The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD
KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP
ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
CAD87529 Phl p 5.0109 284 1722 399.1 9.5e-113
CAA52753 Phl p 5.0101 312 1668 386.8 5.4e-109
Q40962 Phl p 5.0102 286 1637 379.7 6.5e-107
AAC16527 Phl p 5.0107 276 1574 365.4 1.3e-102
AAC16526 Phl p 5.0106 276 1569 364.2 2.9e-102
AAC16528 Phl p 5.0108 276 1564 363.1 6.3e-102
AAC16525 Phl p 5.0105 276 1549 359.7 6.8e-101
P22286 Poa p 5 307 1527 354.6 2.5e-99
CAB05372 Phl p 5.0104 276 1524 354.0 3.5e-99
P22285 Poa p 5 333 1502 348.9 1.4e-97
P22284 Poa p 5 373 1482 344.3 3.9e-96
AAK25823 Phl p 5 275 1360 316.6 6.3e-88
Q40237 Lol p 5 339 1229 286.7 7.9e-79
CAB10765 Hol l 5.0101 264 1168 272.8 8.9e-75
AAK62277 Dac g 5.02 265 1155 269.9 7e-74
AAK62276 Dac g 5.01 265 1143 267.1 4.7e-73
AAD20386 Lol p 5 301 1111 259.8 8.6e-71
CBG76811 Sec c 5.0101 292 1086 254.1 4.3e-69
Q9FPR0 Poa p 5.0101 303 1023 239.7 9.5e-65
CAB10766 Hol l 5.0201 240 985 231.2 2.8e-62
Q40963 Phl p 5.0201 284 874 205.8 1.5e-54
U57845 Hor v 5.0101 313 874 205.8 1.6e-54
CAB05371 Phl p 5.0202 281 863 203.3 8.2e-54
AAC25996 Phl p 5.0204 265 861 202.9 1e-53
9249029 Phl p 5.0205 265 850 200.4 5.9e-53
P56164 Pha a 5 320 824 194.4 4.6e-51
P56167 Pha a 5 175 727 172.5 9.2e-45
P56165 Pha a 5 305 657 156.3 1.2e-39
Q40240 Lol p 5 308 648 154.3 5.2e-39
P56166 Pha a 5 294 520 125.1 3e-30
CAA76556 Phl p 6.0102 138 228 59.0 1.1e-10
P43215 Phl p 6.0101 132 227 58.8 1.2e-10
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 399.1 bits 1722,  Expect = 9e-113
 Identities = 284/284 100%, Positives = 284/284 100%, Gaps = 0/284 0%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD
Sbjct  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
Sbjct  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP
Sbjct  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV
Sbjct  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 2. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 386.8 bits 1668,  Expect = 5e-109
 Identities = 279/284 98%, Positives = 281/284 98%, Gaps = 3/284 1%
Query  1    ADLGYGPATPAAPAAGYTPA---APAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVP 57
            ADLGYGPATPAAPAAGYTPA   APA A PAGKATTEEQKLIEKINAGFKAALAAAAGV 
Sbjct  26   ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQ 85
Query  58   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 117
            PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  86   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 145
Query  118  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 177
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN
Sbjct  146  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 205
Query  178  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 237
            AAPANDKFTVFEAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  206  AAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 265
Query  238  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGAATAATGGYKV
Sbjct  266  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 3. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 275/283 97%, Positives = 278/283 98%, Gaps = 4/283 1%
Query  1    ADLGYGPATPAAPAAGYTPA---APAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVP 57
            ADLGYGPATPAAPAAGYTPA   APAGA+ AGKATTEEQKLIEKINAGFKAALA A GV 
Sbjct  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
Query  58   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 117
            PADKYRTFVATFG ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
Query  118  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 177
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN
Sbjct  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
Query  178  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 237
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
Query  238  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGAATAATGGYKV
Sbjct  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 4. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 365.4 bits 1574,  Expect = 1e-102
 Identities = 267/276 96%, Positives = 269/276 97%, Gaps = 8/276 2%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
Sbjct  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 112
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAANAAP
Sbjct  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAP 172
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  173  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKAITAMSEAQKAAKPAAAATATATSAVGAATGA TAA GGYKV
