The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS
KIQF
Sequence Info Allergen Name Length Opt Bits Score E Value
AAF80379 Cyn d 1.0204 244 1722 406.3 4.6e-115
AAK96255 Cyn d 1.0201 244 1717 405.2 1e-114
AAL14077 Cyn d 1.0202 262 1688 398.4 1.2e-112
AAL14078 Cyn d 1 262 1688 398.4 1.2e-112
AAL14079 Cyn d 1.0203 262 1675 395.4 9.8e-112
A0A4D6FZ45 Uro m 1.0101 262 1675 395.4 9.8e-112
O04701 Cyn d 1 246 1503 355.6 8.9e-100
QCX36431 Zoy m 1.0101 272 1445 342.1 1.1e-95
A0A4D6G2J8 Uro m 1.0201 229 1246 296.1 6.7e-82
CAA10520 Poa p a 263 1236 293.7 4.1e-81
CAA10140 Hol l 1 263 1231 292.5 9.2e-81
P43213 Phl p 1 263 1218 289.5 7.4e-80
CAA81613 Phl p 1.0101 263 1206 286.7 5.1e-79
CAA93121 Hol l 1.0102 248 1199 285.1 1.4e-78
P43216 Hol l 1 265 1198 284.9 1.9e-78
AAA63278 Lol p 1.0102 252 1193 283.7 3.8e-78
AAF72983 Ory s 1 267 1191 283.2 5.8e-78
Q41260 Pha a 1 269 1188 282.5 9.5e-78
CAB63699 Lol p 1.0103 263 1186 282.1 1.3e-77
P14946 Lol p 1 263 1178 280.2 4.6e-77
AAA63279 Lol p 1.0101 263 1175 279.5 7.4e-77
AAF72991 Ory s 1 267 1171 278.6 1.4e-76
ABC58726 Sor h 1.0101 239 1104 263.2 5.7e-72
ACA23876 Pas n 1.0101 265 1097 261.5 2.1e-71
P58738 Zea m 1 269 1085 258.7 1.5e-70
AAF72990 Ory s 1 269 1046 249.6 7.6e-68
Q40638 Ory s 1 263 1028 245.5 1.3e-66
AAF72984 Ory s 1 268 912 218.6 1.7e-58
AAF72987 Ory s 1 275 895 214.6 2.7e-57
Q07154 Zea m 1 191 874 210.1 4.4e-56
AAB61710 Ory s 1 261 868 208.4 1.9e-55
AAF72989 Ory s 1 271 853 204.9 2.2e-54
AAD10496 Tri a ps93 271 852 204.7 2.6e-54
AAF72985 Ory s 1 286 848 203.7 5.4e-54
AAF72988 Ory s 1 327 698 168.8 1.9e-43
AAF72986 Ory s 1 275 688 166.7 7.3e-43
AAA50175 Gly m 2 277 688 166.7 7.4e-43
CAB37496 Ara t expansin 265 393 98.3 2.6e-22
AAG13596 Ory s 1 275 344 87.0 7.2e-19
BAA85432 Ory s 1 284 305 77.9 4e-16
AAP80171 Cyn d 15 112 274 71.5 1.4e-14
P14947 Lol p 2 97 256 67.4 2e-13
CAA10346 Cyn d 2 122 252 66.3 5.3e-13
CAA10348 Poa p 2 122 248 65.4 1e-12
P43214 Phl p 2 122 248 65.4 1e-12
CAA10345 Dac g 2 122 248 65.4 1e-12
CAA51775 Lol p 2 88 236 62.9 4.2e-12
P93124 Dac g 3 96 224 60.0 3.3e-11
2JNZ_A Phl p 3.0101 108 212 57.1 2.7e-10
P14948 Lol p 3 97 190 52.1 7.9e-09
CAA90746 Tri a 3 118 186 51.0 2e-08
A0A077B7S9 Sor h 2.0101 119 183 50.3 3.3e-08
A0A077B2S0 Sor h 2.0201 121 180 49.6 5.5e-08
Q7M1X8 Dac g 1.0101 34 167 47.6 6.2e-08
Q7M1X6 Ant o 1.0101 32 157 45.4 2.8e-07
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cyn d 1.0204 Sequence ID: AAF80379

 Score = 406.3 bits 1722,  Expect = 5e-115
 Identities = 244/244 100%, Positives = 244/244 100%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
            PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  241  KIQF 244
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 2. Allergen Name: Cyn d 1.0201 Sequence ID: AAK96255

