The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL
SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF
EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
EAQKAAKPATEATATATAAVGAATGAATAATGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB05372 Phl p 5.0104 276 1665 386.1 7.2e-109
AAC16526 Phl p 5.0106 276 1621 376.1 7.5e-106
AAC16528 Phl p 5.0108 276 1616 375.0 1.7e-105
AAC16525 Phl p 5.0105 276 1612 374.0 3.1e-105
AAC16527 Phl p 5.0107 276 1595 370.2 4.6e-104
CAA52753 Phl p 5.0101 312 1526 354.4 2.9e-99
CAD87529 Phl p 5.0109 284 1524 354.0 3.5e-99
Q40962 Phl p 5.0102 286 1465 340.5 4e-95
P22286 Poa p 5 307 1416 329.3 1e-91
P22284 Poa p 5 373 1377 320.4 6e-89
P22285 Poa p 5 333 1358 316.1 1.1e-87
AAK25823 Phl p 5 275 1287 300.0 6.2e-83
Q40237 Lol p 5 339 1142 266.8 7.1e-73
CAB10765 Hol l 5.0101 264 1109 259.4 9.6e-71
AAK62277 Dac g 5.02 265 1097 256.7 6.4e-70
AAK62276 Dac g 5.01 265 1087 254.4 3.1e-69
AAD20386 Lol p 5 301 1050 245.9 1.3e-66
CBG76811 Sec c 5.0101 292 1032 241.8 2.1e-65
Q9FPR0 Poa p 5.0101 303 960 225.4 1.9e-60
CAB10766 Hol l 5.0201 240 950 223.2 6.9e-60
Q40963 Phl p 5.0201 284 845 199.2 1.4e-52
AAC25996 Phl p 5.0204 265 838 197.6 3.8e-52
CAB05371 Phl p 5.0202 281 836 197.2 5.6e-52
9249029 Phl p 5.0205 265 827 195.1 2.2e-51
U57845 Hor v 5.0101 313 825 194.6 3.7e-51
P56164 Pha a 5 320 792 187.1 6.9e-49
P56167 Pha a 5 175 700 166.4 6.4e-43
P56165 Pha a 5 305 607 144.9 3.2e-36
Q40240 Lol p 5 308 591 141.3 4.1e-35
P56166 Pha a 5 294 503 121.2 4.2e-29
CAA76556 Phl p 6.0102 138 232 59.9 5.6e-11
P43215 Phl p 6.0101 132 231 59.8 6.1e-11
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 386.1 bits 1665,  Expect = 7e-109
 Identities = 276/276 100%, Positives = 276/276 100%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
Query  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            EAQKAAKPATEATATATAAVGAATGAATAATGGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 2. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 376.1 bits 1621,  Expect = 8e-106
 Identities = 269/276 97%, Positives = 273/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVDSA+KVAATAANAA ANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            EAQKAAKPATEATATATAAVGAATGAATAATGGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 3. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 375.0 bits 1616,  Expect = 2e-105
 Identities = 268/276 97%, Positives = 272/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVDSA+KVAATAANAA ANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKA TAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTAMS 240
Query  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            EAQKAAKPATEATATATAAVGAATGAATAATGGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 4. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 374.0 bits 1612,  Expect = 3e-105
 Identities = 268/276 97%, Positives = 272/276 98%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEA+YDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVDSALKVAATAANAA ANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAANAAPANDKFTVF 180
Query  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA S
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITATS 240
Query  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            EAQKAAKPATEATATATAAVGAATGAATAATGGYKV
Sbjct  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 5. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 370.2 bits 1595,  Expect = 5e-104
 Identities = 264/276 95%, Positives = 269/276 97%, Gaps = 0/276 0%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            FGAASNKAFAEGLSAEPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAKYDAYVATL
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVF 180
            SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVDSA+KVAATAANAA ANDKFTVF
Sbjct  121  SEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFTVF 180
Query  181  EAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
            EAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS
Sbjct  181  EAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMS 240
Query  241  EAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            EAQKAAKPA  ATATAT+AVGAATGA TAA GGYKV