Sbjct  233  KKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 5. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 364.2 bits 1569,  Expect = 3e-102
 Identities = 266/276 96%, Positives = 269/276 97%, Gaps = 8/276 2%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
Sbjct  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 112
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAANAAP
Sbjct  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAP 172
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  173  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKAITAMSEAQKAAKPA  ATATAT+AVGAATGAATAATGGYKV
Sbjct  233  KKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 6. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 363.1 bits 1564,  Expect = 6e-102
 Identities = 265/276 96%, Positives = 268/276 97%, Gaps = 8/276 2%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK
Sbjct  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 112
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAANAAP
Sbjct  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAANAAP 172
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  173  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKA TAMSEAQKAAKPA  ATATAT+AVGAATGAATAATGGYKV
Sbjct  233  KKAFTAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 7. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 359.7 bits 1549,  Expect = 7e-101
 Identities = 263/276 95%, Positives = 268/276 97%, Gaps = 8/276 2%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEA+
Sbjct  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAE 112
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+A+KVAATAANAAP
Sbjct  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAANAAP 172
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  173  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKAITA SEAQKAAKPA  ATATAT+AVGAATGAATAATGGYKV
Sbjct  233  KKAITATSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 8. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 354.6 bits 1527,  Expect = 3e-99
 Identities = 254/282 90%, Positives = 266/282 94%, Gaps = 3/282 1%
Query  1    ADLGYG-PATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPA 59
            ADL YG PATPAAPAAGYTPAAPAGA P  KATT+EQK+IEKIN GFKAA+AAA GVP A
Sbjct  25   ADLSYGAPATPAAPAAGYTPAAPAGAAP--KATTDEQKMIEKINVGFKAAVAAAGGVPAA 82
Query  60   DKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEA 119
            +KY+TFVATFGAASNKAFAE LS EPKGAA  SSKAALTSKLDAAYKLAYK+AEGATPEA
Sbjct  83   NKYKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGATPEA 142
Query  120  KYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAA 179
            KYD YVATLSEALRIIAGTLEVH VKPAAEEVK  PAGELQVI+KVDAAFKVAATAANAA
Sbjct  143  KYDDYVATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAANAA 202
Query  180  PANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETA 239
            PANDKFTVFEAAFN+AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETA
Sbjct  203  PANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETA 262
Query  240  LKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            LKKAITAMS+AQKAAKPAAAAT TAT+AVGAATGAATAA GGYKV
Sbjct  263  LKKAITAMSQAQKAAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 9. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 354.0 bits 1524,  Expect = 4e-99
 Identities = 259/276 93%, Positives = 266/276 96%, Gaps = 8/276 2%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            ADLGYG      PA   TPAAPA A PAGKATTEEQKLIEKIN GFKAALAAAAGVPPAD
Sbjct  1    ADLGYG-----GPA---TPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPAD 52
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            KY+TFVATFGAASNKAFAEGLS EPKGAAESSSK ALTSKL+AAYKLAYKT+EGATPEAK
Sbjct  53   KYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAK 112
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAP 180
            YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAANAA 
Sbjct  113  YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAANAAA 172
Query  181  ANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 240
            ANDKFTVFEAAFN+AIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL
Sbjct  173  ANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 232
Query  241  KKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            KKAITAMSEAQKAAKPA  ATATAT+AVGAATGAATAATGGYKV
Sbjct  233  KKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 10. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 348.9 bits 1502,  Expect = 1e-97
