The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTAS
SKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVH
AVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKEST
GGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAA
TGAATAAAGVAAGAATAAAGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB10765 Hol l 5.0101 264 1596 370.4 3.5e-104
AAK62277 Dac g 5.02 265 1303 303.6 4.5e-84
AAD20386 Lol p 5 301 1294 301.6 2.2e-83
AAK62276 Dac g 5.01 265 1289 300.5 4.1e-83
Q40963 Phl p 5.0201 284 1232 287.4 3.6e-79
AAC25996 Phl p 5.0204 265 1227 286.3 7.3e-79
CAB05371 Phl p 5.0202 281 1217 284.0 3.8e-78
9249029 Phl p 5.0205 265 1208 282.0 1.5e-77
CAD87529 Phl p 5.0109 284 1168 272.8 8.9e-75
Q9FPR0 Poa p 5.0101 303 1145 267.6 3.7e-73
AAC16527 Phl p 5.0107 276 1142 266.9 5.2e-73
CAA52753 Phl p 5.0101 312 1141 266.7 7.1e-73
P22286 Poa p 5 307 1138 266.0 1.1e-72
AAC16526 Phl p 5.0106 276 1135 265.3 1.6e-72
P22284 Poa p 5 373 1136 265.5 1.9e-72
P22285 Poa p 5 333 1135 265.3 2e-72
AAC16528 Phl p 5.0108 276 1130 264.2 3.5e-72
Q40962 Phl p 5.0102 286 1116 261.0 3.3e-71
AAC16525 Phl p 5.0105 276 1115 260.8 3.7e-71
CAB05372 Phl p 5.0104 276 1109 259.4 9.6e-71
CAB10766 Hol l 5.0201 240 1085 254.0 3.6e-69
Q40237 Lol p 5 339 1014 237.7 4.1e-64
AAK25823 Phl p 5 275 971 228.0 2.8e-61
P56164 Pha a 5 320 911 214.2 4.5e-57
P56167 Pha a 5 175 803 189.9 5.2e-50
CBG76811 Sec c 5.0101 292 807 190.6 5.5e-50
U57845 Hor v 5.0101 313 752 178.0 3.5e-46
Q40240 Lol p 5 308 734 173.9 6e-45
P56166 Pha a 5 294 675 160.5 6.3e-41
P56165 Pha a 5 305 593 141.8 2.8e-35
P43215 Phl p 6.0101 132 472 114.7 1.7e-27
CAA76556 Phl p 6.0102 138 464 112.8 6.5e-27
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 370.4 bits 1596,  Expect = 3e-104
 Identities = 264/264 100%, Positives = 264/264 100%, Gaps = 0/264 0%
Query  1    ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTAS 60
            ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTAS
Sbjct  1    ADAGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTAS 60
Query  61   SKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVH 120
            SKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVH
Sbjct  61   SKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVH 120
Query  121  AVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKEST 180
            AVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKEST
Sbjct  121  AVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKEST 180
Query  181  GGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAA 240
            GGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAA
Sbjct  181  GGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAA 240
Query  241  TGAATAAAGVAAGAATAAAGGYKV 264
            TGAATAAAGVAAGAATAAAGGYKV
Sbjct  241  TGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 2. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 303.6 bits 1303,  Expect = 4e-84
 Identities = 215/264 81%, Positives = 230/264 87%, Gaps = 1/264 0%
Query  1    ADAGYTPAAPAA-AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGYTPAA A  A AGGKA T+EQKL+EDVNAGFK AVAAA++ PPADK+KTFEA FTA
Sbjct  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            + KA+IAAAATK P ++ +L+AA   AY  A G TPEAKYDAFV  LTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKPA EEV AAKIPAGELQIVDKIDAA++IAATAANAAP NDKFTVFEGAFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAYE+YKFIP+LE AVKQAYAATVA APEVKY VFE AL KAITAMSEAQK A P AA
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAA 240
Query  240  ATGAATAAAGVAAGAATAAAGGYKV 264
            ATGAATAAA  A GAATAAAGGYKV
Sbjct  241  ATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 3. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 301.6 bits 1294,  Expect = 2e-83
 Identities = 219/263 83%, Positives = 231/263 87%, Gaps = 12/263 4%
Query  1    ADAGYTPAA------PAA--AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKT 52
            ADAGYTPAA      PAA  A AGGKATTDEQKLLEDVNAGFK AVAAAAN PPADK+K 
Sbjct  26   ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKI 85
Query  53   FEAAFTASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
            FEAAF+ SSK  +A +A KAPGLIP+L+ A + AY AA+GATPEAKYDAFVT LTEALRV
Sbjct  86   FEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTALTEALRV 145
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            IAGALEVHAVKPATEEV AAKIP GELQIVDKIDAAF+IAATAANAAP NDKFTVFE AF
