List of B-cell epitopes predicted by BepiPred method ( using a window size of 9 amino acids)

>Input Sequence

MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGTGDDSFNTFFSETGSGK
HVPRAVYVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLSDQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLTVSEITNTCFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPP
TVVQVVIWLKYNVLFVCCPTLLPSLKLGLDWIINLI


Start Position       End Position       Peptide       Score       PD Search in SDAP       Cross-Reactivity Prediction
221       229 RPTYTNLNR       6.114       Click here for PD Search       Click here for Cross-React search
160       168 DYGKKSKLE       5.871       Click here for PD Search       Click here for Cross-React search
220       228 ERPTYTNLN       5.406       Click here for PD Search       Click here for Cross-React search
218       226 DIERPTYTN       4.772       Click here for PD Search       Click here for Cross-React search
214       222 RRNLDIERP       4.626       Click here for PD Search       Click here for Cross-React search
32       40 PDGQMPSDK       4.489       Click here for PD Search       Click here for Cross-React search
277       285 SAEKAYHEQ       4.486       Click here for PD Search       Click here for Cross-React search
120       128 DRIRKLSDQ       4.251       Click here for PD Search       Click here for Cross-React search
33       41 DGQMPSDKT       4.189       Click here for PD Search       Click here for Cross-React search
158       166 SVDYGKKSK       4.088       Click here for PD Search       Click here for Cross-React search
77       85 EVRTGTYRQ       4.084       Click here for PD Search       Click here for Cross-React search
279       287 EKAYHEQLT       3.944       Click here for PD Search       Click here for Cross-React search
76       84 DEVRTGTYR       3.939       Click here for PD Search       Click here for Cross-React search
31       39 QPDGQMPSD       3.887       Click here for PD Search       Click here for Cross-React search
101       109 NNYARGHYT       3.616       Click here for PD Search       Click here for Cross-React search
96       104 KEDAANNYA       3.579       Click here for PD Search       Click here for Cross-React search
83       91 YRQLFHPEQ       3.547       Click here for PD Search       Click here for Cross-React search
95       103 GKEDAANNY       3.505       Click here for PD Search       Click here for Cross-React search
97       105 EDAANNYAR       3.505       Click here for PD Search       Click here for Cross-React search
215       223 RNLDIERPT       3.409       Click here for PD Search       Click here for Cross-React search
304       312 KCDPRHGKY       3.388       Click here for PD Search       Click here for Cross-React search
94       102 TGKEDAANN       3.229       Click here for PD Search       Click here for Cross-React search
306       314 DPRHGKYMA       3.16       Click here for PD Search       Click here for Cross-React search
161       169 YGKKSKLEF       3.044       Click here for PD Search       Click here for Cross-React search
82       90 TYRQLFHPE       2.956       Click here for PD Search       Click here for Cross-React search
278       286 AEKAYHEQL       2.761       Click here for PD Search       Click here for Cross-React search
216       224 NLDIERPTY       2.727       Click here for PD Search       Click here for Cross-React search
256       264 QTNLVPYPR       2.673       Click here for PD Search       Click here for Cross-React search
191       199 THTTLEHSD       2.634       Click here for PD Search       Click here for Cross-React search
222       230 PTYTNLNRL       2.574       Click here for PD Search       Click here for Cross-React search
334       342 SIKTKRSIQ       2.559       Click here for PD Search       Click here for Cross-React search
100       108 ANNYARGHY       2.531       Click here for PD Search       Click here for Cross-React search
159       167 VDYGKKSKL       2.516       Click here for PD Search       Click here for Cross-React search
156       164 RLSVDYGKK       2.464       Click here for PD Search       Click here for Cross-React search
217       225 LDIERPTYT       2.447       Click here for PD Search       Click here for Cross-React search
219       227 IERPTYTNL       2.357       Click here for PD Search       Click here for Cross-React search
190       198 TTHTTLEHS       2.277       Click here for PD Search       Click here for Cross-React search
79       87 RTGTYRQLF       2.269       Click here for PD Search       Click here for Cross-React search
319       327 YRGDVVPKD       2.137       Click here for PD Search       Click here for Cross-React search
155       163 ERLSVDYGK       2.134       Click here for PD Search       Click here for Cross-React search
356       364 NYQPPTVVQ       2.127       Click here for PD Search       Click here for Cross-React search
105       113 RGHYTIGKE       2.122       Click here for PD Search       Click here for Cross-React search
90       98 EQLITGKED       2.121       Click here for PD Search       Click here for Cross-React search
119       127 LDRIRKLSD       2.024       Click here for PD Search       Click here for Cross-React search