 Identities = 255/281 90%, Positives = 266/281 94%, Gaps = 16/281 5%
Query  1    ADLGYG-------PATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAA 53
            AD+GYG       PATPAAPAAGYTPAAPAGA P  KATT+EQKLIEKINAGFKAA+AAA
Sbjct  26   ADVGYGAPATLATPATPAAPAAGYTPAAPAGAAP--KATTDEQKLIEKINAGFKAAVAAA 83
Query  54   AGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAE 113
            AGVP  DKY+TFVATFG ASNKAFAE LS EPKGAA +SS A LTSKLDAAYKLAYK+AE
Sbjct  84   AGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYKSAE 143
Query  114  GATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAA 173
            GATPEAKYDAYVATLSEALRIIAGTLEVHAVKPA EEVK IPAGELQVI+KVDAAFKVAA
Sbjct  144  GATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFKVAA 203
Query  174  TAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKY 233
            TAANAAPANDKFTVFEAAFN+AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKY
Sbjct  204  TAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKY 263
Query  234  TVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGA-------ATAATGGYK 283
            TVFETALKKAITAMS+AQKAAKPAAA TATAT AVGAATGA       ATAA GGYK
Sbjct  264  TVFETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 11. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 344.3 bits 1482,  Expect = 4e-96
 Identities = 247/276 89%, Positives = 257/276 93%, Gaps = 2/276 0%
Query  7    PATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFV 66
            PA PA   A YTPAAPAGA P  KATT+EQKLIEKIN GFKAA+AAAAGVP A KY+TFV
Sbjct  98   PAKPAPKVAAYTPAAPAGAAP--KATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTFV 155
Query  67   ATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVA 126
            ATFGAASNKAFAE LS EPKGAA +SSKA LTSKLDAAYKLAYK+AEGATPEAKYDAYVA
Sbjct  156  ATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYVA 215
Query  127  TLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFT 186
            TLSEALRIIAGTLEVH VKPAAEEVK IPAGELQVI+KVDAAFKVAATAANAAPANDKFT
Sbjct  216  TLSEALRIIAGTLEVHGVKPAAEEVKAIPAGELQVIDKVDAAFKVAATAANAAPANDKFT 275
Query  187  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 246
            VFEAAFN+AIKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALKKAITA
Sbjct  276  VFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKAITA 335
Query  247  MSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            MS+AQKAAKPAAA T TATSAVGAATGAATAA GGYKV
Sbjct  336  MSQAQKAAKPAAAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 52.8 bits 203,  Expect = 2e-08
 Identities = 38/90 42%, Positives = 59/90 65%, Gaps = 12/90 13%
Query  39   IEKINAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALT 98
            ++K N  +K AL AA+ V PA+K+  F ATF    +K + EGLSG P           + 
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATF----DKNLKEGLSG-PDAVG-------FA 48
Query  99   SKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 140
             KLDA  + +Y + + A P+ K+D +V +L+E LR +AG ++
Sbjct  49   KKLDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVK 90

Sequence Alignment: 12. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 316.6 bits 1360,  Expect = 6e-88
 Identities = 237/266 89%, Positives = 238/266 89%, Gaps = 13/266 4%
Query  7    PATPAAPAAGYTPAAPA-GAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTF 65
            P  P  PA    P  P  GA P             K+    KA     A VPPADKYRTF
Sbjct  9    PQLPRPPATPPPPPPPQLGASPY------------KLGPSPKARSERPAIVPPADKYRTF 56
Query  66   VATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYV 125
            VATFGAASNKAFAEGLSGEPKG AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYV
Sbjct  57   VATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYV 116
Query  126  ATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKF 185
            ATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKF
Sbjct  117  ATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKF 176
Query  186  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 245
            TVFEAAFNNAIKA TGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT
Sbjct  177  TVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 236
Query  246  AMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            AMSEAQKAAKPAAAATATATSAVGA TGA TAA GGYKV
Sbjct  237  AMSEAQKAAKPAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 13. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 286.7 bits 1229,  Expect = 8e-79
 Identities = 214/274 78%, Positives = 232/274 84%, Gaps = 14/274 5%