Sbjct  241  EAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 6. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 354.4 bits 1526,  Expect = 3e-99
 Identities = 261/276 94%, Positives = 266/276 96%, Gaps = 11/276 3%
Query  1    ADLGYGG-----------PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
            ADLGYG            PATPAAPAEAAPAGKATTEEQKLIEKIN GFKAALAAAAGV 
Sbjct  26   ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQ 85
Query  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATP 109
            PADKY+TFVATFGAASNKAFAEGLS EPKGAAESSSK ALTSKL+AAYKLAYKT+EGATP
Sbjct  86   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 145
Query  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAAN 169
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAAN
Sbjct  146  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 205
Query  170  AAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
            AA ANDKFTVFEAAFN AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  206  AAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 265
Query  230  TALKKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            TALKKAITAMSEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  266  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 7. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 354.0 bits 1524,  Expect = 4e-99
 Identities = 259/276 93%, Positives = 266/276 96%, Gaps = 8/276 2%
Query  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
Query  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAK 112
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAK
Sbjct  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
Query  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAA 172
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAANAA 
Sbjct  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
Query  173  ANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
            ANDKFTVFEAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
Query  233  KKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            KKAITAMSEAQKAAKPA  ATATAT+AVGAATGAATAATGGYKV
Sbjct  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 8. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 340.5 bits 1465,  Expect = 4e-95
 Identities = 254/275 92%, Positives = 259/275 94%, Gaps = 12/275 4%
Query  1    ADLGYGG-----------PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
Query  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATP 109
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSK ALTSKL+AAYKLAYKT+EGATP
Sbjct  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
Query  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAAN 169
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAAN
Sbjct  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
Query  170  AAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
            AA ANDKFTVFEAAFN  IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
Query  230  TALKKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            TALKKAITAMSEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 9. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 329.3 bits 1416,  Expect = 1e-91
 Identities = 240/276 86%, Positives = 253/276 91%, Gaps = 7/276 2%
Query  1    ADLGYGGPATPAAPAE----AAPAG---KATTEEQKLIEKINDGFKAALAAAAGVPPADK 53
            ADL YG PATPAAPA     AAPAG   KATT+EQK+IEKIN GFKAA+AAA GVP A+K
Sbjct  25   ADLSYGAPATPAAPAAGYTPAAPAGAAPKATTDEQKMIEKINVGFKAAVAAAGGVPAANK 84
Query  54   YKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKY 113
            YKTFVATFGAASNKAFAE LS EPKGAA  SSK ALTSKL+AAYKLAYK++EGATPEAKY
Sbjct  85   YKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEAKY 144
Query  114  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAA 173
            D YVATLSEALRIIAGTLEVH VKPAAEEVK  PAGELQ I+KVD+A+KVAATAANAA A
Sbjct  145  DDYVATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAANAAPA 204
Query  174  NDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 233
            NDKFTVFEAAFN AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALK
Sbjct  205  NDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALK 264