98       106 DAANNYARG       2.003       Click here for PD Search       Click here for Cross-React search
39       47 DKTIGTGDD       1.972       Click here for PD Search       Click here for Cross-React search
89       97 PEQLITGKE       1.964       Click here for PD Search       Click here for Cross-React search
162       170 GKKSKLEFA       1.963       Click here for PD Search       Click here for Cross-React search
78       86 VRTGTYRQL       1.945       Click here for PD Search       Click here for Cross-React search
282       290 YHEQLTVSE       1.942       Click here for PD Search       Click here for Cross-React search
84       92 RQLFHPEQL       1.867       Click here for PD Search       Click here for Cross-React search
27       35 EHGIQPDGQ       1.856       Click here for PD Search       Click here for Cross-React search
276       284 ISAEKAYHE       1.816       Click here for PD Search       Click here for Cross-React search
35       43 QMPSDKTIG       1.759       Click here for PD Search       Click here for Cross-React search
34       42 GQMPSDKTI       1.759       Click here for PD Search       Click here for Cross-React search
336       344 KTKRSIQFV       1.751       Click here for PD Search       Click here for Cross-React search
56       64 TGSGKHVPR       1.716       Click here for PD Search       Click here for Cross-React search
280       288 KAYHEQLTV       1.69       Click here for PD Search       Click here for Cross-React search
81       89 GTYRQLFHP       1.689       Click here for PD Search       Click here for Cross-React search
157       165 LSVDYGKKS       1.686       Click here for PD Search       Click here for Cross-React search
305       313 CDPRHGKYM       1.677       Click here for PD Search       Click here for Cross-React search
335       343 IKTKRSIQF       1.653       Click here for PD Search       Click here for Cross-React search
300       308 NQMVKCDPR       1.643       Click here for PD Search       Click here for Cross-React search
30       38 IQPDGQMPS       1.632       Click here for PD Search       Click here for Cross-React search
99       107 AANNYARGH       1.632       Click here for PD Search       Click here for Cross-React search
183       191 EPYNSILTT       1.612       Click here for PD Search       Click here for Cross-React search
303       311 VKCDPRHGK       1.605       Click here for PD Search       Click here for Cross-React search
213       221 CRRNLDIER       1.604       Click here for PD Search       Click here for Cross-React search
352       360 KVGINYQPP       1.591       Click here for PD Search       Click here for Cross-React search
40       48 KTIGTGDDS       1.583       Click here for PD Search       Click here for Cross-React search
38       46 SDKTIGTGD       1.583       Click here for PD Search       Click here for Cross-React search
80       88 TGTYRQLFH       1.576       Click here for PD Search       Click here for Cross-React search
102       110 NYARGHYTI       1.576       Click here for PD Search       Click here for Cross-React search
43       51 GTGDDSFNT       1.572       Click here for PD Search       Click here for Cross-React search
88       96 HPEQLITGK       1.543       Click here for PD Search       Click here for Cross-React search
53       61 FSETGSGKH       1.534       Click here for PD Search       Click here for Cross-React search
55       63 ETGSGKHVP       1.517       Click here for PD Search       Click here for Cross-React search
75       83 VDEVRTGTY       1.493       Click here for PD Search       Click here for Cross-React search
333       341 ASIKTKRSI       1.493       Click here for PD Search       Click here for Cross-React search
332       340 IASIKTKRS       1.493       Click here for PD Search       Click here for Cross-React search
163       171 KKSKLEFAV       1.472       Click here for PD Search       Click here for Cross-React search
37       45 PSDKTIGTG       1.465       Click here for PD Search       Click here for Cross-React search
36       44 MPSDKTIGT       1.465       Click here for PD Search       Click here for Cross-React search
251       259 DLTEFQTNL       1.463       Click here for PD Search       Click here for Cross-React search
337       345 TKRSIQFVD       1.462       Click here for PD Search       Click here for Cross-React search
296       304 FEPANQMVK       1.419       Click here for PD Search       Click here for Cross-React search
123       131 RKLSDQCTG       1.419       Click here for PD Search       Click here for Cross-React search
172       180 YPAPQVSTA       1.408       Click here for PD Search       Click here for Cross-React search
93       101 ITGKEDAAN       1.407       Click here for PD Search       Click here for Cross-React search
189       197 LTTHTTLEH       1.401       Click here for PD Search       Click here for Cross-React search
301       309 QMVKCDPRH       1.39       Click here for PD Search       Click here for Cross-React search
44       52 TGDDSFNTF       1.376       Click here for PD Search       Click here for Cross-React search
121       129 RIRKLSDQC       1.365       Click here for PD Search       Click here for Cross-React search
