The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP
ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE
AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA
APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET
ALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
Q40962 Phl p 5.0102 286 1741 403.4 4.8e-114
CAA52753 Phl p 5.0101 312 1676 388.6 1.5e-109
CAD87529 Phl p 5.0109 284 1637 379.7 6.5e-107
AAC16526 Phl p 5.0106 276 1507 350.1 5.2e-98
AAC16527 Phl p 5.0107 276 1504 349.4 8.4e-98
AAC16528 Phl p 5.0108 276 1502 349.0 1.2e-97
AAC16525 Phl p 5.0105 276 1487 345.5 1.2e-96
P22286 Poa p 5 307 1475 342.8 9.4e-96
CAB05372 Phl p 5.0104 276 1465 340.5 4e-95
P22285 Poa p 5 333 1446 336.1 1e-93
P22284 Poa p 5 373 1418 329.7 9.6e-92
AAK25823 Phl p 5 275 1319 307.2 4.1e-85
Q40237 Lol p 5 339 1202 280.5 5.7e-77
CAB10765 Hol l 5.0101 264 1116 261.0 3.3e-71
AAK62277 Dac g 5.02 265 1101 257.6 3.6e-70
AAD20386 Lol p 5 301 1094 255.9 1.3e-69
AAK62276 Dac g 5.01 265 1090 255.1 2e-69
CBG76811 Sec c 5.0101 292 1057 247.5 4.2e-67
Q9FPR0 Poa p 5.0101 303 1000 234.5 3.6e-63
CAB10766 Hol l 5.0201 240 949 223.0 8.5e-60
U57845 Hor v 5.0101 313 874 205.8 1.7e-54
Q40963 Phl p 5.0201 284 873 205.6 1.7e-54
CAB05371 Phl p 5.0202 281 858 202.2 1.8e-53
AAC25996 Phl p 5.0204 265 852 200.8 4.4e-53
9249029 Phl p 5.0205 265 841 198.3 2.5e-52
P56164 Pha a 5 320 838 197.6 5e-52
P56167 Pha a 5 175 721 171.2 2.4e-44
P56165 Pha a 5 305 653 155.4 2.4e-39
Q40240 Lol p 5 308 645 153.6 8.4e-39
P56166 Pha a 5 294 504 121.4 3.8e-29
P43215 Phl p 6.0101 132 212 55.4 1.3e-09
CAA76556 Phl p 6.0102 138 205 53.8 4.2e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 403.4 bits 1741,  Expect = 5e-114
 Identities = 286/286 100%, Positives = 286/286 100%, Gaps = 0/286 0%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP 60
            ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP
Sbjct  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP 60
Query  61   ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE 120
            ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE
Sbjct  61   ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE 120
Query  121  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA 180
            AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA
Sbjct  121  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA 180
Query  181  APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET 240
            APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET
Sbjct  181  APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET 240
Query  241  ALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            ALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Sbjct  241  ALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 2. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 388.6 bits 1676,  Expect = 2e-109
 Identities = 280/286 97%, Positives = 280/286 97%, Gaps = 1/286 0%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYGPATPAAPAAGYTPATPAAPA A  AGKATTEEQKLIEKINAGFKAALA A GVQ
Sbjct  26   ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQ 85
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKYRTFVATFG ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  86   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 145
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN
Sbjct  146  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 205
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFND IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  206  AAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 265
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Sbjct  266  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 3. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 379.7 bits 1637,  Expect = 6e-107
 Identities = 275/283 97%, Positives = 278/283 98%, Gaps = 4/283 1%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYGPATPAAPAAGYT   PAAPAGA+ AGKATTEEQKLIEKINAGFKAALA A GV 
Sbjct  1    ADLGYGPATPAAPAAGYT---PAAPAGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVP 57
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKYRTFVATFG ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  58   PADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 117
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN
Sbjct  118  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 177
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  178  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 237
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGAATAATGGYKV
Sbjct  238  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 4. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 350.1 bits 1507,  Expect = 5e-98