Query  234  KAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            KAITAMS+AQKAAKPA  AT TATAAVGAATGAATAA GGYKV
Sbjct  265  KAITAMSQAQKAAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 10. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 320.4 bits 1377,  Expect = 6e-89
 Identities = 232/265 87%, Positives = 245/265 92%, Gaps = 2/265 0%
Query  10   TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAF 69
            TPAAPA AAP  KATT+EQKLIEKIN GFKAA+AAAAGVP A KYKTFVATFGAASNKAF
Sbjct  109  TPAAPAGAAP--KATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFVATFGAASNKAF 166
Query  70   AEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAG 129
            AE LS EPKGAA +SSK  LTSKL+AAYKLAYK++EGATPEAKYDAYVATLSEALRIIAG
Sbjct  167  AEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVATLSEALRIIAG 226
Query  130  TLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFNHAIK 189
            TLEVH VKPAAEEVK IPAGELQ I+KVD+A+KVAATAANAA ANDKFTVFEAAFN AIK
Sbjct  227  TLEVHGVKPAAEEVKAIPAGELQVIDKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIK 286
Query  190  ASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA 249
            ASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALKKAITAMS+AQKAAKPA
Sbjct  287  ASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITAMSQAQKAAKPA 346
Query  250  TEATATATAAVGAATGAATAATGGYKV 276
               T TAT+AVGAATGAATAA GGYKV
Sbjct  347  AAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 51.6 bits 198,  Expect = 5e-08
 Identities = 40/102 39%, Positives = 64/102 62%, Gaps = 16/102 15%
Query  31   IEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALT 90
            ++K N  +K AL AA+ V PA+K+  F ATF    +K + EGLS  P           + 
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATF----DKNLKEGLSG-PDAVG-------FA 48
Query  91   SKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPA 148
             KL+A  + +Y +++ A P+ K+D +V +L+E LR +AG ++     P A +    PA
Sbjct  49   KKLDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVKA----PPASKFPAKPA 102

Sequence Alignment: 11. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 316.1 bits 1358,  Expect = 1e-87
 Identities = 239/275 86%, Positives = 252/275 91%, Gaps = 20/275 7%
Query  1    ADLGYGGPAT------PAAPAE----AAPAG---KATTEEQKLIEKINDGFKAALAAAAG 47
            AD+GYG PAT      PAAPA     AAPAG   KATT+EQKLIEKIN GFKAA+AAAAG
Sbjct  26   ADVGYGAPATLATPATPAAPAAGYTPAAPAGAAPKATTDEQKLIEKINAGFKAAVAAAAG 85
Query  48   VPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGA 107
            VP  DKYKTFVATFG ASNKAFAE LS EPKGAA +SS   LTSKL+AAYKLAYK++EGA
Sbjct  86   VPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAEGA 145
Query  108  TPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATA 167
            TPEAKYDAYVATLSEALRIIAGTLEVHAVKPA EEVK IPAGELQ I+KVD+A+KVAATA
Sbjct  146  TPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFKVAATA 205
Query  168  ANAAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTV 227
            ANAA ANDKFTVFEAAFN AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTV
Sbjct  206  ANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTV 265
Query  228  FETALKKAITAMSEAQKAAKPATEATATATAAVGAATGA-------ATAATGGYK 275
            FETALKKAITAMS+AQKAAKPA   TATAT AVGAATGA       ATAA GGYK
Sbjct  266  FETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 12. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 300.0 bits 1287,  Expect = 6e-83
 Identities = 220/264 83%, Positives = 229/264 86%, Gaps = 5/264 1%
Query  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
            P  PA P    P     +       K+    KA     A VPPADKY+TFVATFGAASNK
Sbjct  12   PRPPATPPPPPPPQLGASP-----YKLGPSPKARSERPAIVPPADKYRTFVATFGAASNK 66
Query  68   AFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRII 127
            AFAEGLS EPKG AESSSK ALTSKL+AAYKLAYKT+EGATPEAKYDAYVATLSEALRII
Sbjct  67   AFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRII 126
Query  128  AGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFNHA 187
            AGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAANAA ANDKFTVFEAAFN+A
Sbjct  127  AGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNA 186