71       79 EPTVVDEVR       1.326       Click here for PD Search       Click here for Cross-React search
254       262 EFQTNLVPY       1.324       Click here for PD Search       Click here for Cross-React search
250       258 VDLTEFQTN       1.317       Click here for PD Search       Click here for Cross-React search
249       257 NVDLTEFQT       1.317       Click here for PD Search       Click here for Cross-React search
54       62 SETGSGKHV       1.315       Click here for PD Search       Click here for Cross-React search
184       192 PYNSILTTH       1.267       Click here for PD Search       Click here for Cross-React search
69       77 DLEPTVVDE       1.256       Click here for PD Search       Click here for Cross-React search
104       112 ARGHYTIGK       1.238       Click here for PD Search       Click here for Cross-React search
91       99 QLITGKEDA       1.237       Click here for PD Search       Click here for Cross-React search
210       218 YDICRRNLD       1.237       Click here for PD Search       Click here for Cross-React search
253       261 TEFQTNLVP       1.219       Click here for PD Search       Click here for Cross-React search
29       37 GIQPDGQMP       1.205       Click here for PD Search       Click here for Cross-React search
293       301 NTCFEPANQ       1.202       Click here for PD Search       Click here for Cross-React search
57       65 GSGKHVPRA       1.201       Click here for PD Search       Click here for Cross-React search
255       263 FQTNLVPYP       1.182       Click here for PD Search       Click here for Cross-React search
185       193 YNSILTTHT       1.182       Click here for PD Search       Click here for Cross-React search
223       231 TYTNLNRLI       1.167       Click here for PD Search       Click here for Cross-React search
47       55 DSFNTFFSE       1.159       Click here for PD Search       Click here for Cross-React search
164       172 KSKLEFAVY       1.153       Click here for PD Search       Click here for Cross-React search
354       362 GINYQPPTV       1.148       Click here for PD Search       Click here for Cross-React search
353       361 VGINYQPPT       1.148       Click here for PD Search       Click here for Cross-React search
50       58 NTFFSETGS       1.145       Click here for PD Search       Click here for Cross-React search
261       269 PYPRIHFPL       1.145       Click here for PD Search       Click here for Cross-React search
281       289 AYHEQLTVS       1.133       Click here for PD Search       Click here for Cross-React search
331       339 AIASIKTKR       1.125       Click here for PD Search       Click here for Cross-React search
116       124 DLVLDRIRK       1.121       Click here for PD Search       Click here for Cross-React search
46       54 DDSFNTFFS       1.118       Click here for PD Search       Click here for Cross-React search
72       80 PTVVDEVRT       1.105       Click here for PD Search       Click here for Cross-React search
168       176 EFAVYPAPQ       1.091       Click here for PD Search       Click here for Cross-React search
186       194 NSILTTHTT       1.089       Click here for PD Search       Click here for Cross-React search
257       265 TNLVPYPRI       1.082       Click here for PD Search       Click here for Cross-React search
179       187 TAVVEPYNS       1.076       Click here for PD Search       Click here for Cross-React search
178       186 STAVVEPYN       1.076       Click here for PD Search       Click here for Cross-React search
338       346 KRSIQFVDW       1.065       Click here for PD Search       Click here for Cross-React search
28       36 HGIQPDGQM       1.06       Click here for PD Search       Click here for Cross-React search
154       162 MERLSVDYG       1.056       Click here for PD Search       Click here for Cross-React search
318       326 LYRGDVVPK       1.055       Click here for PD Search       Click here for Cross-React search
59       67 GKHVPRAVY       1.053       Click here for PD Search       Click here for Cross-React search
171       179 VYPAPQVST       1.034       Click here for PD Search       Click here for Cross-React search
260       268 VPYPRIHFP       1.03       Click here for PD Search       Click here for Cross-React search
258       266 NLVPYPRIH       1.02       Click here for PD Search       Click here for Cross-React search
307       315 PRHGKYMAC       1.014       Click here for PD Search       Click here for Cross-React search
320       328 RGDVVPKDV       1.012       Click here for PD Search       Click here for Cross-React search
122       130 IRKLSDQCT       1.005       Click here for PD Search       Click here for Cross-React search
48       56 SFNTFFSET       1.002       Click here for PD Search       Click here for Cross-React search
292       300 TNTCFEPAN       1.002       Click here for PD Search       Click here for Cross-React search
357       365 YQPPTVVQV       0.982       Click here for PD Search       Click here for Cross-React search
192       200 HTTLEHSDC       0.979       Click here for PD Search       Click here for Cross-React search
52       60 FFSETGSGK       0.976       Click here for PD Search       Click here for Cross-React search