 Identities = 260/275 94%, Positives = 263/275 95%, Gaps = 12/275 4%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYG-----------GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAAN
Sbjct  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN 169
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITAMSEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  230  TALKKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 5. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 349.4 bits 1504,  Expect = 8e-98
 Identities = 259/275 94%, Positives = 263/275 95%, Gaps = 12/275 4%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYG-----------GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAAN
Sbjct  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN 169
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITAMSEAQKAAKPAAAATATAT+AVGAATGA TAA GGYKV
Sbjct  230  TALKKAITAMSEAQKAAKPAAAATATATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 6. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 349.0 bits 1502,  Expect = 1e-97
 Identities = 259/275 94%, Positives = 262/275 95%, Gaps = 12/275 4%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYG-----------GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+AFKVAATAAN
Sbjct  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSAFKVAATAAN 169
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKA TAMSEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  230  TALKKAFTAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 7. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 345.5 bits 1487,  Expect = 1e-96
 Identities = 257/275 93%, Positives = 262/275 95%, Gaps = 12/275 4%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYG-----------GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP
Sbjct  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 109
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EA+YDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVD+A+KVAATAAN
Sbjct  110  EAEYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDSALKVAATAAN 169
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AAPANDKFTVFEAAFN+ IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  170  AAPANDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITA SEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  230  TALKKAITATSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 8. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 342.8 bits 1475,  Expect = 9e-96
 Identities = 252/281 89%, Positives = 262/281 93%, Gaps = 7/281 2%
Query  1    ADLGYG-PATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQ 59
            ADL YG PATPAAPAAGYT   PAAPAGA  A KATT+EQK+IEKIN GFKAA+A AG  
Sbjct  25   ADLSYGAPATPAAPAAGYT---PAAPAGA--APKATTDEQKMIEKINVGFKAAVAAAGGV 79
Query  60   PA-DKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGAT 118
            PA +KY+TFVATFG ASNKAFAE LS EPKGAA  SSKAALTSKLDAAYKLAYK+AEGAT
Sbjct  80   PAANKYKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEGAT 139
Query  119  PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAA 178
            PEAKYD YVATLSEALRIIAGTLEVH VKPAAEEVK  PAGELQVI+KVDAAFKVAATAA
Sbjct  140  PEAKYDDYVATLSEALRIIAGTLEVHGVKPAAEEVKATPAGELQVIDKVDAAFKVAATAA 199
Query  179  NAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 238
            NAAPANDKFTVFEAAFND IKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVF
Sbjct  200  NAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVF 259
Query  239  ETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            ETALKKAITAMS+AQKAAKPAAAAT TATAAVGAATGAATAA GGYKV
Sbjct  260  ETALKKAITAMSQAQKAAKPAAAATGTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 9. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 340.5 bits 1465,  Expect = 4e-95
 Identities = 254/275 92%, Positives = 259/275 94%, Gaps = 12/275 4%
Query  1    ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQ 59
            ADLGYG            PATPAAPA A  AGKATTEEQKLIEKIN GFKAALA A GV 
Sbjct  1    ADLGYG-----------GPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVP 49
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATP 119
            PADKY+TFVATFG ASNKAFAEGLS EPKGAAESSSK ALTSKL+AAYKLAYKT+EGATP
Sbjct  50   PADKYKTFVATFGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATP 109
Query  120  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAAN 179
            EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQ IEKVD+A+KVAATAAN
Sbjct  110  EAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQFIEKVDSALKVAATAAN 169
Query  180  AAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 239