Query  188  IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK 247
            IKA TGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK
Sbjct  187  IKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAK 246
Query  248  PATEATATATAAVGAATGAATAATGGYKV 276
            PA  ATATAT+AVGA TGA TAA GGYKV
Sbjct  247  PAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 13. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 266.8 bits 1142,  Expect = 7e-73
 Identities = 197/258 76%, Positives = 218/258 84%, Gaps = 7/258 2%
Query  8    PATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNK 67
            PATPA PA A P+GKATTEEQKLIEKIN GFKAA+AAAA VPPADKYKTFV TFG A+NK
Sbjct  50   PATPATPA-AVPSGKATTEEQKLIEKINAGFKAAVAAAAVVPPADKYKTFVETFGTATNK 108
Query  68   AFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRII 127
            AF EGL++   G A+ S K  LTSKL+AA KLAY+ ++GATPEAKYDAYVATL+EALR+I
Sbjct  109  AFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAAQGATPEAKYDAYVATLTEALRVI 164
Query  128  AGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFN 185
            AGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVD+A + AATAANAA ANDKFTVFE  FN
Sbjct  165  AGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYRTAATAANAAPANDKFTVFENTFN 224
Query  186  HAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA 245
            +AIK S G AY+SYKFIP L AAVKQAYAA  ATAPEVKYTV ETALKKA+TAMSEA+K 
Sbjct  225  NAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPEVKYTVSETALKKAVTAMSEAEKE 284
Query  246  AKPATEATATATAAVGAATGAATAA 270
            A PA  ATAT T A   AT    AA
Sbjct  285  ATPAAAATATPTPAAATATATPAAA 309

Sequence Alignment: 14. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 259.4 bits 1109,  Expect = 1e-70
 Identities = 191/262 72%, Positives = 214/262 81%, Gaps = 16/262 6%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY    TPAAPA A   GKATT+EQKL+E +N GFK A+AAAA VPPADKYKTF A 
Sbjct  1    ADAGY----TPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAA 56
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F A+S  + A         AA + + G L  +L AA   AY  ++GATPEAKYDA+V TL
Sbjct  57   FTASSKASIA---------AAATKAPG-LIPQLNAATNTAYAAAQGATPEAKYDAFVTTL 106
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKPA EEV    IPAGELQ ++K+D+A+++AATAANAA  NDKFT
Sbjct  107  TEALRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFT 166
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITA
Sbjct  167  VFEGAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITA 226
Query  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            MSEAQK AKP   AT  ATAA G A GAATAA GGYKV
Sbjct  227  MSEAQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 15. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 256.7 bits 1097,  Expect = 6e-70
 Identities = 192/263 73%, Positives = 210/263 79%, Gaps = 15/263 5%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PA  A PA A   GKA TEEQKLIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADAGYT-PAAAATPAAA--GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F AA     A   +  P           + +KL+AAY +AYKT+ G TPEAKYDA+VA L
Sbjct  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAAL 107
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ ++K+D+A K+AATAANAA ANDKFT
Sbjct  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
Query  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            MSEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  228  MSEAQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 16. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 254.4 bits 1087,  Expect = 3e-69
 Identities = 191/263 72%, Positives = 209/263 79%, Gaps = 15/263 5%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PA  A PA A   GKA TEEQ LIE +N GFKAA+AAA+  PPADK+KTF AT
Sbjct  1    ADAGYT-PAAAATPATA--GGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEAT 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F AA     A   +  P           + +KL+AAY +AYKT+ G TPEAKYDA+VA L
Sbjct  58   FTAACKANIAAAATKVP----------LFVAKLDAAYAVAYKTATGPTPEAKYDAFVAAL 107
Query  121  SEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKPAAEEV    IPAGELQ ++K+D+A K+AATAANAA ANDKFT
Sbjct  108  TEALRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFT 167