Sbjct  146  IAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAF 205
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            NKA+ E TGGAYE YKFIPSLE AVKQAYAATVA APEVKY VFE AL KAITAM++AQK
Sbjct  206  NKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQK 265
Query  233  EAKPVAAA-TGAATAAAGVA---AGAATAAAGGYK 263
              KP AAA TGAAT A G A   AGAATAAAGGYK
Sbjct  266  AGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 4. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 300.5 bits 1289,  Expect = 4e-83
 Identities = 213/264 80%, Positives = 228/264 86%, Gaps = 1/264 0%
Query  1    ADAGYTPAAPAA-AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGYTPAA A  A AGGKA T+EQ L+EDVNAGFK AVAAA++ PPADK+KTFEA FTA
Sbjct  1    ADAGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            + KA+IAAAATK P ++ +L+AA   AY  A G TPEAKYDAFV  LTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKPA EEV AAKIPAGELQIVDKIDAA++IAATAANAAP NDKFTVFEGAFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAYE+YKFIP+LE AVKQAYAATVA APEVKY VFE AL KAITAMSEAQK A P A 
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAAV 240
Query  240  ATGAATAAAGVAAGAATAAAGGYKV 264
            ATGAATAAA  A GAATAAAGGYKV
Sbjct  241  ATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 5. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 287.4 bits 1232,  Expect = 4e-79
 Identities = 203/260 78%, Positives = 225/260 86%, Gaps = 9/260 3%
Query  1    ADAGYTPAAPAAAGAG-GKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGY PA PAAAGA  GKATT+EQKL+ED+N GFK AVAAAA+VP ADK+KTFEAAFT+
Sbjct  20   ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 79
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            SSK    AAA KAPGL+P+L+AA + AY AA GATPEAK+D+FV +LTEALRVIAGALEV
Sbjct  80   SSK----AAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 135
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKP TEE G AKIPAGELQI+DKIDAAF++AATAA  AP +DKFTVFE AFNKAIKES
Sbjct  136  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 195
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAY+ YK IPSLE AVKQAYAATVA AP+VKY VFE AL KAITAMSE QK ++P   
Sbjct  196  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 255
Query  240  AT----GAATAAAGVAAGAATAAAGGYKV 264
            A     GAAT AAG A+GAAT AAGGYKV
Sbjct  256  AATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 6. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 286.3 bits 1227,  Expect = 7e-79
 Identities = 202/260 77%, Positives = 225/260 86%, Gaps = 9/260 3%
Query  1    ADAGYTPAAPAAAGA-GGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGY PA PAAAGA  GKATT+EQKL+ED+N GFK AVAAAA+VP ADK+KTFEAAFT+
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 60
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            SSKA+ A    KAPGL+P+L+AA + AY AA GATPEAK+D+FV +LTEALRVIAGALEV
Sbjct  61   SSKAATA----KAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 116
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKP TEE G AKIPAGELQI+DKIDAAF++AATAA  AP +DKFTVFE AFNKAIKES
Sbjct  117  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 176
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAY+ YK IPSLE AVKQAYAATVA AP+VKY VFE AL KAITAMSE QK ++P   
Sbjct  177  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 236
Query  240  AT----GAATAAAGVAAGAATAAAGGYKV 264
            A     GAAT AAG A+GAAT AAGGYKV
Sbjct  237  AATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 7. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 284.0 bits 1217,  Expect = 4e-78
 Identities = 200/260 76%, Positives = 223/260 85%, Gaps = 9/260 3%
Query  1    ADAGYTPAAPAAAGA-GGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGY PA PAAAGA  GKATT+EQKL+ED+N GFK AVAAAA+VP  DK+KTFEAAFT+
Sbjct  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            SSKA+ A    KAPGL+P+L+AA + AY AA GATPEAK+D+FV +LTEALRVIAGALEV
Sbjct  77   SSKAATA----KAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 132
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKP TEE G AKIPAGELQI+DKIDAAF++AATAA  AP +DKFTVFE AFNKAIKES
Sbjct  133  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 192
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAY+ YK IPSLE AVKQAYAATVA AP+VKY VFE AL KAITAMSE QK ++P   
Sbjct  193  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 252