 Score = 405.2 bits 1717,  Expect = 1e-114
 Identities = 243/244 99%, Positives = 244/244 100%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
Sbjct  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
            PKGSDEFLPMKQSWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS
Sbjct  181  PKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
Query  241  KIQF 244
            KIQF
Sbjct  241  KIQF 244

Sequence Alignment: 3. Allergen Name: Cyn d 1.0202 Sequence ID: AAL14077

 Score = 398.4 bits 1688,  Expect = 1e-112
 Identities = 239/244 97%, Positives = 242/244 99%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS+PNYLALLVKYAAGDGNIV VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
             KGSDEFLPMKQSWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KIQF 244
            KIQF
Sbjct  259  KIQF 262

Sequence Alignment: 4. Allergen Name: Cyn d 1 Sequence ID: AAL14078

 Score = 398.4 bits 1688,  Expect = 1e-112
 Identities = 239/244 97%, Positives = 240/244 98%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 78
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKI FHVEKGSSPNYLALLVKYAAGDGNIVGVDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKITFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 198
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
            PKGSD FLPMK SWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  199  PKGSDVFLPMKLSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KIQF 244
            KIQF
Sbjct  259  KIQF 262

Sequence Alignment: 5. Allergen Name: Cyn d 1.0203 Sequence ID: AAL14079

 Score = 395.4 bits 1675,  Expect = 1e-111
 Identities = 237/244 97%, Positives = 240/244 98%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFD MTGCGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGN 78
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS+PNYLALLVKYAAGDGNIV VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
             KGSDEFLPMKQSWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KIQF 244
            KIQF
Sbjct  259  KIQF 262

Sequence Alignment: 6. Allergen Name: Uro m 1.0101 Sequence ID: A0A4D6FZ45

 Score = 395.4 bits 1675,  Expect = 1e-111
 Identities = 237/244 97%, Positives = 240/244 98%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFD MTGCGN
Sbjct  19   AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDSMTGCGN 78
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  79   EPIFKDGLGCGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 138
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGS+PNYLALLVKYAAGDGNIV VDIK
Sbjct  139  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSNPNYLALLVKYAAGDGNIVSVDIK 198
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
             KGSDEFLPMKQSWGAIWR+DPPKPLKGPFTIRLTSESGGHVEQ+DVIPEDWKPDTVYKS
Sbjct  199  SKGSDEFLPMKQSWGAIWRIDPPKPLKGPFTIRLTSESGGHVEQEDVIPEDWKPDTVYKS 258
Query  241  KIQF 244
            KIQF
Sbjct  259  KIQF 262

Sequence Alignment: 7. Allergen Name: Cyn d 1 Sequence ID: O04701

 Score = 355.6 bits 1503,  Expect = 9e-100
 Identities = 207/244 84%, Positives = 225/244 92%, Gaps = 0/244 0%
Query  1    AMGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGN 60
            A+GDKPGPNITATYG KWL+A+ATFYGS+PRGAAPDDHGGACGYKDVDK PFDGMT CGN
Sbjct  1    AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKPPFDGMTACGN 60
Query  61   EPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
            EPIFKDGL C +CYEIKCKEP ECSGEPVL+KITDKNYEHIAAYHFDLSGKAFGAMAKKG
Sbjct  61   EPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEHIAAYHFDLSGKAFGAMAKKG 120
Query  121  EEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK 180
            +EDKLRKAGEL LQFRRVKC+YPS TKI FH+EKGS+ +YLALLVKYAAGDGNIV VDIK
Sbjct  121  QEDKLRKAGELTLQFRRVKCKYPSGTKITFHIEKGSNDHYLALLVKYAAGDGNIVAVDIK 180
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
            P+ SDEF+PMK SWGAIWR+DP KPLKGPF+IRLTSE G H+ QDDVIP +WKPDTVY S
Sbjct  181  PRDSDEFIPMKSSWGAIWRIDPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTS 240
Query  241  KIQF 244
            K+QF
Sbjct  241  KLQF 244