Query  1    ADLGYGPATPAAPAA---GYTPAAPA-----GAEPAGKATTEEQKLIEKINAGFKAALAA 52
            AD GY PATPA PAA     TPA PA      A P+GKATTEEQKLIEKINAGFKAA+AA
Sbjct  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
Query  53   AAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTA 112
            AA VPPADKY+TFV TFG A+NKAF EGL+    G A+ S K  LTSKLDAA KLAY+ A
Sbjct  86   AAVVPPADKYKTFVETFGTATNKAFVEGLAS---GYADQS-KNQLTSKLDAALKLAYEAA 141
Query  113  EGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK 170
            +GATPEAKYDAYVATL+EALR+IAGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVDAA++
Sbjct  142  QGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYR 201
Query  171  VAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPE 230
             AATAANAAPANDKFTVFE  FNNAIK S G AY+SYKFIP L AAVKQAYAA  ATAPE
Sbjct  202  TAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPE 261
Query  231  VKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAA 278
            VKYTV ETALKKA+TAMSEA+K A PAAAATAT T A   AT    AA
Sbjct  262  VKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAA 309

Sequence Alignment: 14. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 272.8 bits 1168,  Expect = 9e-75
 Identities = 193/260 74%, Positives = 216/260 83%, Gaps = 12/260 4%
Query  15   AGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASN 74
            AGYTPAAPA A   GKATT+EQKL+E +NAGFK A+AAAA VPPADKY+TF A F A+S 
Sbjct  3    AGYTPAAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTASSK 62
Query  75   KAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRI 134
             + A   +  P           L  +L+AA   AY  A+GATPEAKYDA+V TL+EALR+
Sbjct  63   ASIAAAATKAP----------GLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRV 112
Query  135  IAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAF 192
            IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++AATAANAAP NDKFTVFE AF
Sbjct  113  IAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAF 172
Query  193  NNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 252
            N AIK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK
Sbjct  173  NKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 232
Query  253  AAKPAAAATATATSAVGAATGAATAATGGYKV 284
             AKP AAAT  AT+A G A GAATAA GGYKV
Sbjct  233  EAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 15. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 269.9 bits 1155,  Expect = 7e-74
 Identities = 196/260 75%, Positives = 215/260 82%, Gaps = 13/260 5%
Query  15   AGYTPAAPAG-AEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAAS 73
            AGYTPAA A  A   GKA TEEQKLIE +NAGFKAA+AAA+  PPADK++TF ATF AA 
Sbjct  3    AGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAAC 62
Query  74   NKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALR 133
                A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EALR
Sbjct  63   KANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALR 112
Query  134  IIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAA 191
            +IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
Query  192  FNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQ 251
            FN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSEAQ
Sbjct  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
Query  252  KAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            K A PAAAAT  AT+A  AATGAATAA GGYKV
Sbjct  233  KVATPAAAATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 16. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 267.1 bits 1143,  Expect = 5e-73
 Identities = 194/260 74%, Positives = 213/260 81%, Gaps = 13/260 5%
Query  15   AGYTPAAPAG-AEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAAS 73
            AGYTPAA A  A   GKA TEEQ LIE +NAGFKAA+AAA+  PPADK++TF ATF AA 
Sbjct  3    AGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTAAC 62
Query  74   NKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALR 133
                A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EALR
Sbjct  63   KANIAAAATKVP----------LFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALR 112
Query  134  IIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAA 191
            +IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE A
Sbjct  113  VIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGA 172
Query  192  FNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQ 251
            FN AIK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSEAQ
