The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL
SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF
EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
AAC16527 Phl p 5.0107 276 1665 386.1 7.2e-109
AAC16526 Phl p 5.0106 276 1640 380.4 3.7e-107
AAC16528 Phl p 5.0108 276 1635 379.3 8.2e-107
AAC16525 Phl p 5.0105 276 1620 375.9 8.8e-106
CAB05372 Phl p 5.0104 276 1595 370.2 4.6e-104
CAD87529 Phl p 5.0109 284 1574 365.4 1.3e-102
CAA52753 Phl p 5.0101 312 1565 363.3 6.1e-102
Q40962 Phl p 5.0102 286 1504 349.4 8.4e-98
P22286 Poa p 5 307 1465 340.5 4.3e-95
P22284 Poa p 5 373 1434 333.4 7.3e-93
P22285 Poa p 5 333 1411 328.2 2.4e-91
AAK25823 Phl p 5 275 1357 315.9 9.8e-88
Q40237 Lol p 5 339 1187 277.1 5.8e-76
CAB10765 Hol l 5.0101 264 1142 266.9 5.2e-73
AAK62277 Dac g 5.02 265 1134 265.1 1.9e-72
AAK62276 Dac g 5.01 265 1121 262.1 1.5e-71
AAD20386 Lol p 5 301 1093 255.7 1.4e-69
CBG76811 Sec c 5.0101 292 1071 250.7 4.4e-68
Q9FPR0 Poa p 5.0101 303 985 231.1 3.7e-62
CAB10766 Hol l 5.0201 240 981 230.3 5.2e-62
Q40963 Phl p 5.0201 284 877 206.5 8.8e-55
AAC25996 Phl p 5.0204 265 868 204.5 3.3e-54
U57845 Hor v 5.0101 313 867 204.2 4.8e-54
CAB05371 Phl p 5.0202 281 866 204.0 4.9e-54
9249029 Phl p 5.0205 265 857 202.0 1.9e-53
P56164 Pha a 5 320 835 196.9 7.7e-52
P56167 Pha a 5 175 723 171.6 1.7e-44
P56165 Pha a 5 305 656 156.1 1.4e-39
Q40240 Lol p 5 308 630 150.2 8.6e-38
P56166 Pha a 5 294 513 123.5 8.7e-30
CAA76556 Phl p 6.0102 138 232 59.9 5.6e-11
P43215 Phl p 6.0101 132 231 59.8 6.1e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 386.1 bits 1665,  Expect = 7e-109
 Identities = 276/276 100%, Positives = 276/276 100%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV
Sbjct  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 2. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 380.4 bits 1640,  Expect = 4e-107
 Identities = 271/276 98%, Positives = 272/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            EAQKAAKPA  ATATAT+AVGAATGA TAA GGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 3. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 379.3 bits 1635,  Expect = 8e-107
 Identities = 270/276 97%, Positives = 271/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKA TAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTAMS 240
Query  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            EAQKAAKPA  ATATAT+AVGAATGA TAA GGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 4. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 375.9 bits 1620,  Expect = 9e-106
 Identities = 268/276 97%, Positives = 271/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEA+YDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSA+KVAATAANAAPANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAANAAPANDKFTVF 180
Query  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA S
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITATS 240
Query  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            EAQKAAKPA  ATATAT+AVGAATGA TAA GGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 5. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 370.2 bits 1595,  Expect = 5e-104
 Identities = 264/276 95%, Positives = 269/276 97%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVDSA+KVAATAANAA ANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
Query  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            EAQKAAKPA  ATATAT+AVGAATGA TAA GGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 6. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 365.4 bits 1574,  Expect = 1e-102
 Identities = 267/276 96%, Positives = 269/276 97%, Gaps = 8/276 2%
Query  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
Query  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 112
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
Sbjct  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
Query  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAP 172
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAANAAP
Sbjct  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
Query  173  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
Query  233  KKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            KKAITAMSEAQKAAKPAAAATATATSAVGAATGA TAA GGYKV
Sbjct  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 7. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 363.3 bits 1565,  Expect = 6e-102
 Identities = 266/276 96%, Positives = 270/276 97%, Gaps = 11/276 3%
Query  1    ADLGYGG-----------PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
            ADLGYG            PATPAAPAEAAPAGKATTEEQKLIEKIN GFKAALAAAAGV 
Sbjct  26   ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQ 85
Query  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
            PADKY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  86   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 145
Query  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN 169
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAAN
Sbjct  146  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 205
Query  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
            AAPANDKFTVFEAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  206  AAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 265
Query  230  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGA TAA GGYKV
Sbjct  266  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 8. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 349.4 bits 1504,  Expect = 8e-98
 Identities = 259/275 94%, Positives = 263/275 95%, Gaps = 12/275 4%
Query  1    ADLGYGG-----------PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
Query  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
Query  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN 169
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAAN
Sbjct  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
Query  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
Query  230  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGA TAA GGYKV
Sbjct  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 9. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 340.5 bits 1465,  Expect = 4e-95
 Identities = 247/276 89%, Positives = 259/276 93%, Gaps = 7/276 2%
Query  1    ADLGYGGPATPAAPAE----AAPAG---KATTEEQKLIEKINDGFKAALAAAAGVPPADK 53
            ADL YG PATPAAPA     AAPAG   KATT+EQK+IEKIN GFKAA+AAA GVP A+K
Sbjct  25   ADLSYGAPATPAAPAAGYTPAAPAGAAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANK 84
Query  54   YKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 113
            YKTFVATFGAASNKAFAE LS EPKGAA  SSKAALTSKLDAAYKLAYK+AEGATPEAKY
Sbjct  85   YKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKY 144
Query  114  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPA 173
            D YVATLSEALRIIAGTLEVH VKPAAEEVK  PAGELQVI+KVD+AFKVAATAANAAPA
Sbjct  145  DDYVATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAANAAPA 204
Query  174  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 233
            NDKFTVFEAAFN+AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALK
Sbjct  205  NDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALK 264
Query  234  KAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            KAITAMS+AQKAAKPAAAAT TAT+AVGAATGA TAAAGGYKV
Sbjct  265  KAITAMSQAQKAAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 10. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 333.4 bits 1434,  Expect = 7e-93
 Identities = 241/265 90%, Positives = 251/265 94%, Gaps = 2/265 0%
Query  10   TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF 69
            TPAAPA AAP  KATT+EQKLIEKIN GFKAA+AAAAGVP A KYKTFVATFGAASNKAF
Sbjct  109  TPAAPAGAAP--KATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFVATFGAASNKAF 166
Query  70   AEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAG 129
            AE LS EPKGAA +SSKA LTSKLDAAYKLAYK+AEGATPEAKYDAYVATLSEALRIIAG
Sbjct  167  AEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAG 226
Query  130  TLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIK 189
            TLEVH VKPAAEEVK IPAGELQVI+KVD+AFKVAATAANAAPANDKFTVFEAAFN+AIK
Sbjct  227  TLEVHGVKPAAEEVKAIPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIK 286
Query  190  ASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA 249
            ASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALKKAITAMS+AQKAAKPA
Sbjct  287  ASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPA 346
Query  250  AAATATATSAVGAATGATTAAAGGYKV 276
            AA T TATSAVGAATGA TAAAGGYKV
Sbjct  347  AAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 52.6 bits 202,  Expect = 3e-08
 Identities = 41/102 40%, Positives = 63/102 61%, Gaps = 16/102 15%
Query  31   IEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALT 90
            ++K N  +K AL AA+ V PA+K+  F ATF    +K + EGLS  P           + 
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATF----DKNLKEGLSG-PDAVG-------FA 48
Query  91   SKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPA 148
             KLDA  + +Y + + A P+ K+D +V +L+E LR +AG ++     P A +    PA
Sbjct  49   KKLDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKA----PPASKFPAKPA 102

Sequence Alignment: 11. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 328.2 bits 1411,  Expect = 2e-91
 Identities = 247/275 89%, Positives = 258/275 93%, Gaps = 20/275 7%
Query  1    ADLGYGGPAT------PAAPAE----AAPAG---KATTEEQKLIEKINDGFKAALAAAAG 47
            AD+GYG PAT      PAAPA     AAPAG   KATT+EQKLIEKIN GFKAA+AAAAG
Sbjct  26   ADVGYGAPATLATPATPAAPAAGYTPAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAG 85
Query  48   VPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGA 107
            VP  DKYKTFVATFG ASNKAFAE LS EPKGAA +SS A LTSKLDAAYKLAYK+AEGA
Sbjct  86   VPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGA 145
Query  108  TPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATA 167
            TPEAKYDAYVATLSEALRIIAGTLEVHAVKPA EEVK IPAGELQVI+KVD+AFKVAATA
Sbjct  146  TPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFKVAATA 205
