       Click here for Cross-React search
366       374 ENLDGPAAV       0.533       Click here for PD Search       Click here for Cross-React search
269       277 ENAFEQGVL       0.531       Click here for PD Search       Click here for Cross-React search
180       188 YNAAGGQHV       0.528       Click here for PD Search       Click here for Cross-React search
156       164 TYAYVVDSG       0.524       Click here for PD Search       Click here for Cross-React search
155       163 GTYAYVVDS       0.524       Click here for PD Search       Click here for Cross-React search
264       272 FNDAVENAF       0.51       Click here for PD Search       Click here for Cross-React search
361       369 YLAALENLD       0.5       Click here for PD Search       Click here for Cross-React search
343       351 NTISGTSMA       0.5       Click here for PD Search       Click here for Cross-React search
206       214 YGIAKKASI       0.5       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database