Sbjct  173  FNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQ 232
Query  252  KAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            K A PAA AT  AT+A  AATGAATAA GGYKV
Sbjct  233  KVATPAAVATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 17. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 259.8 bits 1111,  Expect = 9e-71
 Identities = 197/267 73%, Positives = 222/267 83%, Gaps = 24/267 8%
Query  1    ADLGYGPATPAAPAAGYTPAA-PAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPA 59
            AD GY PA  A PA   TPAA PA A   GKATT+EQKL+E +NAGFKAA+AAAA  PPA
Sbjct  26   ADAGYTPAAAATPA---TPAATPAAA--GGKATTDEQKLLEDVNAGFKAAVAAAANAPPA 80
Query  60   DKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKA-ALTSKLDAAYKLAYKTAEGATPE 118
            DK++ F A F  +S     +GL       A S++KA  L  KLD AY +AYK AEGATPE
Sbjct  81   DKFKIFEAAFSESS-----KGL------LATSAAKAPGLIPKLDTAYDVAYKAAEGATPE 129
Query  119  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 176
            AKYDA+V  L+EALR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAA
Sbjct  130  AKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAA 189
Query  177  NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 236
            NAAP NDKFTVFE+AFN A+   TGGAYE+YKFIP+LEAAVKQAYAATVA APEVKY VF
Sbjct  190  NAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVF 249
Query  237  ETALKKAITAMSEAQKAAKPAAAA-TATATSAVGAAT---GAATAATGGYK 283
            E AL KAITAM++AQKA KPAAAA T  AT A GAAT   GAATAA GGYK
Sbjct  250  EAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 254.1 bits 1086,  Expect = 4e-69
 Identities = 181/270 67%, Positives = 219/270 81%, Gaps = 10/270 3%
Query  8    ATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVA 67
            A PA     Y PAAP G +P  KATT EQKL+E IN GFKAA+ AAA V PADKY+TF  
Sbjct  18   AGPAVSYGTYAPAAP-GTQP--KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKTFQT 74
Query  68   TFGAASNKAFAEGLSGEPKGA--AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYV 125
            TF   SNKAFA+ L+    G   A+S S A L++ L+++YKLAY +AEGATPE KYD YV
Sbjct  75   TFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYDTYV 134
Query  126  ATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKF 185
            A+L+E+LR+I+G +EVHAVKPA+EEVK +PA +L+V++++DAA++ AATAANAAP NDKF
Sbjct  135  ASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTNDKF 194
Query  186  TVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAIT 245
             VFE++FN AIK +TGGAY SY F+PALE+AVKQAYAATVA+APEVKY VF+ AL KAI 
Sbjct  195  NVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSKAIN 254
Query  246  AMSEAQKAAKPAAAA--TATATSAVGAATGAATAATGGYK 283
            AM EA+K AKPAAAA  TATAT+ VGAA GAA    GGYK
Sbjct  255  AMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYK 291

Sequence Alignment: 19. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 239.7 bits 1023,  Expect = 9e-65
 Identities = 185/270 68%, Positives = 215/270 79%, Gaps = 24/270 8%
Query  6    GPATPAAPAAGYTPAAPAGA-EPAGKAT-TEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
            GPA   A  AGY PA PA A   AGK T T+EQKL+E IN GFKAA+AAAAG PPADK++
Sbjct  19   GPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFK 78
Query  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
            TF A F +AS +A A  L+     AA++     + S + A     YK A GATPEAK+D+
Sbjct  79   TFQAAF-SASVEASAAKLN-----AAQAP---GFVSHVAATSDATYKAAVGATPEAKFDS 129
Query  124  YVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPA 181
            +VA ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+DAAFKVAATAANAAPA
Sbjct  130  FVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPA 189
Query  182  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 241
            NDKFTVFEAAFNNAIK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ AL 
Sbjct  190  NDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALT 249
Query  242  KAITAMSEAQKAAKPAA-----------AATATATSAVGAATGAATAATGGYKV 284
            KAITAM+E QK +KP A           AAT  AT A GAATGAAT + GGYKV
Sbjct  250  KAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 231.2 bits 985,  Expect = 3e-62
 Identities = 169/238 71%, Positives = 195/238 81%, Gaps = 13/238 5%
Query  36   QKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKA 95
            QKL+E +NA FKAA+AAAA VPPADKY+TF+  F       +  G + + K  AE +   
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMP 53
Query  96   ALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV-- 153
             L+SKL  AY  A+K + G T EAKYDA+V TL+EALR+IAG LEVHAVKPA EEV    
Sbjct  54   ELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAK 113