Query  168  ANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTV 227
            ANAAPANDKFTVFEAAFN+AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTV
Sbjct  206  ANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTV 265
Query  228  FETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAT-------TAAAGGYK 275
            FETALKKAITAMS+AQKAAKPAAA TATAT AVGAATGA        TAAAGGYK
Sbjct  266  FETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 12. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 315.9 bits 1357,  Expect = 1e-87
 Identities = 232/264 87%, Positives = 236/264 89%, Gaps = 5/264 1%
Query  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
            P  PA P    P     +       K+    KA     A VPPADKY+TFVATFGAASNK
Sbjct  12   PRPPATPPPPPPPQLGASP-----YKLGPSPKARSERPAIVPPADKYRTFVATFGAASNK 66
Query  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 127
            AFAEGLS EPKG AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII
Sbjct  67   AFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 126
Query  128  AGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNA 187
            AGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAANAAPANDKFTVFEAAFNNA
Sbjct  127  AGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNA 186
Query  188  IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK 247
            IKA TGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK
Sbjct  187  IKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK 246
Query  248  PAAAATATATSAVGAATGATTAAAGGYKV 276
            PAAAATATATSAVGA TGATTAAAGGYKV
Sbjct  247  PAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 13. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 277.1 bits 1187,  Expect = 6e-76
 Identities = 206/258 79%, Positives = 225/258 87%, Gaps = 8/258 3%
Query  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
Query  68   AFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 127
            AF EGL++   G A+ S K  LTSKLDAA KLAY+ A+GATPEAKYDAYVATL+EALR+I
Sbjct  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
Query  128  AGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFN 185
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A++ AATAANAAPANDKFTVFE  FN
Sbjct  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
Query  186  NAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA 245
            NAIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K 
Sbjct  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
Query  246  AKPAAAATATATSAVGAATGATTAAA 271
            A PAAAATAT T A   AT AT AAA
Sbjct  285  ATPAAAATATPTPAAATAT-ATPAAA 309

Sequence Alignment: 14. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 266.9 bits 1142,  Expect = 5e-73
 Identities = 193/262 73%, Positives = 216/262 82%, Gaps = 16/262 6%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F A+S  + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL
Sbjct  57   FTASSKASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ+++K+D+AF++AATAANAAP NDKFT
Sbjct  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
Query  239  MSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            MSEAQK AKP AAAT  AT+A G A GA TAAAGGYKV
Sbjct  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 15. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 265.1 bits 1134,  Expect = 2e-72
 Identities = 196/263 74%, Positives = 215/263 81%, Gaps = 15/263 5%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADAGYT-PAAAATPAAA--GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L
Sbjct  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A+K+AATAANAAPANDKFT
Sbjct  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
Query  239  MSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            MSEAQK A PAAAAT  AT+A  AATGA TAAAGGYKV
Sbjct  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 16. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 262.1 bits 1121,  Expect = 1e-71
 Identities = 194/263 73%, Positives = 213/263 80%, Gaps = 15/263 5%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PA  A PA A   GKA TEEQ LIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADAGYT-PAAAATPATA--GGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F AA     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L
Sbjct  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTATGPTPEAKYDAFVAAL 107
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+D+A+K+AATAANAAPANDKFT
Sbjct  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
Query  239  MSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            MSEAQK A PAA AT  AT+A  AATGA TAAAGGYKV
Sbjct  228  MSEAQKVATPAAVATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 17. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 255.7 bits 1093,  Expect = 1e-69
 Identities = 192/264 72%, Positives = 217/264 82%, Gaps = 22/264 8%
Query  1    ADLGY--GGPATPAAPAE--AAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKT 56
            AD GY     ATPA PA   AA  GKATT+EQKL+E +N GFKAA+AAAA  PPADK+K 