            AA ANDKFTVFEAAFN  IKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE
Sbjct  170  AAAANDKFTVFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFE 229
Query  240  TALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TALKKAITAMSEAQKAAKPA  ATATATAAVGAATGAATAATGGYKV
Sbjct  230  TALKKAITAMSEAQKAAKPATEATATATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 10. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 336.1 bits 1446,  Expect = 1e-93
 Identities = 252/280 90%, Positives = 262/280 93%, Gaps = 20/280 7%
Query  1    ADLGYG-------PATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAAL 53
            AD+GYG       PATPAAPAAGYT   PAAPAGA  A KATT+EQKLIEKINAGFKAA+
Sbjct  26   ADVGYGAPATLATPATPAAPAAGYT---PAAPAGA--APKATTDEQKLIEKINAGFKAAV 80
Query  54   AGA-GVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYK 112
            A A GV   DKY+TFVATFG ASNKAFAE LS EPKGAA +SS A LTSKLDAAYKLAYK
Sbjct  81   AAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLAYK 140
Query  113  TAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFK 172
            +AEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPA EEVK IPAGELQVI+KVDAAFK
Sbjct  141  SAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEEVKAIPAGELQVIDKVDAAFK 200
Query  173  VAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPE 232
            VAATAANAAPANDKFTVFEAAFND IKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP 
Sbjct  201  VAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPA 260
Query  233  VKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGA-------ATAATGGYK 285
            VKYTVFETALKKAITAMS+AQKAAKPAAA TATAT AVGAATGA       ATAA GGYK
Sbjct  261  VKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAAGGYK 320

Sequence Alignment: 11. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 329.7 bits 1418,  Expect = 1e-91
 Identities = 242/278 87%, Positives = 253/278 91%, Gaps = 5/278 1%
Query  7    PAT--PAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGA-GVQPADK 63
            PA+  PA PA      TPAAPAG  AA KATT+EQKLIEKIN GFKAA+A A GV  A K
Sbjct  93   PASKFPAKPAPKVAAYTPAAPAG--AAPKATTDEQKLIEKINVGFKAAVAAAAGVPAASK 150
Query  64   YRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 123
            Y+TFVATFG ASNKAFAE LS EPKGAA +SSKA LTSKLDAAYKLAYK+AEGATPEAKY
Sbjct  151  YKTFVATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKY 210
Query  124  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPA 183
            DAYVATLSEALRIIAGTLEVH VKPAAEEVK IPAGELQVI+KVDAAFKVAATAANAAPA
Sbjct  211  DAYVATLSEALRIIAGTLEVHGVKPAAEEVKAIPAGELQVIDKVDAAFKVAATAANAAPA 270
Query  184  NDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 243
            NDKFTVFEAAFND IKASTGGAY+SYKFIPALEAAVKQ+YAATVATAP VKYTVFETALK
Sbjct  271  NDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALK 330
Query  244  KAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            KAITAMS+AQKAAKPAAA T TAT+AVGAATGAATAA GGYKV
Sbjct  331  KAITAMSQAQKAAKPAAAVTGTATSAVGAATGAATAAAGGYKV 373
 Score = 49.1 bits 187,  Expect = 3e-07
 Identities = 37/89 41%, Positives = 58/89 65%, Gaps = 13/89 14%
Query  42   IEKINAGFKAAL-AGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALT 100
            ++K N  +K AL A + V PA+K+  F ATF    +K + EGLSG P           + 
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATF----DKNLKEGLSG-PDAVG-------FA 48
Query  101  SKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLE 142
             KLDA  + +Y + + A P+ K+D +V +L+E LR +AG ++
Sbjct  49   KKLDAFIQTSYLSTKAAEPKEKFDLFVLSLTEVLRFMAGAVK 90

Sequence Alignment: 12. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 307.2 bits 1319,  Expect = 4e-85
 Identities = 229/264 86%, Positives = 235/264 89%, Gaps = 16/264 6%
Query  7    PATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRT 66
            P  PA P     P   A+P     + KA +E   +                V PADKYRT
Sbjct  12   PRPPATPPPPPPPQLGASPYKLGPSPKARSERPAI----------------VPPADKYRT 55
Query  67   FVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY 126
            FVATFG ASNKAFAEGLSGEPKG AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY
Sbjct  56   FVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAY 115
Query  127  VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDK 186
            VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDK
Sbjct  116  VATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDK 175
Query  187  FTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAI 246
            FTVFEAAFN+ IKA TGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAI
Sbjct  176  FTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAI 235