103       111 YARGHYTIG       0.97       Click here for PD Search       Click here for Cross-React search
203       211 MVDNEAIYD       0.937       Click here for PD Search       Click here for Cross-React search
64       72 RAVYVDLEP       0.933       Click here for PD Search       Click here for Cross-React search
63       71 PRAVYVDLE       0.933       Click here for PD Search       Click here for Cross-React search
284       292 EQLTVSEIT       0.921       Click here for PD Search       Click here for Cross-React search
58       66 SGKHVPRAV       0.901       Click here for PD Search       Click here for Cross-React search
118       126 VLDRIRKLS       0.9       Click here for PD Search       Click here for Cross-React search
165       173 SKLEFAVYP       0.892       Click here for PD Search       Click here for Cross-React search
351       359 FKVGINYQP       0.891       Click here for PD Search       Click here for Cross-React search
225       233 TNLNRLIGQ       0.885       Click here for PD Search       Click here for Cross-React search
26       34 LEHGIQPDG       0.884       Click here for PD Search       Click here for Cross-React search
274       282 PVISAEKAY       0.884       Click here for PD Search       Click here for Cross-React search
272       280 YAPVISAEK       0.884       Click here for PD Search       Click here for Cross-React search
153       161 LMERLSVDY       0.88       Click here for PD Search       Click here for Cross-React search
297       305 EPANQMVKC       0.879       Click here for PD Search       Click here for Cross-React search
283       291 HEQLTVSEI       0.869       Click here for PD Search       Click here for Cross-React search
355       363 INYQPPTVV       0.861       Click here for PD Search       Click here for Cross-React search
285       293 QLTVSEITN       0.855       Click here for PD Search       Click here for Cross-React search
322       330 DVVPKDVNA       0.848       Click here for PD Search       Click here for Cross-React search
299       307 ANQMVKCDP       0.847       Click here for PD Search       Click here for Cross-React search
298       306 PANQMVKCD       0.847       Click here for PD Search       Click here for Cross-React search
321       329 GDVVPKDVN       0.831       Click here for PD Search       Click here for Cross-React search
182       190 VEPYNSILT       0.829       Click here for PD Search       Click here for Cross-React search
45       53 GDDSFNTFF       0.825       Click here for PD Search       Click here for Cross-React search
224       232 YTNLNRLIG       0.8       Click here for PD Search       Click here for Cross-React search
302       310 MVKCDPRHG       0.794       Click here for PD Search       Click here for Cross-React search
60       68 KHVPRAVYV       0.79       Click here for PD Search       Click here for Cross-React search
275       283 VISAEKAYH       0.778       Click here for PD Search       Click here for Cross-React search
42       50 IGTGDDSFN       0.764       Click here for PD Search       Click here for Cross-React search
106       114 GHYTIGKEI       0.759       Click here for PD Search       Click here for Cross-React search
248       256 LNVDLTEFQ       0.752       Click here for PD Search       Click here for Cross-React search
290       298 EITNTCFEP       0.748       Click here for PD Search       Click here for Cross-React search
49       57 FNTFFSETG       0.74       Click here for PD Search       Click here for Cross-React search
294       302 TCFEPANQM       0.74       Click here for PD Search       Click here for Cross-React search
193       201 TTLEHSDCA       0.726       Click here for PD Search       Click here for Cross-React search
170       178 AVYPAPQVS       0.724       Click here for PD Search       Click here for Cross-React search
150       158 TSLLMERLS       0.723       Click here for PD Search       Click here for Cross-React search
92       100 LITGKEDAA       0.722       Click here for PD Search       Click here for Cross-React search
188       196 ILTTHTTLE       0.722       Click here for PD Search       Click here for Cross-React search
286       294 LTVSEITNT       0.713       Click here for PD Search       Click here for Cross-React search
74       82 VVDEVRTGT       0.707       Click here for PD Search       Click here for Cross-React search
73       81 TVVDEVRTG       0.707       Click here for PD Search       Click here for Cross-React search
51       59 TFFSETGSG       0.704       Click here for PD Search       Click here for Cross-React search
108       116 YTIGKEIVD       0.699       Click here for PD Search       Click here for Cross-React search
243       251 RFDGALNVD       0.689       Click here for PD Search       Click here for Cross-React search
65       73 AVYVDLEPT       0.687       Click here for PD Search       Click here for Cross-React search
41       49 TIGTGDDSF       0.685       Click here for PD Search       Click here for Cross-React search
207       215 EAIYDICRR       0.685       Click here for PD Search       Click here for Cross-React search
239       247 TASLRFDGA       0.676       Click here for PD Search       Click here for Cross-React search