Sbjct  26   ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKI 85
Query  57   FVATFGAASNKAFAEGLSAEPKGAAESSSKA-ALTSKLDAAYKLAYKTAEGATPEAKYDA 115
            F A F  +S     +GL       A S++KA  L  KLD AY +AYK AEGATPEAKYDA
Sbjct  86   FEAAFSESS-----KGL------LATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDA 134
Query  116  YVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPA 173
            +V  L+EALR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+AFK+AATAANAAP 
Sbjct  135  FVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPT 194
Query  174  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 233
            NDKFTVFE+AFN A+   TGGAYE+YKFIP+LEAAVKQAYAATVA APEVKY VFE AL 
Sbjct  195  NDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALT 254
Query  234  KAITAMSEAQKAAKPAAAA-TATATSAVGAAT---GATTAAAGGYK 275
            KAITAM++AQKA KPAAAA T  AT A GAAT   GA TAAAGGYK
Sbjct  255  KAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 250.7 bits 1071,  Expect = 4e-68
 Identities = 179/263 68%, Positives = 217/263 82%, Gaps = 10/263 3%
Query  7    GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASN 66
            G   PAAP    P  KATT EQKL+E IN+GFKAA+ AAA V PADKYKTF  TF   SN
Sbjct  25   GTYAPAAPG-TQP--KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSN 81
Query  67   KAFAEGLSAEPKGA--AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEAL 124
            KAFA+ L+A   G   A+S S A L++ L+++YKLAY +AEGATPE KYD YVA+L+E+L
Sbjct  82   KAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESL 141
Query  125  RIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAF 184
            R+I+G +EVHAVKPA+EEVK +PA +L+V++++D+A++ AATAANAAP NDKF VFE++F
Sbjct  142  RVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESSF 201
Query  185  NNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 244
            N AIK +TGGAY SY F+PALE+AVKQAYAATVA+APEVKY VF+ AL KAI AM EA+K
Sbjct  202  NKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEK 261
Query  245  AAKPAAAA--TATATSAVGAATGATTAAAGGYK 275
             AKPAAAA  TATAT+ VGAA GA   AAGGYK
Sbjct  262  DAKPAAAAAATATATATVGAAAGA---AAGGYK 291

Sequence Alignment: 19. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 231.1 bits 985,  Expect = 4e-62
 Identities = 185/264 70%, Positives = 213/264 80%, Gaps = 26/264 9%
Query  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
            AD GY  PATPAA   A  AGK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  26   ADAGYA-PATPAAAGAA--AGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
Query  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
             F A+   + A+  +A+  G     S  A TS  DA YK     A GATPEAK+D++VA 
Sbjct  83   AFSASVEASAAKLNAAQAPGFV---SHVAATS--DATYK----AAVGATPEAKFDSFVAA 133
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPANDKF 177
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+D+AFKVAATAANAAPANDKF
Sbjct  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
Query  178  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
            TVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
Query  238  AMSEAQKAAKPAA-----------AATATATSAVGAATGATTAAAGGYKV 276
            AM+E QK +KP A           AAT  AT A GAATGA T +AGGYKV
Sbjct  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 230.3 bits 981,  Expect = 5e-62
 Identities = 168/238 70%, Positives = 194/238 81%, Gaps = 13/238 5%
Query  28   QKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKA 87
            QKL+E +N  FKAA+AAAA VPPADKYKTF+  F       +  G + + K  AE +   
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMP 53
Query  88   ALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV-- 145
             L+SKL  AY  A+K + G T EAKYDA+V TL+EALR+IAG LEVHAVKPA EEV    
Sbjct  54   ELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAK 113
Query  146  IPAGELQVIEKVDSAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPAL 205
            IPAG+LQV++K+D++FK+AATAANAAPANDKFTVFE AFN A+K STGGAYESYKFIP+L
Sbjct  114  IPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSL 173
Query  206  EAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAATG 265
            EAAVKQAYA+TVA APEVKY VFE AL KAITAMS+AQK A+PAAAAT  AT A GAAT 
Sbjct  174  EAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAAT- 232
Query  266  ATTAAAGGYKV 276
                AAGGYKV
Sbjct  233  ---TAAGGYKV 240

Sequence Alignment: 21. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 206.5 bits 877,  Expect = 9e-55
 Identities = 189/259 72%, Positives = 215/259 83%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA   A  AGKATTEEQKLIE IN GFKAA+AAAA VP ADK+KTF A 
Sbjct  20   ADAGYA-PATPAAAGAA--AGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAA 76
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F  +S+KA A    A+  G         L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  77   F-TSSSKAAA----AKAPG---------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 122
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  123  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 182