Query  240  AT----GAATAAAGVAAGAATAAAGGYKV 264
            A     GAAT A G A+GAAT AAGGYKV
Sbjct  253  AATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 8. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 282.0 bits 1208,  Expect = 1e-77
 Identities = 199/260 76%, Positives = 223/260 85%, Gaps = 9/260 3%
Query  1    ADAGYTPAAPAAAGA-GGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            ADAGY PA PAAAGA  GKATT+EQKL+ED+N GF  AVAAAA+VP ADK+KTFEAAFT+
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFTS 60
Query  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            SSKA+ A    KAPGL+P+L+AA + AY AA GATPEAK+D++V +LTEALRVIAGALEV
Sbjct  61   SSKAATA----KAPGLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEALRVIAGALEV 116
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKP TEE G AKIPAGELQI+DKIDAAF++AATAA  AP +DKFTVFE AFNKAIKES
Sbjct  117  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 176
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
            TGGAY+ YK IPSLE AVKQ YAATVA AP+VKY VFE AL KAITAMSE QK ++P   
Sbjct  177  TGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 236
Query  240  AT----GAATAAAGVAAGAATAAAGGYKV 264
            A     GAAT AAG A+GAAT AAGGYKV
Sbjct  237  AATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 9. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 272.8 bits 1168,  Expect = 9e-75
 Identities = 193/260 74%, Positives = 216/260 83%, Gaps = 12/260 4%
Query  3    AGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSK 62
            AGYTPAAPA A   GKATT+EQKL+E +NAGFK A+AAAA VPPADKY+TF A F A+S 
Sbjct  15   AGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASN 74
Query  63   ASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
             + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL+EALR+
Sbjct  75   KAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRI 134
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++AATAANAAP NDKFTVFE AF
Sbjct  135  IAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAF 192
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            N AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK
Sbjct  193  NNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 252
Query  233  EAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
             AKP AAAT  AT+A G A GAATAA GGYKV
Sbjct  253  AAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 10. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 267.6 bits 1145,  Expect = 4e-73
 Identities = 193/264 73%, Positives = 221/264 83%, Gaps = 14/264 5%
Query  1    ADAGYTPAAPAAAGAG-GKAT-TDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFT 58
            ADAGY PA PAAAGA  GK T T EQKL+ED+N GFK AVAAAA  PPADK+KTF+AAF+
Sbjct  26   ADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQAAFS 85
Query  59   ASSKASIAA-AATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGAL 117
            AS +AS A   A +APG++ ++ A ++  Y AA GATPEAK+D+FV  +TEALR+IAG L
Sbjct  86   ASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEALRIIAGVL 145
Query  118  EVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIK 177
            +VHAVKP TEE GAAKIPAGE QI+DKIDAAF++AATAANAAP NDKFTVFE AFN AIK
Sbjct  146  KVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEAAFNNAIK 205
Query  178  ESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPV 237
            ESTGGAY+ YK IPSLE AVKQAYAAT+A APEVK+ VF+ AL KAITAM+E QK +KPV
Sbjct  206  ESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEVQKVSKPV 265
Query  238  A-----------AATGAATAAAGVAAGAATAAAGGYKV 264
            A           AATGAAT AAG A GAAT +AGGYKV
Sbjct  266  AGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 11. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 266.9 bits 1142,  Expect = 5e-73
 Identities = 193/262 73%, Positives = 216/262 82%, Gaps = 16/262 6%
Query  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  57   FTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
            F A+S  + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+D+AF++AATAANAAP NDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            MSEAQK AKP AAAT  AT+A G A GA TAAAGGYKV
Sbjct  239  MSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 12. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 266.7 bits 1141,  Expect = 7e-73
 Identities = 193/260 74%, Positives = 215/260 82%, Gaps = 15/260 5%