Query  154  IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPAL 213
            IPAG+LQV++K+DA+FK+AATAANAAPANDKFTVFE AFN A+K STGGAYESYKFIP+L
Sbjct  114  IPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSL 173
Query  214  EAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATSAVGAATG 273
            EAAVKQAYA+TVA APEVKY VFE AL KAITAMS+AQK A+PAAAAT  AT A GAAT 
Sbjct  174  EAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAATT 233
Query  274  AATAATGGYKV 284
            AA    GGYKV
Sbjct  234  AA----GGYKV 240

Sequence Alignment: 21. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 205.8 bits 874,  Expect = 1e-54
 Identities = 187/265 70%, Positives = 212/265 80%, Gaps = 21/265 7%
Query  6    GPATPAAPAAGYTPAAPAGA-EPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRT 64
            GP       AGY PA PA A   AGKATTEEQKLIE IN GFKAA+AAAA VP ADK++T
Sbjct  13   GPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKT 72
Query  65   FVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY 124
            F A F  +S+KA A    G             L  KLDAAY +AYK A GATPEAK+D++
Sbjct  73   FEAAF-TSSSKAAAAKAPG-------------LVPKLDAAYSVAYKAAVGATPEAKFDSF 118
Query  125  VATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPAN 182
            VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  APA+
Sbjct  119  VASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPAD 178
Query  183  DKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 242
            DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL K
Sbjct  179  DKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTK 238
Query  243  AITAMSEAQKAAKPAAAATATA----TSAVGAATGAATAATGGYKV 284
            AITAMSE QK ++PA  A   A    T+A GAA+GAAT A GGYKV
Sbjct  239  AITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 22. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 205.8 bits 874,  Expect = 2e-54
 Identities = 152/210 72%, Positives = 174/210 82%, Gaps = 7/210 3%
Query  70   GAASNKAFAEGLSGEPKG--AAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVAT 127
            G    KAFAE L G   G  A +SSS A L+S L+ +YKLAY  A+GATPEAKYDAYVAT
Sbjct  102  GREFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVAT 161
Query  128  LSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTV 187
            L+E+LR+I+GTLEVH+VKPAAEEVK +PAGEL+ I++VDAAF+ AATAA+AAPANDKFTV
Sbjct  162  LTESLRVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVDAAFRTAATAADAAPANDKFTV 221
Query  188  FEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAM 247
            FE+      +   GGAYESYKFIPALEAAVKQAYAATVA APEVK+TVF+TAL KAI AM
Sbjct  222  FESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAM 281
Query  248  SEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284
            ++A K AKPAAAATATAT A GA   AATA  G YKV
Sbjct  282  TQAGKVAKPAAAATATATVAAGA---AATA--GNYKV 313

Sequence Alignment: 23. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 203.3 bits 863,  Expect = 8e-54
 Identities = 188/264 71%, Positives = 214/264 81%, Gaps = 23/264 8%
Query  6    GPATPAAPAAGYTPAAPA--GAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
            GP    A  AGY PA PA  GAE AGKATTEEQKLIE IN GFKAA+AAAA VP  DK++
Sbjct  10   GPGRSYAADAGYAPATPAAAGAE-AGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFK 68
Query  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
            TF A F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D+
Sbjct  69   TFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDS 114
Query  124  YVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPA 181
            +VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  APA
Sbjct  115  FVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPA 174
Query  182  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 241
            +DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL 
Sbjct  175  DDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALT 234
Query  242  KAITAMSEAQKAAKPAAAATATA----TSAVGAATGAATAATGGYKV 284
            KAITAMSE QK ++PA  A   A    T+A GAA+GAAT A GGYKV
Sbjct  235  KAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 24. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 202.9 bits 861,  Expect = 1e-53
 Identities = 190/259 73%, Positives = 216/259 83%, Gaps = 31/259 11%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            AD GY PATPAA          AGAE AGKATTEEQKLIE IN GFKAA+AAAA VP AD
Sbjct  1    ADAGYAPATPAA----------AGAE-AGKATTEEQKLIEDINVGFKAAVAAAASVPAAD 49