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  183  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 242
Query  239  MSEAQKAAKPAAAATATA----TSAVGAATGATTAAAGGYKV 276
            MSE QK ++PA  A   A    T+A GAA+GA T AAGGYKV
Sbjct  243  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 22. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 204.5 bits 868,  Expect = 3e-54
 Identities = 187/259 72%, Positives = 213/259 82%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP ADK+KTF A 
Sbjct  1    ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAA 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  58   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 103
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  104  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 163
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  164  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 223
Query  239  MSEAQKAAKPAAAATATA----TSAVGAATGATTAAAGGYKV 276
            MSE QK ++PA  A   A    T+A GAA+GA T AAGGYKV
Sbjct  224  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 23. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 204.2 bits 867,  Expect = 5e-54
 Identities = 149/210 70%, Positives = 172/210 81%, Gaps = 7/210 3%
Query  62   GAASNKAFAEGLSAEPKG--AAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
            G    KAFAE L     G  A +SSS A L+S L+ +YKLAY  A+GATPEAKYDAYVAT
Sbjct  102  GREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVAT 161
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTV 179
            L+E+LR+I+GTLEVH+VKPAAEEVK +PAGEL+ I++VD+AF+ AATAA+AAPANDKFTV
Sbjct  162  LTESLRVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVDAAFRTAATAADAAPANDKFTV 221
Query  180  FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 239
            FE+      +   GGAYESYKFIPALEAAVKQAYAATVA APEVK+TVF+TAL KAI AM
Sbjct  222  FESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAM 281
Query  240  SEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            ++A K AKPAAAATATAT A GAA     A AG YKV
Sbjct  282  TQAGKVAKPAAAATATATVAAGAA-----ATAGNYKV 313

Sequence Alignment: 24. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 204.0 bits 866,  Expect = 5e-54
 Identities = 186/259 71%, Positives = 212/259 81%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
Query  239  MSEAQKAAKPAAAATATA----TSAVGAATGATTAAAGGYKV 276
            MSE QK ++PA  A   A    T+A GAA+GA T AAGGYKV
Sbjct  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 25. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 202.0 bits 857,  Expect = 2e-53
 Identities = 185/259 71%, Positives = 210/259 81%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GF AA+AAAA VP ADK+KTF A 
Sbjct  1    ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAA 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D+ VA+L
Sbjct  58   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSLVASL 103
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  104  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 163
Query  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQ YAATVA AP+VKY VFE AL KAITA
Sbjct  164  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITA 223
Query  239  MSEAQKAAKPAAAATATA----TSAVGAATGATTAAAGGYKV 276
            MSE QK ++PA  A   A    T+A GAA+GA T AAGGYKV
Sbjct  224  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 196.9 bits 835,  Expect = 8e-52
 Identities = 151/258 58%, Positives = 180/258 69%, Gaps = 19/258 7%
Query  7    GPATPAAPAEAAP-------AGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
            GPA P  P    P       A    T   + +E IN   +    A+  VPPADK+KTF  
Sbjct  19   GPAAPTPPTPRTPPLLPPPRARDKATLTSRSVEDINAASRRPWWAS--VPPADKFKTFAD 76
Query  60   TFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 119
                  N       +  P+          L +KLDAAY++AY+ AEG+TPEAKYDA++A 
Sbjct  77   HVLCVPNADVTSAATKAPQ----------LKAKLDAAYRVAYEAAEGSTPEAKYDAFIAA 126
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTV 179
            L+EALR+IAG +EVHAVKPA EEV   P GELQ+++K+D+AFK+AATAAN+APANDKFTV
Sbjct  127  LTEALRVIAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPANDKFTV 186
Query  180  FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 239
            FE AFN AIK ST GAYE+YKFIP+LEAAVKQAY ATVA APEVKY VFE  L KAITAM
Sbjct  187  FEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAM 246
Query  240  SEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276
            SEAQK AKP  +        + A   AT AAA   +V
Sbjct  247  SEAQKVAKPPLSPQPPQVLPLAAGGAATVAAASDVRV 283

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 171.6 bits 723,  Expect = 2e-44
 Identities = 121/166 72%, Positives = 137/166 82%, Gaps = 9/166 5%
Query  111  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAA 168
            AKYDA++A L+EALR+IAG +EVHAVKPA EEV    IPAGELQ+++K+D+AFK+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  169  NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTV 227
            N+APANDKFTVFE AFN AIK   GGAYE+YKFIP+LEA+  KQAY ATVA APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  228  FETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAA------GGYKV 276