Query  3    AGYTPAAPAA---AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
            AGYTPA PAA   A   GKATT+EQKL+E +NAGFK A+AAAA V PADKY+TF A F A
Sbjct  40   AGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGA 99
Query  60   SSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEA 109
            +S  + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL+EA
Sbjct  100  ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 159
Query  110  LRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFE 169
            LR+IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++AATAANAAP NDKFTVFE
Sbjct  160  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 217
Query  170  GAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 229
             AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITAMSE
Sbjct  218  AAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 277
Query  230  AQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            AQK AKP AAAT  ATAA G A GAATAA GGYKV
Sbjct  278  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 13. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 266.0 bits 1138,  Expect = 1e-72
 Identities = 190/258 73%, Positives = 214/258 82%, Gaps = 14/258 5%
Query  3    AGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSK 62
            AGYTPAAP  AGA  KATTDEQK++E +N GFK AVAAA  VP A+KYKTF A F A+S 
Sbjct  40   AGYTPAAP--AGAAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANKYKTFVATFGAASN 97
Query  63   ASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
             + A A +  P           L  +L+AA   AY +A+GATPEAKYD +V TL+EALR+
Sbjct  98   KAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKYDDYVATLSEALRI 157
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            IAG LEVH VKPA EEV A   PAGELQ++DK+DAAF++AATAANAAP NDKFTVFE AF
Sbjct  158  IAGTLEVHGVKPAAEEVKAT--PAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAF 215
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            N AIK STGGAY++YKFIP+LE AVKQ+YAATVATAP VKYTVFETALKKAITAMS+AQK
Sbjct  216  NDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQK 275
Query  233  EAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
             AKP AAATG ATAA G A GAATAAAGGYKV
Sbjct  276  AAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 14. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 265.3 bits 1135,  Expect = 2e-72
 Identities = 192/262 73%, Positives = 214/262 81%, Gaps = 16/262 6%
Query  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  57   FTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
            F A+S  + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+D+AF++AATAANAAP NDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            MSEAQK AKP   AT  ATAA G A GAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 15. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 265.5 bits 1136,  Expect = 2e-72
 Identities = 191/258 74%, Positives = 214/258 82%, Gaps = 14/258 5%
Query  3    AGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSK 62
            A YTPAAP  AGA  KATTDEQKL+E +N GFK AVAAAA VP A KYKTF A F A+S 
Sbjct  106  AAYTPAAP--AGAAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFVATFGAASN 163
Query  63   ASIAAAATKAPG----------LIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
             + A A +  P           L  +L+AA   AY +A+GATPEAKYDA+V TL+EALR+
Sbjct  164  KAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRI 223
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            IAG LEVH VKPA EEV A  IPAGELQ++DK+DAAF++AATAANAAP NDKFTVFE AF
Sbjct  224  IAGTLEVHGVKPAAEEVKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAF 281
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            N AIK STGGAY++YKFIP+LE AVKQ+YAATVATAP VKYTVFETALKKAITAMS+AQK
Sbjct  282  NDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQK 341
Query  233  EAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
             AKP AA TG AT+A G A GAATAAAGGYKV
Sbjct  342  AAKPAAAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 44.8 bits 168,  Expect = 5e-06
 Identities = 36/96 37%, Positives = 61/96 63%, Gaps = 5/96 5%
Query  27   LEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIAAAATKAPGLIPQLNAATNTA 86
            ++  N  +KTA+ AA+ V PA+K+  F+A F  + K  ++     A G+  +L+A   T+