166       174 KLEFAVYPA       0.672       Click here for PD Search       Click here for Cross-React search
87       95 FHPEQLITG       0.668       Click here for PD Search       Click here for Cross-React search
85       93 QLFHPEQLI       0.668       Click here for PD Search       Click here for Cross-React search
173       181 PAPQVSTAV       0.667       Click here for PD Search       Click here for Cross-React search
204       212 VDNEAIYDI       0.664       Click here for PD Search       Click here for Cross-React search
61       69 HVPRAVYVD       0.66       Click here for PD Search       Click here for Cross-React search
325       333 PKDVNAAIA       0.66       Click here for PD Search       Click here for Cross-React search
252       260 LTEFQTNLV       0.65       Click here for PD Search       Click here for Cross-React search
289       297 SEITNTCFE       0.649       Click here for PD Search       Click here for Cross-React search
271       279 TYAPVISAE       0.638       Click here for PD Search       Click here for Cross-React search
208       216 AIYDICRRN       0.636       Click here for PD Search       Click here for Cross-React search
237       245 SITASLRFD       0.635       Click here for PD Search       Click here for Cross-React search
379       387 PTLLPSLKL       0.633       Click here for PD Search       Click here for Cross-React search
126       134 SDQCTGLQG       0.621       Click here for PD Search       Click here for Cross-React search
241       249 SLRFDGALN       0.615       Click here for PD Search       Click here for Cross-React search
383       391 PSLKLGLDW       0.598       Click here for PD Search       Click here for Cross-React search
124       132 KLSDQCTGL       0.598       Click here for PD Search       Click here for Cross-React search
266       274 HFPLVTYAP       0.583       Click here for PD Search       Click here for Cross-React search
330       338 AAIASIKTK       0.58       Click here for PD Search       Click here for Cross-React search
212       220 ICRRNLDIE       0.574       Click here for PD Search       Click here for Cross-React search
326       334 KDVNAAIAS       0.572       Click here for PD Search       Click here for Cross-React search
350       358 GFKVGINYQ       0.57       Click here for PD Search       Click here for Cross-React search
273       281 APVISAEKA       0.57       Click here for PD Search       Click here for Cross-React search
107       115 HYTIGKEIV       0.57       Click here for PD Search       Click here for Cross-React search
206       214 NEAIYDICR       0.562       Click here for PD Search       Click here for Cross-React search
148       156 GFTSLLMER       0.56       Click here for PD Search       Click here for Cross-React search
70       78 LEPTVVDEV       0.558       Click here for PD Search       Click here for Cross-React search
187       195 SILTTHTTL       0.558       Click here for PD Search       Click here for Cross-React search
86       94 LFHPEQLIT       0.557       Click here for PD Search       Click here for Cross-React search
117       125 LVLDRIRKL       0.554       Click here for PD Search       Click here for Cross-React search
211       219 DICRRNLDI       0.553       Click here for PD Search       Click here for Cross-React search
262       270 YPRIHFPLV       0.549       Click here for PD Search       Click here for Cross-React search
259       267 LVPYPRIHF       0.549       Click here for PD Search       Click here for Cross-React search
176       184 QVSTAVVEP       0.549       Click here for PD Search       Click here for Cross-React search
175       183 PQVSTAVVE       0.549       Click here for PD Search       Click here for Cross-React search
68       76 VDLEPTVVD       0.538       Click here for PD Search       Click here for Cross-React search
180       188 AVVEPYNSI       0.522       Click here for PD Search       Click here for Cross-React search
167       175 LEFAVYPAP       0.52       Click here for PD Search       Click here for Cross-React search
209       217 IYDICRRNL       0.519       Click here for PD Search       Click here for Cross-React search
125       133 LSDQCTGLQ       0.518       Click here for PD Search       Click here for Cross-React search
323       331 VVPKDVNAA       0.513       Click here for PD Search       Click here for Cross-React search
264       272 RIHFPLVTY       0.513       Click here for PD Search       Click here for Cross-React search
236       244 SSITASLRF       0.509       Click here for PD Search       Click here for Cross-React search
263       271 PRIHFPLVT       0.506       Click here for PD Search       Click here for Cross-React search
67       75 YVDLEPTVV       0.505       Click here for PD Search       Click here for Cross-React search
66       74 VYVDLEPTV       0.505       Click here for PD Search       Click here for Cross-React search
246       254 GALNVDLTE       0.502       Click here for PD Search       Click here for Cross-React search

Source: Epitopes are predicted using BepiPred webserver implemented in IEDB Analysis Resource at http://tools.iedb.org/main/bcell/


Thanks for using SDAP Database