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFE AFN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITA
Sbjct  168  VFEGAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITA 227
Query  239  MSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            MSEAQK A PA  AT  ATAA  AATGAATAA GGYKV
Sbjct  228  MSEAQKVATPAAVATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 17. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 245.9 bits 1050,  Expect = 1e-66
 Identities = 182/265 68%, Positives = 208/265 78%, Gaps = 20/265 7%
Query  1    ADLGY--GGPATPAAPAE--AAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKT 56
            AD GY     ATPA PA   AA  GKATT+EQKL+E +N GFKAA+AAAA  PPADK+K 
Sbjct  26   ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKI 85
Query  57   FVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAY 116
            F A F  +S   +A   +  P           L  KL+ AY +AYK +EGATPEAKYDA+
Sbjct  86   FEAAFSESSKGLLATSAAKAP----------GLIPKLDTAYDVAYKAAEGATPEAKYDAF 135
Query  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAAN 174
            V  L+EALR+IAG LEVHAVKPA EEV    IP GELQ ++K+D+A+K+AATAANAA  N
Sbjct  136  VTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
Query  175  DKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
            DKFTVFE+AFN A+   TGGAYE+YKFIP+LEAAVKQAYAATVA APEVKY VFE AL K
Sbjct  196  DKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTK 255
Query  235  AITAMSEAQKAAKPATEA-TATATAAVGAAT---GAATAATGGYK 275
            AITAM++AQKA KPA  A T  AT A GAAT   GAATAA GGYK
Sbjct  256  AITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 241.8 bits 1032,  Expect = 2e-65
 Identities = 174/263 66%, Positives = 210/263 79%, Gaps = 10/263 3%
Query  7    GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASN 66
            G   PAAP    P  KATT EQKL+E IN+GFKAA+ AAA V PADKYKTF  TF   SN
Sbjct  25   GTYAPAAPG-TQP--KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQTTFIKGSN 81
Query  67   KAFAEGLSAEPKGA--AESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEAL 124
            KAFA+ L+A   G   A+S S   L++ LE++YKLAY ++EGATPE KYD YVA+L+E+L
Sbjct  82   KAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYVASLTESL 141
Query  125  RIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAF 184
            R+I+G +EVHAVKPA+EEVK +PA +L+ ++++D+A + AATAANAA  NDKF VFE++F
Sbjct  142  RVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKFNVFESSF 201
Query  185  NHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 244
            N AIK +TGGAY SY F+PALE+AVKQAYAATVA+APEVKY VF+ AL KAI AM EA+K
Sbjct  202  NKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAINAMVEAEK 261
Query  245  AAKPATEA--TATATAAVGAATGAATAATGGYK 275
             AKPA  A  TATATA VGAA GAA    GGYK
Sbjct  262  DAKPAAAAAATATATATVGAAAGAA---AGGYK 291

Sequence Alignment: 19. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 225.4 bits 960,  Expect = 2e-60
 Identities = 180/264 68%, Positives = 212/264 80%, Gaps = 26/264 9%
Query  1    ADLGYGGPATPAAPAEAAPAGKAT-TEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
            AD GY  PATPAA   A  AGK T T+EQKL+E IN GFKAA+AAAAG PPADK+KTF A
Sbjct  26   ADAGYA-PATPAAAGAA--AGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFKTFQA 82
Query  60   TFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVAT 119
             F +AS +A A  L+A       + + G + S + A     YK + GATPEAK+D++VA 
Sbjct  83   AF-SASVEASAAKLNA-------AQAPG-FVSHVAATSDATYKAAVGATPEAKFDSFVAA 133
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAANDKF 177
            ++EALRIIAG L+VHAVKP  EE     IPAGE Q I+K+D+A+KVAATAANAA ANDKF
Sbjct  134  FTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKF 193
Query  178  TVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 237
            TVFEAAFN+AIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL KAIT
Sbjct  194  TVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAIT 253
Query  238  AMSEAQKAAKP-----------ATEATATATAAVGAATGAATAATGGYKV 276
            AM+E QK +KP           AT AT  AT A GAATGAAT + GGYKV
Sbjct  254  AMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 223.2 bits 950,  Expect = 7e-60
 Identities = 164/238 68%, Positives = 190/238 79%, Gaps = 13/238 5%