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSG--PDAVGFAKKLDAFIQTS 58
Query  87   YAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKPATE 127
            Y + + A P+ K+D FV +LTE LR +AGA++     PA++
Sbjct  59   YLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKA---PPASK 96

Sequence Alignment: 16. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 265.3 bits 1135,  Expect = 2e-72
 Identities = 198/257 77%, Positives = 219/257 85%, Gaps = 21/257 8%
Query  3    AGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF-TASS 61
            AGYTPAAP  AGA  KATTDEQKL+E +NAGFK AVAAAA VP  DKYKTF A F TAS+
Sbjct  47   AGYTPAAP--AGAAPKATTDEQKLIEKINAGFKAAVAAAAGVPAVDKYKTFVATFGTASN 104
Query  62   KASI---------AAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
            KA           AAAA+    L  +L+AA   AY +A+GATPEAKYDA+V TL+EALR+
Sbjct  105  KAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRI 164
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            IAG LEVHAVKPA EEV A  IPAGELQ++DK+DAAF++AATAANAAP NDKFTVFE AF
Sbjct  165  IAGTLEVHAVKPAGEEVKA--IPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAF 222
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            N AIK STGGAY++YKFIP+LE AVKQ+YAATVATAP VKYTVFETALKKAITAMS+AQK
Sbjct  223  NDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQK 282
Query  233  EAKPVAAAT-------GAATAAAGVAAGAATAAAGGYK 263
             AKP AA T       GAAT A G A GAATAAAGGYK
Sbjct  283  AAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 17. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 264.2 bits 1130,  Expect = 3e-72
 Identities = 191/262 72%, Positives = 213/262 81%, Gaps = 16/262 6%
Query  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  57   FTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
            F A+S  + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+D+AF++AATAANAAP NDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKA TA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTA 238
Query  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            MSEAQK AKP   AT  ATAA G A GAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 18. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 261.0 bits 1116,  Expect = 3e-71
 Identities = 193/259 74%, Positives = 215/259 83%, Gaps = 16/259 6%
Query  3    AGYTPAAPAA---AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF-T 58
            AGYTPA PAA   A A GKATT+EQKL+E +NAGFK A+A A  V PADKY+TF A F  
Sbjct  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGP 73
Query  59   ASSKASI---------AAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEA 109
            AS+KA           AA ++    L  +L+AA   AY  A+GATPEAKYDA+V TL+EA
Sbjct  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
Query  110  LRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFE 169
            LR+IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++AATAANAAP NDKFTVFE
Sbjct  134  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
Query  170  GAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 229
             AFN  IK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITAMSE
Sbjct  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
Query  230  AQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            AQK AKP AAAT  ATAA G A GAATAA GGYKV
Sbjct  252  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 19. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 260.8 bits 1115,  Expect = 4e-71
 Identities = 189/262 72%, Positives = 213/262 81%, Gaps = 16/262 6%
Query  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  57   FTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
            F A+S  + A   +  P           L  +L+AA   AY  A+GATPEA+YDA+V TL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATL 120
Query  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+D+A+++AATAANAAP NDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSALKVAATAANAAPANDKFT 178
Query  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
             SEAQK AKP   AT  ATAA G A GAATAA GGYKV
Sbjct  239  TSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 20. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 259.4 bits 1109,  Expect = 1e-70
 Identities = 191/262 72%, Positives = 214/262 81%, Gaps = 16/262 6%
Query  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  57   FTASSKASIA---------AAATKAPG-LIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