            FE  L KAITAMSEAQK AKP  + TA A  A  AA GA T AA      GGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 156.1 bits 656,  Expect = 1e-39
 Identities = 139/259 53%, Positives = 172/259 66%, Gaps = 33/259 12%
Query  4    GYGGPATPAAPAE----AAPAGK---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKT 56
            GY  PATPAA A     A PA     A T E  ++ K   G+     AA       K   
Sbjct  28   GYA-PATPAASATLATPATPAASPQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSD 84
Query  57   FVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY 116
             +      +   F + +          SS +A +SK D A+ L Y + +G + +   DA 
Sbjct  85   EI------NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DAS 135
Query  117  VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDK 176
            V ++S  + +I   +EV  +    EEVKVIPAGE++VI KV +AF  AATAA+ APANDK
Sbjct  136  VGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDK 193
Query  177  FTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAI 236
            FTVF ++FN AIK +TGGAY  YKFIP LEAAVKQAYAA+ ATAPEVKY VFETALKKAI
Sbjct  194  FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAI 253
Query  237  TAMSEAQKAAKPAAAATA-----TATSAVGAA-------TGATTAAAGGYKV 276
            +AMSEAQK AKPAAA +A     +A++A  AA       T    A AGGYKV
Sbjct  254  SAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 29. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 150.2 bits 630,  Expect = 9e-38
 Identities = 128/258 49%, Positives = 159/258 61%, Gaps = 19/258 7%
Query  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
Query  59   ATFGAASNKAFAEGLSAEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPEAKYDAY 116
              +   S+++      + P+ ++ +S+  A  L  KLD AY +AYK AE A P  +    
Sbjct  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
Query  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDSAFKVAATAANAAPAN 174
                  +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+D+AFK+AATAANAAP N
Sbjct  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
Query  175  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
Query  235  AITAMSEAQKAAKPAAAATATATSAVGAATGATTAAA 271
            AITAM++AQKA KPAAAA   AT+A   AT A TAAA
Sbjct  256  AITAMTQAQKAGKPAAAA---ATAAATVATAAATAAA 289

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 123.5 bits 513,  Expect = 9e-30
 Identities = 164/247 66%, Positives = 180/247 72%, Gaps = 43/247 17%
Query  6    GGPATPAAPA-EAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAA 64
            G P TPA PA   A AGKATT EQKLIE IN  FK   A+A   PPADKYKTF   F   
Sbjct  29   GTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFKWWPASA---PPADKYKTFETAF--- 82
Query  65   SNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEAL 124
             +KA   G S   KG             LDAAY + Y TA GATPEAKYD++V  L+EAL
Sbjct  83   -SKANIAGAST--KG-------------LDAAYSVVYNTAAGATPEAKYDSFVTALTEAL 126
Query  125  RIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSA----FKVAAT---------AANAA 171
            RI+AGTLEVHAVKPA EE   +P+ ++       S     FK+AAT         AAN+A
Sbjct  127  RIMAGTLEVHAVKPATEE--EVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTAANSA 184
Query  172  PANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETA 231
            PANDKFTVFE AFN AIK   GG  E+YKFIP+LEAAVKQAY ATVA APEVKY VFE  
Sbjct  185  PANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAG 244
Query  232  LKKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAA-----GGYKV 276
            L KAITAMSEAQK AKP   +         AA GA T AA     GGYKV
Sbjct  245  LTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV 294

Sequence Alignment: 31. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 59.9 bits 232,  Expect = 6e-11
 Identities = 69/118 58%, Positives = 82/118 69%, Gaps = 10/118 8%
Query  13   APAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEG 72
            A +  A  GKATTEEQKLIE IN  F+AA+A  A VPPADKYKTF A F  +S + +A+ 
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  73   LSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 132
            +S  P+          L  KLD  Y  AY  A+ A PE KY+A+V  +SEAL IIAGT E
Sbjct  81   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPE 130
Query  133  VHAVKPAA 140
            VHAVKP A
Sbjct  131  VHAVKPGA 138

Sequence Alignment: 32. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 59.8 bits 231,  Expect = 6e-11
 Identities = 69/118 58%, Positives = 83/118 70%, Gaps = 10/118 8%
Query  13   APAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEG 72
            A +  A  GKATTEEQKLIE +N  F+AA+A  A VPPADKYKTF A F  +S + +A+ 
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  73   LSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 132
            +S  P+          L  KLD  Y  AY  A+ A PE KY+A+V  +SEALRIIAGT E
Sbjct  75   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPE 124
Query  133  VHAVKPAA 140
            VHAVKP A
Sbjct  125  VHAVKPGA 132

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.