Query  247  TAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            TAMSEAQKAAKPAAAATATAT+AVGA TGA TAA GGYKV
Sbjct  236  TAMSEAQKAAKPAAAATATATSAVGAPTGATTAAAGGYKV 275

Sequence Alignment: 13. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 280.5 bits 1202,  Expect = 6e-77
 Identities = 211/276 76%, Positives = 230/276 83%, Gaps = 12/276 4%
Query  1    ADLGYGPATPAAPAA---GYTPATPAAPAGADA--AGKATTEEQKLIEKINAGFKAALAG 55
            AD GY PATPA PAA     TPATPA PA   A  +GKATTEEQKLIEKINAGFKAA+A 
Sbjct  26   ADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAGFKAAVAA 85
Query  56   AGV-QPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTA 114
            A V  PADKY+TFV TFG A+NKAF EGL+    G A+ S K  LTSKLDAA KLAY+ A
Sbjct  86   AAVVPPADKYKTFVETFGTATNKAFVEGLA---SGYADQS-KNQLTSKLDAALKLAYEAA 141
Query  115  EGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFK 172
            +GATPEAKYDAYVATL+EALR+IAGTLEVHAVKPAAEEVKV  IPA E+Q+I+KVDAA++
Sbjct  142  QGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDAAYR 201
Query  173  VAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPE 232
             AATAANAAPANDKFTVFE  FN+ IK S G AY+SYKFIP L AAVKQAYAA  ATAPE
Sbjct  202  TAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQATAPE 261
Query  233  VKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAA 280
            VKYTV ETALKKA+TAMSEA+K A PAAAATAT T A   AT    AA
Sbjct  262  VKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAA 309

Sequence Alignment: 14. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 261.0 bits 1116,  Expect = 3e-71
 Identities = 193/259 74%, Positives = 215/259 83%, Gaps = 16/259 6%
Query  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGP 73
            AGYTP   AAPA A A GKATT+EQKL+E +NAGFK A+A A  V PADKY+TF A F  
Sbjct  3    AGYTP---AAPAAAGAGGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAF-T 58
Query  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
            AS+KA           AA ++    L  +L+AA   AY  A+GATPEAKYDA+V TL+EA
Sbjct  59   ASSKASI---------AAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEA 109
Query  134  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
            LR+IAG LEVHAVKPA EEV    IPAGELQ+++K+DAAF++AATAANAAP NDKFTVFE
Sbjct  110  LRVIAGALEVHAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFE 169
Query  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
             AFN  IK STGGAYE+YKFIP+LE AVKQAYAATVATAPEVKYTVFETALKKAITAMSE
Sbjct  170  GAFNKAIKESTGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 229
Query  252  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            AQK AKP AAAT  ATAA G A GAATAA GGYKV
Sbjct  230  AQKEAKPVAAATGAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 15. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 257.6 bits 1101,  Expect = 4e-70
 Identities = 194/260 74%, Positives = 211/260 81%, Gaps = 15/260 5%
Query  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGP 73
            AGYTPA  A PA A   GKA TEEQKLIE +NAGFKAA+A A    PADK++TF ATF  
Sbjct  3    AGYTPAAAATPAAA--GGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
            A     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EA
Sbjct  61   ACKANIAAAATKVP----------LFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEA 110
Query  134  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
            LR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE
Sbjct  111  LRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFE 170
Query  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
             AFN  IK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSE
Sbjct  171  GAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSE 230
Query  252  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            AQK A PAAAAT  ATAA  AATGAATAA GGYKV
Sbjct  231  AQKVATPAAAATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 16. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 255.9 bits 1094,  Expect = 1e-69
 Identities = 194/269 72%, Positives = 219/269 81%, Gaps = 24/269 8%
Query  6    GPATPAAPAAGYTPA---TPAAPAGADAA--GKATTEEQKLIEKINAGFKAALAGAG-VQ 59
            GPA   A  AGYTPA   TPA PA   AA  GKATT+EQKL+E +NAGFKAA+A A    
Sbjct  19   GPAASYAADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAP 78
Query  60   PADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKA-ALTSKLDAAYKLAYKTAEGAT 118
            PADK++ F A F  +S     +GL       A S++KA  L  KLD AY +AYK AEGAT
Sbjct  79   PADKFKIFEAAFSESS-----KGL------LATSAAKAPGLIPKLDTAYDVAYKAAEGAT 127
Query  119  PEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAAT 176
            PEAKYDA+V  L+EALR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AAT