            F A+S  + A         AA + + G L  +L AA   AY  ++GATPEAKYDA+V TL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
Query  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ ++K+D+A+++AATAANAA  NDKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
Query  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            MSEAQK AKP   AT  ATAA G A GAATAA GGYKV
Sbjct  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 21. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 254.0 bits 1085,  Expect = 4e-69
 Identities = 187/237 78%, Positives = 200/237 84%, Gaps = 7/237 2%
Query  24   QKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIA---AAATKAPGLIPQLN 80
            QKLLEDVNA FK AVAAAA VPPADKYKTF  AFT   + S     A  TK P L  +L 
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLV 60
Query  81   AATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQ 140
             A   A+ A+ G T EAKYDAFVTTLTEALRVIAGALEVHAVKPATEEV AAKIPAG+LQ
Sbjct  61   DAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQ 120
Query  141  IVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQA 200
            +VDKIDA+F+IAATAANAAP NDKFTVFE AFNKA+KESTGGAYE+YKFIPSLE AVKQA
Sbjct  121  VVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQA 180
Query  201  YAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAATGAATAAAGVAAGAATAAAG 260
            YA+TVA APEVKY VFE AL KAITAMS+AQK A+P AAATGAAT    VAAGAAT AAG
Sbjct  181  YASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAAT----VAAGAATTAAG 236
Query  261  GYKV 264
            GYKV
Sbjct  237  GYKV 240

Sequence Alignment: 22. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 237.7 bits 1014,  Expect = 4e-64
 Identities = 174/252 69%, Positives = 195/252 77%, Gaps = 7/252 2%
Query  6    TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF-TASSKAS 64
            TPA PAA  +G KATT+EQKL+E +NAGFK AVAAAA VPPADKYKTF   F TA++KA 
Sbjct  52   TPATPAAVPSG-KATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNKAF 110
Query  65   IAAAAT-----KAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
            +   A+         L  +L+AA   AY AAQGATPEAKYDA+V TLTEALRVIAG LEV
Sbjct  111  VEGLASGYADQSKNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVIAGTLEV 170
Query  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
            HAVKPA EEV    IPA E+Q++DK+DAA+R AATAANAAP NDKFTVFE  FN AIK S
Sbjct  171  HAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFNNAIKVS 230
Query  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAA 239
             G AY++YKFIP+L  AVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+KEA P AA
Sbjct  231  LGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKEATPAAA 290
Query  240  ATGAATAAAGVAAGAATAA 258
            AT   T AA  A     AA
Sbjct  291  ATATPTPAAATATATPAAA 309

Sequence Alignment: 23. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 228.0 bits 971,  Expect = 3e-61
 Identities = 162/221 73%, Positives = 181/221 81%, Gaps = 12/221 5%
Query  42   ANVPPADKYKTFEAAFTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQ 91
            A VPPADKY+TF A F A+S  + A   +  P           L  +L+AA   AY  A+
Sbjct  45   AIVPPADKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAE 104
Query  92   GATPEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRI 151
            GATPEAKYDA+V TL+EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++
Sbjct  105  GATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKV 162
Query  152  AATAANAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEV 211
            AATAANAAP NDKFTVFE AFN AIK  TGGAYE+YKFIP+LE AVKQAYAATVATAPEV
Sbjct  163  AATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEV 222
Query  212  KYTVFETALKKAITAMSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
            KYTVFETALKKAITAMSEAQK AKP AAAT  AT+A G   GA TAAAGGYKV
Sbjct  223  KYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 24. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 214.2 bits 911,  Expect = 4e-57
 Identities = 164/248 66%, Positives = 181/248 72%, Gaps = 6/248 2%
Query  6    TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASI 65
            TP       A  KAT    + +ED+NA  +    A  +VPPADK+KTF         A +
Sbjct  30   TPPLLPPPRARDKATLT-SRSVEDINAASRRPWWA--SVPPADKFKTFADHVLCVPNADV 86
Query  66   AAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKPA 125