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            K++TF A F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK
Sbjct  50   KFKTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAK 95
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANA 178
            +D++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  
Sbjct  96   FDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAAT 155
Query  179  APANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET 238
            APA+DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE 
Sbjct  156  APADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEA 215
Query  239  ALKKAITAMSEAQKAAKPAAAATATA----TSAVGAATGAATAATGGYKV 284
            AL KAITAMSE QK ++PA  A   A    T+A GAA+GAAT A GGYKV
Sbjct  216  ALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 25. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 200.4 bits 850,  Expect = 6e-53
 Identities = 188/259 72%, Positives = 213/259 82%, Gaps = 31/259 11%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            AD GY PATPAA          AGAE AGKATTEEQKLIE IN GF AA+AAAA VP AD
Sbjct  1    ADAGYAPATPAA----------AGAE-AGKATTEEQKLIEDINVGFNAAVAAAASVPAAD 49
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAK 120
            K++TF A F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK
Sbjct  50   KFKTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAK 95
Query  121  YDAYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANA 178
            +D+ VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  
Sbjct  96   FDSLVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAAT 155
Query  179  APANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET 238
            APA+DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQ YAATVA AP+VKY VFE 
Sbjct  156  APADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEA 215
Query  239  ALKKAITAMSEAQKAAKPAAAATATA----TSAVGAATGAATAATGGYKV 284
            AL KAITAMSE QK ++PA  A   A    T+A GAA+GAAT A GGYKV
Sbjct  216  ALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 194.4 bits 824,  Expect = 5e-51
 Identities = 155/256 60%, Positives = 183/256 71%, Gaps = 19/256 7%
Query  6    GPATPAAPAAGYTPAAPAGAEP--AGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
            GPA P  P    TP  P    P  A    T   + +E INA  +    A+  VPPADK++
Sbjct  19   GPAAPTPP----TPRTPPLLPPPRARDKATLTSRSVEDINAASRRPWWAS--VPPADKFK 72
Query  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
            TF        N       +  P+          L +KLDAAY++AY+ AEG+TPEAKYDA
Sbjct  73   TFADHVLCVPNADVTSAATKAPQ----------LKAKLDAAYRVAYEAAEGSTPEAKYDA 122
Query  124  YVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPAND 183
            ++A L+EALR+IAG +EVHAVKPA EEV   P GELQ+++K+DAAFK+AATAAN+APAND
Sbjct  123  FIAALTEALRVIAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPAND 182
Query  184  KFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKA 243
            KFTVFE AFN AIK ST GAYE+YKFIP+LEAAVKQAY ATVA APEVKY VFE  L KA
Sbjct  183  KFTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKA 242
Query  244  ITAMSEAQKAAKPAAAATATATSAVGAATGAATAA 278
            ITAMSEAQK AKP  +        + AA GAAT A
Sbjct  243  ITAMSEAQKVAKPPLSPQPPQVLPL-AAGGAATVA 276

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 172.5 bits 727,  Expect = 9e-45
 Identities = 122/166 73%, Positives = 137/166 82%, Gaps = 9/166 5%
Query  119  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 176
            AKYDA++A L+EALR+IAG +EVHAVKPA EEV    IPAGELQ+++K+DAAFK+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  177  NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTV 235
            N+APANDKFTVFE AFN AIK   GGAYE+YKFIP+LEA+  KQAY ATVA APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  236  FETALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAAT------GGYKV 284
            FE  L KAITAMSEAQK AKP  + TA A  A  AA GAAT A       GGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 156.3 bits 657,  Expect = 1e-39
 Identities = 146/265 55%, Positives = 178/265 67%, Gaps = 29/265 10%
Query  4    GYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
            GY PATPAA A   TPA PA A P   A T E  ++ K  AG+     AA       K  
Sbjct  28   GYAPATPAASATLATPATPA-ASPQ-HAGTTEYHIVRK--AGLNEEKNAARQTDDEQKRS 83
Query  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
              +      +   F + +          SS +A +SK D A+ L Y + +G + +   DA
Sbjct  84   DEI------NCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DA 134
Query  124  YVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPAND 183