Sbjct  128  PEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAAT 187
Query  177  AANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYT 236
            AANAAP NDKFTVFE+AFN  +   TGGAYE+YKFIP+LEAAVKQAYAATVA APEVKY 
Sbjct  188  AANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYA 247
Query  237  VFETALKKAITAMSEAQKAAKPAAAA-TATATAAVGAAT---GAATAATGGYK 285
            VFE AL KAITAM++AQKA KPAAAA T  AT A GAAT   GAATAA GGYK
Sbjct  248  VFEAALTKAITAMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 17. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 255.1 bits 1090,  Expect = 2e-69
 Identities = 192/260 73%, Positives = 209/260 80%, Gaps = 15/260 5%
Query  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGP 73
            AGYTPA  A PA   A GKA TEEQ LIE +NAGFKAA+A A    PADK++TF ATF  
Sbjct  3    AGYTPAAAATPA--TAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
            A     A   +  P           + +KLDAAY +AYKTA G TPEAKYDA+VA L+EA
Sbjct  61   ACKANIAAAATKVP----------LFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEA 110
Query  134  LRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
            LR+IAG LEVHAVKPAAEEV    IPAGELQ+++K+DAA+K+AATAANAAPANDKFTVFE
Sbjct  111  LRVIAGALEVHAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFE 170
Query  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
             AFN  IK STGGAYESYKFIP LEAAVKQAYAATVA APEVKY VFE AL KAITAMSE
Sbjct  171  GAFNKAIKESTGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSE 230
Query  252  AQKAAKPAAAATATATAAVGAATGAATAATGGYKV 286
            AQK A PAA AT  ATAA  AATGAATAA GGYKV
Sbjct  231  AQKVATPAAVATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 18. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 247.5 bits 1057,  Expect = 4e-67
 Identities = 180/272 66%, Positives = 216/272 79%, Gaps = 11/272 4%
Query  8    ATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAAL-AGAGVQPADKYRT 66
            A  A PA  Y    PAAP G     KATT EQKL+E IN GFKAA+ A A V PADKY+T
Sbjct  15   ALVAGPAVSYGTYAPAAP-GTQP--KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKT 71
Query  67   FVATFGPASNKAFAEGLSGEPKGA--AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD 124
            F  TF   SNKAFA+ L+    G   A+S S A L++ L+++YKLAY +AEGATPE KYD
Sbjct  72   FQTTFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYD 131
Query  125  AYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPAN 184
             YVA+L+E+LR+I+G +EVHAVKPA+EEVK +PA +L+V++++DAA++ AATAANAAP N
Sbjct  132  TYVASLTESLRVISGAFEVHAVKPASEEVKGVPAPQLKVVDQIDAAYRTAATAANAAPTN 191
Query  185  DKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKK 244
            DKF VFE++FN  IK +TGGAY SY F+PALE+AVKQAYAATVA+APEVKY VF+ AL K
Sbjct  192  DKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAALSK 251
Query  245  AITAMSEAQKAAKPAAAA--TATATAAVGAATGAATAATGGYK 285
            AI AM EA+K AKPAAAA  TATATA VGAA GAA    GGYK
Sbjct  252  AINAMVEAEKDAKPAAAAAATATATATVGAAAGAA---AGGYK 291

Sequence Alignment: 19. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 234.5 bits 1000,  Expect = 4e-63
 Identities = 185/270 68%, Positives = 215/270 79%, Gaps = 26/270 9%
Query  6    GPATPAAPAAGYTPATPAAPAGADAAGKAT-TEEQKLIEKINAGFKAALAGA-GVQPADK 63
            GPA   A  AGY PATPAA AGA AAGK T T+EQKL+E IN GFKAA+A A G  PADK
Sbjct  19   GPAASYAADAGYAPATPAA-AGA-AAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADK 76
Query  64   YRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 123
            ++TF A F  AS +A A  L+     AA++     + S + A     YK A GATPEAK+
Sbjct  77   FKTFQAAFS-ASVEASAAKLN-----AAQA---PGFVSHVAATSDATYKAAVGATPEAKF 127
Query  124  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAANAA 181
            D++VA ++EALRIIAG L+VHAVKP  EE     IPAGE Q+I+K+DAAFKVAATAANAA
Sbjct  128  DSFVAAFTEALRIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAA 187
Query  182  PANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETA 241
            PANDKFTVFEAAFN+ IK STGGAY++YK IP+LEAAVKQAYAAT+A APEVK+ VF+ A
Sbjct  188  PANDKFTVFEAAFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAA 247
Query  242  LKKAITAMSEAQKAAKPAA-----------AATATATAAVGAATGAATAATGGYKV 286
            L KAITAM+E QK +KP A           AAT  AT A GAATGAAT + GGYKV
Sbjct  248  LTKAITAMAEVQKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 20. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 223.0 bits 949,  Expect = 8e-60
 Identities = 165/237 69%, Positives = 191/237 80%, Gaps = 14/237 5%
Query  39   QKLIEKINAGFKAALAGAG-VQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKA 97
            QKL+E +NA FKAA+A A  V PADKY+TF+  F       +  G + + K  AE +   
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAF-----TVLDRGSTEQSK--AEETKMP 53