Query  28   QKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKG 87
            QKL+E +N  FKAA+AAAA VPPADKYKTF+  F       +  G + + K  AE +   
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMP 53
Query  88   ALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV-- 145
             L+SKL  AY  A+K S G T EAKYDA+V TL+EALR+IAG LEVHAVKPA EEV    
Sbjct  54   ELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAK 113
Query  146  IPAGELQFIEKVDSALKVAATAANAAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPAL 205
            IPAG+LQ ++K+D+++K+AATAANAA ANDKFTVFE AFN A+K STGGAYESYKFIP+L
Sbjct  114  IPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSL 173
Query  206  EAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPATEATATATAAVGAATG 265
            EAAVKQAYA+TVA APEVKY VFE AL KAITAMS+AQK A+PA  AT  AT A GAAT 
Sbjct  174  EAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAATT 233
Query  266  AATAATGGYKV 276
            AA    GGYKV
Sbjct  234  AA----GGYKV 240

Sequence Alignment: 21. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 199.2 bits 845,  Expect = 1e-52
 Identities = 184/259 71%, Positives = 212/259 81%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA   A  AGKATTEEQKLIE IN GFKAA+AAAA VP ADK+KTF A 
Sbjct  20   ADAGYA-PATPAAAGAA--AGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAA 76
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F ++S              AA + + G L  KL+AAY +AYK + GATPEAK+D++VA+L
Sbjct  77   FTSSSK-------------AAAAKAPG-LVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 122
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ I+K+D+A+KVAATAA  A A+DKFT
Sbjct  123  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 182
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  183  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 242
Query  239  MSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYKV 276
            MSE QK ++PAT A   A    T A GAA+GAAT A GGYKV
Sbjct  243  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 22. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 197.6 bits 838,  Expect = 4e-52
 Identities = 184/259 71%, Positives = 211/259 81%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP ADK+KTF A 
Sbjct  1    ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAA 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KL+AAY +AYK + GATPEAK+D++VA+L
Sbjct  58   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 103
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ I+K+D+A+KVAATAA  A A+DKFT
Sbjct  104  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 163
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  164  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 223
Query  239  MSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYKV 276
            MSE QK ++PAT A   A    T A GAA+GAAT A GGYKV
Sbjct  224  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 23. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 197.2 bits 836,  Expect = 6e-52
 Identities = 183/259 70%, Positives = 210/259 81%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KL+AAY +AYK + GATPEAK+D++VA+L
Sbjct  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ I+K+D+A+KVAATAA  A A+DKFT
Sbjct  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
Query  239  MSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYKV 276
            MSE QK ++PAT A   A    T A GAA+GAAT A GGYKV
Sbjct  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 24. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 195.1 bits 827,  Expect = 2e-51
 Identities = 182/259 70%, Positives = 208/259 80%, Gaps = 23/259 8%
Query  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
            AD GY  PATPAA    A AGKATTEEQKLIE IN GF AA+AAAA VP ADK+KTF A 
Sbjct  1    ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAA 57
Query  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
            F ++S  A A+     P           L  KL+AAY +AYK + GATPEAK+D+ VA+L
Sbjct  58   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSLVASL 103
Query  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ I+K+D+A+KVAATAA  A A+DKFT
Sbjct  104  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 163
Query  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQ YAATVA AP+VKY VFE AL KAITA