             +AATKAP L  +L+AA   AY AA+G+TPEAKYDAF+  LTEALRVIAGA+EVHAVKPA
Sbjct  87   TSAATKAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAFEVHAVKPA 146
Query  126  TEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKESTGGAYE 185
            TEEV A   P GELQIVDKIDAAF+IAATAAN+AP NDKFTVFEGAFNKAIKEST GAYE
Sbjct  147  TEEVVAD--PVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIKESTAGAYE 204
Query  186  AYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVAAATGAAT 245
             YKFIPSLE AVKQAY ATVA APEVKY VFE  L KAITAMSEAQK AKP   +     
Sbjct  205  TYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKP-PLSPQPPQ 263
Query  246  AAAGVAAGAATAAA 259
                 A GAAT AA
Sbjct  264  VLPLAAGGAATVAA 277

Sequence Alignment: 25. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 189.9 bits 803,  Expect = 5e-50
 Identities = 139/168 82%, Positives = 146/168 86%, Gaps = 7/168 4%
Query  97   AKYDAFVTTLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAA 156
            AKYDAF+  LTEALRVIAGA+EVHAVKPATEEV AAKIPAGELQIVDKIDAAF+IAATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  157  NAAPVNDKFTVFEGAFNKAIKESTGGAYEAYKFIPSLETA-VKQAYAATVATAPEVKYTV 215
            N+AP NDKFTVFEGAFNKAIKE  GGAYE YKFIPSLE +  KQAY ATVA APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  216  FETALKKAITAMSEAQKEAKPV----AAATGAATAAAGVAAGAAT--AAAGGYKV 264
            FE  L KAITAMSEAQK AKPV    AAA GAATAA G A  AA+   +AGGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 26. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 190.6 bits 807,  Expect = 5e-50
 Identities = 167/256 65%, Positives = 198/256 77%, Gaps = 15/256 5%
Query  5    YTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKAS 64
            Y   APAA G   KATT EQKL+E++N GFK AV AAA V PADKYKTF+  F   S  +
Sbjct  24   YGTYAPAAPGTQPKATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSNKA 83
Query  65   IAAAATKAP-GLIP-----------QLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
             A   T A  G IP            L ++   AY +A+GATPE KYD +V +LTE+LRV
Sbjct  84   FADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESLRV 143
Query  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
            I+GA+EVHAVKPA+EEV    +PA +L++VD+IDAA+R AATAANAAP NDKF VFE +F
Sbjct  144  ISGAFEVHAVKPASEEVKG--VPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESSF 201
Query  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
            NKAIKE+TGGAY +Y F+P+LE+AVKQAYAATVA+APEVKY VF+ AL KAI AM EA+K
Sbjct  202  NKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEK 261
Query  233  EAKPVAAATGAATAAAGVAAGAATAAAGGYK 263
            +AKP AAA   ATA A V A AA AAAGGYK
Sbjct  262  DAKPAAAAAATATATATVGA-AAGAAAGGYK 291

Sequence Alignment: 27. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 178.0 bits 752,  Expect = 4e-46
 Identities = 130/207 62%, Positives = 154/207 74%, Gaps = 7/207 3%
Query  51   KTFEAAFTASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEAL 110
            K F   +  ++   IA  ++    L   L  +   AY  AQGATPEAKYDA+V TLTE+L
Sbjct  107  KAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVATLTESL 166
Query  111  RVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEG 170
            RVI+G LEVH+VKPA EEV    +PAGEL+ +D++DAAFR AATAA+AAP NDKFTVFE 
Sbjct  167  RVISGTLEVHSVKPAAEEVKG--VPAGELKAIDQVDAAFRTAATAADAAPANDKFTVFES 224
Query  171  AFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEA 230
                  ++  GGAYE+YKFIP+LE AVKQAYAATVA APEVK+TVF+TAL KAI AM++A
Sbjct  225  LQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQA 284
Query  231  QKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264
             K AKP AAAT  AT    VAAGAA A AG YKV
Sbjct  285  GKVAKPAAAATATAT----VAAGAA-ATAGNYKV 313

Sequence Alignment: 28. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 173.9 bits 734,  Expect = 6e-45
 Identities = 144/252 57%, Positives = 167/252 66%, Gaps = 19/252 7%
Query  1    ADAGYTPAA------PAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPAD------ 48
            ADAGYTPAA      PAA  AGG    D+++      AG +  +A+    PP        
Sbjct  26   ADAGYTPAAAATPATPAATPAGGWREGDDRRAEA---AGGRQRLASRQPWPPLPTPLRRT 82
Query  49   KYKTFEAAFTASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTE 108
              ++      +  +AS   +A KAPGLIP+L+ A + AY AA+ A P  +   +      
Sbjct  83   SSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRLRHCPHR 141