Query  98   ALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV-- 155
             L+SKL  AY  A+K + G T EAKYDA+V TL+EALR+IAG LEVHAVKPA EEV    
Sbjct  54   ELSSKLVDAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAK 113
Query  156  IPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPAL 215
            IPAG+LQV++K+DA+FK+AATAANAAPANDKFTVFE AFN  +K STGGAYESYKFIP+L
Sbjct  114  IPAGDLQVVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSL 173
Query  216  EAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATG 275
            EAAVKQAYA+TVA APEVKY VFE AL KAITAMS+AQK A+PAAAAT  AT A GAAT 
Sbjct  174  EAAVKQAYASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAATT 233
Query  276  AATAATGGYKV 286
            AA    GGYKV
Sbjct  234  AA----GGYKV 240

Sequence Alignment: 21. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 205.8 bits 874,  Expect = 2e-54
 Identities = 151/205 73%, Positives = 173/205 84%, Gaps = 7/205 3%
Query  77   KAFAEGLSGEPKG--AAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEAL 134
            KAFAE L G   G  A +SSS A L+S L+ +YKLAY  A+GATPEAKYDAYVATL+E+L
Sbjct  107  KAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVATLTESL 166
Query  135  RIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAF 194
            R+I+GTLEVH+VKPAAEEVK +PAGEL+ I++VDAAF+ AATAA+AAPANDKFTVFE+  
Sbjct  167  RVISGTLEVHSVKPAAEEVKGVPAGELKAIDQVDAAFRTAATAADAAPANDKFTVFESLQ 226
Query  195  NDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQK 254
                +   GGAYESYKFIPALEAAVKQAYAATVA APEVK+TVF+TAL KAI AM++A K
Sbjct  227  QGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINAMTQAGK 286
Query  255  AAKPAAAATATATAAVGAATGAATAATGGYKV 286
             AKPAAAATATAT A GA   AATA  G YKV
Sbjct  287  VAKPAAAATATATVAAGA---AATA--GNYKV 313

Sequence Alignment: 22. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 205.6 bits 873,  Expect = 2e-54
 Identities = 188/265 70%, Positives = 212/265 80%, Gaps = 23/265 8%
Query  6    GPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPA-DKY 64
            GP       AGY PATPAA AGA AAGKATTEEQKLIE IN GFKAA+A A   PA DK+
Sbjct  13   GPGRSYTADAGYAPATPAA-AGA-AAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKF 70
Query  65   RTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD 124
            +TF A F  +S+KA A    G             L  KLDAAY +AYK A GATPEAK+D
Sbjct  71   KTFEAAF-TSSSKAAAAKAPG-------------LVPKLDAAYSVAYKAAVGATPEAKFD 116
Query  125  AYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAP 182
            ++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  AP
Sbjct  117  SFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAP 176
Query  183  ANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 242
            A+DKFTVFEAAFN  IK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL
Sbjct  177  ADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL 236
Query  243  KKAITAMSEAQKAAKPAAAATATA----TAAVGAATGAATAATGGYKV 286
             KAITAMSE QK ++PA  A   A    T A GAA+GAAT A GGYKV
Sbjct  237  TKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 23. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 202.2 bits 858,  Expect = 2e-53
 Identities = 187/265 70%, Positives = 212/265 80%, Gaps = 23/265 8%
Query  6    GPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPA-DKY 64
            GP    A  AGY PATPAA AGA+A GKATTEEQKLIE IN GFKAA+A A   PA DK+
Sbjct  10   GPGRSYAADAGYAPATPAA-AGAEA-GKATTEEQKLIEDINVGFKAAVAAAASVPAGDKF 67
Query  65   RTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD 124
            +TF A F  +S  A A+     P           L  KLDAAY +AYK A GATPEAK+D
Sbjct  68   KTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFD 113
Query  125  AYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAP 182
            ++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  AP
Sbjct  114  SFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAP 173
Query  183  ANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 242
            A+DKFTVFEAAFN  IK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL
Sbjct  174  ADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL 233
Query  243  KKAITAMSEAQKAAKPAAAATATA----TAAVGAATGAATAATGGYKV 286
             KAITAMSE QK ++PA  A   A    T A GAA+GAAT A GGYKV
Sbjct  234  TKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 24. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 200.8 bits 852,  Expect = 4e-53
 Identities = 184/256 71%, Positives = 209/256 81%, Gaps = 23/256 8%
Query  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPA-DKYRTFVATFGP 73
            AGY PATPAA AGA+A GKATTEEQKLIE IN GFKAA+A A   PA DK++TF A F  