Sbjct  164  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITA 223
Query  239  MSEAQKAAKPATEATATA----TAAVGAATGAATAATGGYKV 276
            MSE QK ++PAT A   A    T A GAA+GAAT A GGYKV
Sbjct  224  MSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 25. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 194.6 bits 825,  Expect = 4e-51
 Identities = 145/210 69%, Positives = 169/210 80%, Gaps = 7/210 3%
Query  62   GAASNKAFAEGLSAEPKG--AAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVAT 119
            G    KAFAE L     G  A +SSS   L+S LE +YKLAY  ++GATPEAKYDAYVAT
Sbjct  102  GREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVAT 161
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTV 179
            L+E+LR+I+GTLEVH+VKPAAEEVK +PAGEL+ I++VD+A++ AATAA+AA ANDKFTV
Sbjct  162  LTESLRVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVDAAFRTAATAADAAPANDKFTV 221
Query  180  FEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 239
            FE+      +   GGAYESYKFIPALEAAVKQAYAATVA APEVK+TVF+TAL KAI AM
Sbjct  222  FESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAM 281
Query  240  SEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276
            ++A K AKPA  ATATAT A GA   AATA  G YKV
Sbjct  282  TQAGKVAKPAAAATATATVAAGA---AATA--GNYKV 313

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 187.1 bits 792,  Expect = 7e-49
 Identities = 147/251 58%, Positives = 176/251 70%, Gaps = 20/251 7%
Query  7    GPATPAAPAEAAP-------AGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVA 59
            GPA P  P    P       A    T   + +E IN   +    A+  VPPADK+KTF  
Sbjct  19   GPAAPTPPTPRTPPLLPPPRARDKATLTSRSVEDINAASRRPWWAS--VPPADKFKTFAD 76
Query  60   TFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVAT 119
                  N       +  P+          L +KL+AAY++AY+ +EG+TPEAKYDA++A 
Sbjct  77   HVLCVPNADVTSAATKAPQ----------LKAKLDAAYRVAYEAAEGSTPEAKYDAFIAA 126
Query  120  LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDKFTV 179
            L+EALR+IAG +EVHAVKPA EEV   P GELQ ++K+D+A+K+AATAAN+A ANDKFTV
Sbjct  127  LTEALRVIAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPANDKFTV 186
Query  180  FEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 239
            FE AFN AIK ST GAYE+YKFIP+LEAAVKQAY ATVA APEVKY VFE  L KAITAM
Sbjct  187  FEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAM 246
Query  240  SEAQKAAKPATEATATATAAVGAATGAATAA 270
            SEAQK AKP           + AA GAAT A
Sbjct  247  SEAQKVAKPPLSPQPPQVLPL-AAGGAATVA 276

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 166.4 bits 700,  Expect = 6e-43
 Identities = 119/166 71%, Positives = 134/166 80%, Gaps = 9/166 5%
Query  111  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAA 168
            AKYDA++A L+EALR+IAG +EVHAVKPA EEV    IPAGELQ ++K+D+A+K+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  169  NAAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTV 227
            N+A ANDKFTVFE AFN AIK   GGAYE+YKFIP+LEA+  KQAY ATVA APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  228  FETALKKAITAMSEAQKAAKPATEATATATAAVGAATGAATAAT------GGYKV 276
            FE  L KAITAMSEAQK AKP    TA A  A  AA GAAT A       GGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 144.9 bits 607,  Expect = 3e-36
 Identities = 134/258 51%, Positives = 167/258 64%, Gaps = 35/258 13%
Query  4    GYGGPATPAAPAE----AAPAGK---ATTEEQKLIEKINDGFKAALAAAAGVPPADKYKT 56
            GY  PATPAA A     A PA     A T E  ++ K   G+     AA       K   
Sbjct  28   GYA-PATPAASATLATPATPAASPQHAGTTEYHIVRKA--GLNEEKNAARQTDDEQKRSD 84
Query  57   FVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAY 116
             +      +   F + +          SS  A +SK + A+ L Y + +G + +   DA 
Sbjct  85   EI------NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DAS 135
Query  117  VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAAANDK 176
            V ++S  + +I   +EV  +    EEVKVIPAGE++ I KV +A+  AATAA+ A ANDK
Sbjct  136  VGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPANDK 193
Query  177  FTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAI 236
            FTVF ++FN AIK +TGGAY  YKFIP LEAAVKQAYAA+ ATAPEVKY VFETALKKAI
Sbjct  194  FTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKAI 253