             V ++S  + +I   +EV  +    EEVKVIPAGE++VI KV AAF  AATAA+ APAND
Sbjct  135  SVGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPAND 192
Query  184  KFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKA 243
            KFTVF ++FN AIK +TGGAY  YKFIP LEAAVKQAYAA+ ATAPEVKY VFETALKKA
Sbjct  193  KFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALKKA 252
Query  244  ITAMSEAQKAAKPAAAATATATSAVGAAT-----------GAAT--AATGGYKV 284
            I+AMSEAQK AKPAAA +A AT+ + A+T           G AT  A  GGYKV
Sbjct  253  ISAMSEAQKEAKPAAAISA-ATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 29. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 154.3 bits 648,  Expect = 5e-39
 Identities = 134/259 51%, Positives = 162/259 62%, Gaps = 21/259 8%
Query  1    ADLGYGPATPAAPAAGYTPAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPAD 60
            AD GY   TPAA A   TPA PA A PAG     + +  E   AG +  LA+    PP  
Sbjct  26   ADAGY---TPAAAA---TPATPA-ATPAGGWREGDDRRAE--AAGGRQRLASRQPWPP-- 74
Query  61   KYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPE 118
                +   +   S+++        P+ ++ +S+  A  L  KLD AY +AYK AE A P 
Sbjct  75   ----LPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
Query  119  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 176
             +          +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAA
Sbjct  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
Query  177  NAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 236
            NAAP NDKFTVFE+AFN A+   TGGA       P       +        APEVKY VF
Sbjct  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
Query  237  ETALKKAITAMSEAQKAAKPAAAA-TATATSAVGAATGAA 275
            E AL KAITAM++AQKA KPAAAA TA AT A  AAT AA
Sbjct  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 125.1 bits 520,  Expect = 3e-30
 Identities = 166/254 65%, Positives = 189/254 74%, Gaps = 47/254 18%
Query  6    GPATPAAPAAGY--TPAAPA--GAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADK 61
            GPA   A  AG   TPA PA  GA  AGKATT EQKLIE INA FK   A+A   PPADK
Sbjct  19   GPAASYAADAGTPPTPATPAVPGAA-AGKATTHEQKLIEDINAAFKWWPASA---PPADK 74
Query  62   YRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 121
            Y+TF   F  A+       ++G            A T  LDAAY + Y TA GATPEAKY
Sbjct  75   YKTFETAFSKAN-------IAG------------ASTKGLDAAYSVVYNTAAGATPEAKY 115
Query  122  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAA----FKVAAT--- 174
            D++V  L+EALRI+AGTLEVHAVKPA EE   +P+ ++       +     FK+AAT   
Sbjct  116  DSFVTALTEALRIMAGTLEVHAVKPATEE--EVPSAKILRANSRSSTRSSRFKIAATVAT 173
Query  175  ------AANAAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATA 228
                  AAN+APANDKFTVFE AFN AIK   GG  E+YKFIP+LEAAVKQAY ATVA A
Sbjct  174  PLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARA 233
Query  229  PEVKYTVFETALKKAITAMSEAQKAAKPAAAAT----ATATSAVGAAT-GAATAATGGYK 283
            PEVKY VFE  L KAITAMSEAQK AKP   +         +A GAAT  AA+ + GGYK
Sbjct  234  PEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYK 293
Query  284  V 284
            V
Sbjct  294  V 294

Sequence Alignment: 31. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 59.0 bits 228,  Expect = 1e-10
 Identities = 68/118 57%, Positives = 82/118 69%, Gaps = 10/118 8%
Query  21   APAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEG 80
            A +     GKATTEEQKLIE INA F+AA+A  A VPPADKY+TF A F  +S + +A+ 
Sbjct  21   ATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 80
Query  81   LSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 140
            +S  P+          L  KLD  Y  AY  A+ A PE KY+A+V  +SEAL IIAGT E
Sbjct  81   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPE 130
Query  141  VHAVKPAA 148
            VHAVKP A
Sbjct  131  VHAVKPGA 138

Sequence Alignment: 32. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 58.8 bits 227,  Expect = 1e-10
 Identities = 68/118 57%, Positives = 83/118 70%, Gaps = 10/118 8%
Query  21   APAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYRTFVATFGAASNKAFAEG 80
            A +     GKATTEEQKLIE +NA F+AA+A  A VPPADKY+TF A F  +S + +A+ 
Sbjct  15   ATSPTAEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADA 74
Query  81   LSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 140
            +S  P+          L  KLD  Y  AY  A+ A PE KY+A+V  +SEALRIIAGT E
Sbjct  75   VSKAPQ----------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPE 124
Query  141  VHAVKPAA 148
            VHAVKP A
Sbjct  125  VHAVKPGA 132

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.