Sbjct  3    AGYAPATPAA-AGAEA-GKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 60
Query  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
            +S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L+EA
Sbjct  61   SSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEA 106
Query  134  LRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
            LR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  APA+DKFTVFE
Sbjct  107  LRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFE 166
Query  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
            AAFN  IK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITAMSE
Sbjct  167  AAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSE 226
Query  252  AQKAAKPAAAATATA----TAAVGAATGAATAATGGYKV 286
             QK ++PA  A   A    T A GAA+GAAT A GGYKV
Sbjct  227  VQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 25. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 198.3 bits 841,  Expect = 2e-52
 Identities = 182/256 71%, Positives = 206/256 80%, Gaps = 23/256 8%
Query  15   AGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPA-DKYRTFVATFGP 73
            AGY PATPAA AGA+A GKATTEEQKLIE IN GF AA+A A   PA DK++TF A F  
Sbjct  3    AGYAPATPAA-AGAEA-GKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFTS 60
Query  74   ASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEA 133
            +S  A A+     P           L  KLDAAY +AYK A GATPEAK+D+ VA+L+EA
Sbjct  61   SSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEA 106
Query  134  LRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFE 191
            LR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  APA+DKFTVFE
Sbjct  107  LRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFE 166
Query  192  AAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSE 251
            AAFN  IK STGGAY++YK IP+LEAAVKQ YAATVA AP+VKY VFE AL KAITAMSE
Sbjct  167  AAFNKAIKESTGGAYDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSE 226
Query  252  AQKAAKPAAAATATA----TAAVGAATGAATAATGGYKV 286
             QK ++PA  A   A    T A GAA+GAAT A GGYKV
Sbjct  227  VQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 26. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 197.6 bits 838,  Expect = 5e-52
 Identities = 155/258 60%, Positives = 182/258 70%, Gaps = 17/258 6%
Query  6    GPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYR 65
            GPA P  P    TP TP       A  KAT    + +E INA  +     A V PADK++
Sbjct  19   GPAAPTPP----TPRTPPLLPPPRARDKATLT-SRSVEDINAASRRPWW-ASVPPADKFK 72
Query  66   TFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 125
            TF        N       +  P+          L +KLDAAY++AY+ AEG+TPEAKYDA
Sbjct  73   TFADHVLCVPNADVTSAATKAPQ----------LKAKLDAAYRVAYEAAEGSTPEAKYDA 122
Query  126  YVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPAND 185
            ++A L+EALR+IAG +EVHAVKPA EEV   P GELQ+++K+DAAFK+AATAAN+APAND
Sbjct  123  FIAALTEALRVIAGAFEVHAVKPATEEVVADPVGELQIVDKIDAAFKIAATAANSAPAND 182
Query  186  KFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKA 245
            KFTVFE AFN  IK ST GAYE+YKFIP+LEAAVKQAY ATVA APEVKY VFE  L KA
Sbjct  183  KFTVFEGAFNKAIKESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKA 242
Query  246  ITAMSEAQKAAKPAAAATATATAAVGAATGAATAA 280
            ITAMSEAQK AKP  +        + AA GAAT A
Sbjct  243  ITAMSEAQKVAKPPLSPQPPQVLPL-AAGGAATVA 276

Sequence Alignment: 27. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 171.2 bits 721,  Expect = 2e-44
 Identities = 124/166 74%, Positives = 139/166 83%, Gaps = 9/166 5%
Query  121  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 178
            AKYDA++A L+EALR+IAG +EVHAVKPA EEV    IPAGELQ+++K+DAAFK+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  179  NAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAA-VKQAYAATVATAPEVKYTV 237
            N+APANDKFTVFE AFN  IK   GGAYE+YKFIP+LEA+  KQAY ATVA APEVKY V
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  238  FETALKKAITAMSEAQKAAKPA----AAATATATAAVGAATGAATAAT--GGYKV 286
            FE  L KAITAMSEAQK AKP     AAA   ATAA GAAT AA+  T  GGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 28. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 155.4 bits 653,  Expect = 2e-39
 Identities = 148/265 55%, Positives = 179/265 67%, Gaps = 31/265 11%
Query  4    GYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADK 63
            GY PATPAA A   TPATPAA     +   A T E  ++ K  AG+      A  Q  D+
Sbjct  28   GYAPATPAASATLATPATPAA-----SPQHAGTTEYHIVRK--AGLNEE-KNAARQTDDE 79
Query  64   YRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 123
             +       P  NK+        P      SS +A +SK D A+ L Y + +G + +   