Query  237  TAMSEAQKAAKPATEATATATAAVGAAT-----------GAAT--AATGGYKV 276
            +AMSEAQK AKPA  A + AT  + A+T           G AT  A  GGYKV
Sbjct  254  SAMSEAQKEAKPAA-AISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 29. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 141.3 bits 591,  Expect = 4e-35
 Identities = 123/257 47%, Positives = 155/257 60%, Gaps = 19/257 7%
Query  1    ADLGY--GGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFV 58
            AD GY     ATPA PA A PAG     + +  E    G +  LA+    PP      + 
Sbjct  26   ADAGYTPAAAATPATPA-ATPAGGWREGDDRRAEAA--GGRQRLASRQPWPP------LP 76
Query  59   ATFGAASNKAFAEGLSAEPKGAAESSSKGA--LTSKLEAAYKLAYKTSEGATPEAKYDAY 116
              +   S+++      + P+ ++ +S+  A  L  KL+ AY +AYK +E A P  +    
Sbjct  77   TPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPRGQVRRL 135
Query  117  VATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQFIEKVDSALKVAATAANAAAAN 174
                  +LR+IAG LEVHAVKPA EEV    IP GELQ ++K+D+A+K+AATAANAA  N
Sbjct  136  RHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTN 195
Query  175  DKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 234
            DKFTVFE+AFN A+   TGGA       P       +        APEVKY VFE AL K
Sbjct  196  DKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVFEAALTK 255
Query  235  AITAMSEAQKAAKPATEATATATAAVGAATGAATAA 270
            AITAM++AQKA KPA    A ATAA   AT AATAA
Sbjct  256  AITAMTQAQKAGKPAA---AAATAAATVATAAATAA 288

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 121.2 bits 503,  Expect = 4e-29
 Identities = 160/247 64%, Positives = 183/247 74%, Gaps = 43/247 17%
Query  6    GGPATPAAPA-EAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAA 64
            G P TPA PA   A AGKATT EQKLIE IN  FK   A+A   PPADKYKTF   F  A
Sbjct  29   GTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFKWWPASA---PPADKYKTFETAFSKA 85
Query  65   SNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEAL 124
            +               A +S+KG     L+AAY + Y T+ GATPEAKYD++V  L+EAL
Sbjct  86   N--------------IAGASTKG-----LDAAYSVVYNTAAGATPEAKYDSFVTALTEAL 126
Query  125  RIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSA----LKVAAT---------AANAA 171
            RI+AGTLEVHAVKPA EE   +P+ ++       S     +K+AAT         AAN+A
Sbjct  127  RIMAGTLEVHAVKPATEE--EVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTAANSA 184
Query  172  AANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETA 231
             ANDKFTVFE AFN AIK   GG  E+YKFIP+LEAAVKQAY ATVA APEVKY VFE  
Sbjct  185  PANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAG 244
Query  232  LKKAITAMSEAQKAAKPATEAT----ATATAAVGAAT-GAATAATGGYKV 276
            L KAITAMSEAQK AKP   +         AA GAAT  AA+ + GGYKV
Sbjct  245  LTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV 294

Sequence Alignment: 31. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 59.9 bits 232,  Expect = 6e-11
 Identities = 67/118 56%, Positives = 82/118 69%, Gaps = 10/118 8%
Query  13   APAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEG 72
            A +  A  GKATTEEQKLIE IN  F+AA+A  A VPPADKYKTF A F  +S + +A+ 
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  73   LSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGTLE 132
            +S  P+          L  KL+  Y  AY  ++ A PE KY+A+V  +SEAL IIAGT E
Sbjct  81   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPE 130
Query  133  VHAVKPAA 140
            VHAVKP A
Sbjct  131  VHAVKPGA 138

Sequence Alignment: 32. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 59.8 bits 231,  Expect = 6e-11
 Identities = 67/118 56%, Positives = 83/118 70%, Gaps = 10/118 8%
Query  13   APAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVATFGAASNKAFAEG 72
            A +  A  GKATTEEQKLIE +N  F+AA+A  A VPPADKYKTF A F  +S + +A+ 
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  73   LSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATLSEALRIIAGTLE 132
            +S  P+          L  KL+  Y  AY  ++ A PE KY+A+V  +SEALRIIAGT E
Sbjct  75   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPE 124
Query  133  VHAVKPAA 140
            VHAVKP A
Sbjct  125  VHAVKPGA 132

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.