Query  109  ALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVF 168
            +LRVIAGALEVHAVKPATEEV AAKIP GELQIVDKIDAAF+IAATAANAAP NDKFTVF
Sbjct  142  SLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVF 201
Query  169  EGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMS 228
            E AFNKA+ E TGGA       P       +        APEVKY VFE AL KAITAM+
Sbjct  202  ESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTKAITAMT 261
Query  229  EAQKEAKPVAAATGAATAAAGVAAGAATAAA 259
            +AQK  KP AA   AATAAA VA  AATAAA
Sbjct  262  QAQKAGKPAAA---AATAAATVATAAATAAA 289

Sequence Alignment: 29. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 160.5 bits 675,  Expect = 6e-41
 Identities = 174/251 69%, Positives = 191/251 76%, Gaps = 31/251 12%
Query  1    ADAGY--TPAAPAAAGAG-GKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF 57
            ADAG   TPA PA  GA  GKATT EQKL+ED+NA FK   A+A   PPADKYKTFE AF
Sbjct  26   ADAGTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFKWWPASA---PPADKYKTFETAF 82
Query  58   TASSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGAL 117
               SKA+IA A+TK       L+AA +  Y  A GATPEAKYD+FVT LTEALR++AG L
Sbjct  83   ---SKANIAGASTKG------LDAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMAGTL 133
Query  118  EVHAVKPATEE-VGAAKIPAGELQIVDKIDAAFRIAAT---------AANAAPVNDKFTV 167
            EVHAVKPATEE V +AKI     +   +  + F+IAAT         AAN+AP NDKFTV
Sbjct  134  EVHAVKPATEEEVPSAKILRANSRSSTR-SSRFKIAATVATPLSHSTAANSAPANDKFTV 192
Query  168  FEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAM 227
            FEGAFNKAIKE  GG  E YKFIPSLE AVKQAY ATVA APEVKY VFE  L KAITAM
Sbjct  193  FEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAM 252
Query  228  SEAQKEAKPVAAATGAATAAAGVAAGAATAAA-----GGYKV 264
            SEAQK AKPV  +          A GAAT AA     GGYKV
Sbjct  253  SEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV 294

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 141.8 bits 593,  Expect = 3e-35
 Identities = 130/253 51%, Positives = 163/253 64%, Gaps = 39/253 15%
Query  1    ADAGYTPAAPAA----------AGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKY 50
            A  GY PA PAA          A +   A T E  ++    AG+     AA      D+ 
Sbjct  25   AGDGYAPATPAASATLATPATPAASPQHAGTTEYHIVR--KAGLNEEKNAARQTD--DEQ 80
Query  51   KTFEAAFTASSKASIAAAATKAP------GLIPQLNAATNTAYAAAQGATPEAKYDAFVT 104
            K  +         S+   A + P          + + A    Y + QG + +   DA V 
Sbjct  81   KRSDEINCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DASVG 137
Query  105  TLTEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDK 164
            +++  + VI  A+EV  +    EEV    IPAGE+++++K+ AAF  AATAA+ AP NDK
Sbjct  138  SVSSEFHVIESAIEV--ITYIGEEVKV--IPAGEVEVINKVKAAFSTAATAADEAPANDK 193
Query  165  FTVFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAI 224
            FTVF  +FNKAIKE+TGGAY  YKFIP+LE AVKQAYAA+ ATAPEVKY VFETALKKAI
Sbjct  194  FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAI 253
Query  225  TAMSEAQKEAKPVAAATGAATAAAGVAA----------GAAT--AAAGGYKV 264
            +AMSEAQKEAKP AA + A T  +   A          G AT  A AGGYKV
Sbjct  254  SAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 114.7 bits 472,  Expect = 2e-27
 Identities = 74/116 63%, Positives = 89/116 76%, Gaps = 0/116 0%
Query  9    APAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIAAA 68
            A +    GGKATT+EQKL+EDVNA F+ A+A  ANVPPADKYKTFEAAFT SSK ++A A
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  69   ATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKP 124
             +KAP L+P+L+   N AY AA  A PE KY+AFV  ++EALR+IAG  EVHAVKP
Sbjct  75   VSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKP 130

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 112.8 bits 464,  Expect = 6e-27
 Identities = 72/116 62%, Positives = 88/116 75%, Gaps = 0/116 0%
Query  9    APAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSKASIAAA 68
            A +    GGKATT+EQKL+ED+NA F+ A+A  ANVPPADKYKTFEAAFT SSK ++A A
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  69   ATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEVHAVKP 124
             +KAP L+P+L+   N AY AA  A PE KY+AFV  ++EAL +IAG  EVHAVKP
Sbjct  81   VSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKP 136

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.