Sbjct  80   QKRSDEINCPDFNKSVHCRADRLPV----CSSTSAHSSKQDVAWMLGYGSIQGFSMD--- 132
Query  124  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPA 183
            DA V ++S  + +I   +EV  +    EEVKVIPAGE++VI KV AAF  AATAA+ APA
Sbjct  133  DASVGSVSSEFHVIESAIEV--ITYIGEEVKVIPAGEVEVINKVKAAFSTAATAADEAPA 190
Query  184  NDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 243
            NDKFTVF ++FN  IK +TGGAY  YKFIP LEAAVKQAYAA+ ATAPEVKY VFETALK
Sbjct  191  NDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK 250
Query  244  KAITAMSEAQKAAKPAAAATATATAAVGAAT-----------GAAT--AATGGYKV 286
            KAI+AMSEAQK AKPAAA +A AT  + A+T           G AT  A  GGYKV
Sbjct  251  KAISAMSEAQKEAKPAAAISA-ATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 29. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 153.6 bits 645,  Expect = 8e-39
 Identities = 132/263 50%, Positives = 160/263 60%, Gaps = 17/263 6%
Query  6    GPATPAAPAAGYTPA---TPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPAD 62
            GP    A  AGYTPA   TPA PA   A G    ++++  E   AG +  LA    QP  
Sbjct  19   GPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRR-AE--AAGGRQRLASR--QPWP 73
Query  63   KYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAA--LTSKLDAAYKLAYKTAEGATPE 120
               T +      S++  +      P+ ++ +S+  A  L  KLD AY +AYK AE A P 
Sbjct  74   PLPTPLRRTSSRSSRPPSPS---PPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
Query  121  AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKV--IPAGELQVIEKVDAAFKVAATAA 178
             +          +LR+IAG LEVHAVKPA EEV    IP GELQ+++K+DAAFK+AATAA
Sbjct  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
Query  179  NAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVF 238
            NAAP NDKFTVFE+AFN  +   TGGA       P       +        APEVKY VF
Sbjct  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
Query  239  ETALKKAITAMSEAQKAAKPAAAA-TATATAAVGAATGAA 277
            E AL KAITAM++AQKA KPAAAA TA AT A  AAT AA
Sbjct  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 121.4 bits 504,  Expect = 4e-29
 Identities = 168/256 65%, Positives = 189/256 73%, Gaps = 45/256 17%
Query  6    GPATPAAPAAGYTPATPAAPA--GADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADK 63
            GPA   A  AG TP TPA PA  GA AAGKATT EQKLIE INA FK   A A   PADK
Sbjct  19   GPAASYAADAG-TPPTPATPAVPGA-AAGKATTHEQKLIEDINAAFKWWPASA--PPADK 74
Query  64   YRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKY 123
            Y+TF   F  A+       ++G            A T  LDAAY + Y TA GATPEAKY
Sbjct  75   YKTFETAFSKAN-------IAG------------ASTKGLDAAYSVVYNTAAGATPEAKY 115
Query  124  DAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAA----FKVAAT--- 176
            D++V  L+EALRI+AGTLEVHAVKPA EE   +P+ ++       +     FK+AAT   
Sbjct  116  DSFVTALTEALRIMAGTLEVHAVKPATEEE--VPSAKILRANSRSSTRSSRFKIAATVAT 173
Query  177  ------AANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATA 230
                  AAN+APANDKFTVFE AFN  IK   GG  E+YKFIP+LEAAVKQAY ATVA A
Sbjct  174  PLSHSTAANSAPANDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARA 233
Query  231  PEVKYTVFETALKKAITAMSEAQKAAKPAAAAT----ATATAAVGAAT-GAATAATGGYK 285
            PEVKY VFE  L KAITAMSEAQK AKP   +         AA GAAT  AA+ + GGYK
Sbjct  234  PEVKYAVFEAGLTKAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYK 293
Query  286  V 286
            V
Sbjct  294  V 294

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 55.4 bits 212,  Expect = 1e-09
 Identities = 66/109 60%, Positives = 80/109 73%, Gaps = 11/109 10%
Query  32   GKATTEEQKLIEKINAGFKAALAG-AGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGA 90
            GKATTEEQKLIE +NA F+AA+A  A V PADKY+TF A F  +S + +A+ +S  P+  
Sbjct  23   GKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQ-- 80
Query  91   AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAA 150
                    L  KLD  Y  AY  A+ A PE KY+A+V  +SEALRIIAGT EVHAVKP A
Sbjct  81   --------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA 132

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 53.8 bits 205,  Expect = 4e-09
 Identities = 66/109 60%, Positives = 79/109 72%, Gaps = 11/109 10%
Query  32   GKATTEEQKLIEKINAGFKAALAG-AGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGA 90
            GKATTEEQKLIE INA F+AA+A  A V PADKY+TF A F  +S + +A+ +S  P+  
Sbjct  29   GKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQ-- 86
Query  91   AESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAA 150
                    L  KLD  Y  AY  A+ A PE KY+A+V  +SEAL IIAGT EVHAVKP A
Sbjct  87   --------LVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKPGA 138

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.