Sequence Alignment: 8. Allergen Name: Zoy m 1.0101 Sequence ID: QCX36431

 Score = 342.1 bits 1445,  Expect = 1e-95
 Identities = 200/243 82%, Positives = 221/243 90%, Gaps = 0/243 0%
Query  2    MGDKPGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNE 61
            +GDKPGPNITATY ++W DAKATFYGS+PRGAAPDD GGACGYK+VDKAPF GMTGCGNE
Sbjct  30   IGDKPGPNITATYNEEWQDAKATFYGSNPRGAAPDDDGGACGYKNVDKAPFFGMTGCGNE 89
Query  62   PIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGE 121
            PIFKDGL CGSC+EIKCKEPAECS +PVLI+ITDKNYEHIAAYHFDLSGKAFG+MAK+G+
Sbjct  90   PIFKDGLGCGSCFEIKCKEPAECSDKPVLIRITDKNYEHIAAYHFDLSGKAFGSMAKQGQ 149
Query  122  EDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKP 181
            ED LRKAGEL LQFRRVKCEYPS TKI FHVEKG + NYLALLV+YAAGDG+IV VDIKP
Sbjct  150  EDNLRKAGELTLQFRRVKCEYPSKTKITFHVEKGCNDNYLALLVEYAAGDGDIVAVDIKP 209
Query  182  KGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            KGSDEFLPMK SWGAIWR+DP KPLKGPFT+RLTSESG  + Q+DVIP DWKP+T Y S 
Sbjct  210  KGSDEFLPMKPSWGAIWRIDPKKPLKGPFTVRLTSESGAKLVQEDVIPADWKPNTAYTSN 269
Query  242  IQF 244
            +Q+
Sbjct  270  LQY 272

Sequence Alignment: 9. Allergen Name: Uro m 1.0201 Sequence ID: A0A4D6G2J8

 Score = 296.1 bits 1246,  Expect = 7e-82
 Identities = 171/227 75%, Positives = 199/227 87%, Gaps = 1/227 0%
Query  17   KWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEI 76
            KWLDAKAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKDGL CGSCYEI
Sbjct  3    KWLDAKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNPPIFKDGLGCGSCYEI 61
Query  77   KCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFR 136
            KC +PAECSGEPV++ ITD+NYE IAAYHFDL+G AFGAMAKKGEE+KLRKAG + +QFR
Sbjct  62   KCDKPAECSGEPVIVHITDQNYEPIAAYHFDLAGTAFGAMAKKGEEEKLRKAGIIDMQFR 121
Query  137  RVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGA 196
            RVKC+YP++TKIAFHVEKG +PNY+ALL+KYAAGDG+IV VDIK KGS+EF+P+K+SWGA
Sbjct  122  RVKCKYPANTKIAFHVEKGCNPNYFALLIKYAAGDGDIVAVDIKEKGSEEFIPLKHSWGA 181
Query  197  IWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            IWR+D PKP+KGP  +RLTSE G  + QDD IPE WK DTVY SK+QF
Sbjct  182  IWRIDSPKPIKGPIAVRLTSEGGTTLVQDDAIPEGWKADTVYTSKLQF 229

Sequence Alignment: 10. Allergen Name: Poa p a Sequence ID: CAA10520

 Score = 293.7 bits 1236,  Expect = 4e-81
 Identities = 172/235 73%, Positives = 193/235 82%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF GMTGCGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFSGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
             G  CGSC+EIKC +P  CSGEPVL+ ITD N E IAAYHFDLSGKAFGAMAKKGEE KL
Sbjct  88   SGRGCGSCFEIKCTKPESCSGEPVLVHITDDNEEPIAAYHFDLSGKAFGAMAKKGEEQKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL L+FRRVKCEYP  TK+ FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELKFRRVKCEYPEGTKVTFHVEKGSNPNYLALLVKYVTGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWG+IWR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y SK
Sbjct  208  KWIELKESWGSIWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYASK 263

Sequence Alignment: 11. Allergen Name: Hol l 1 Sequence ID: CAA10140

 Score = 292.5 bits 1231,  Expect = 9e-81
 Identities = 169/235 71%, Positives = 194/235 82%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
             G  CGSC+EIKC +P  CSGEP+++ ITD N E IAAYH+DLSGKAFGAMAKKGEE KL
Sbjct  88   SGRGCGSCFEIKCTKPESCSGEPIVVHITDDNEEPIAAYHLDLSGKAFGAMAKKGEEQKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL L+FRRVKCEYP  TK+ FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELKFRRVKCEYPKGTKVTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G  VE +DVIPE WK DT Y+SK
Sbjct  208  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKVEAEDVIPEGWKADTAYESK 263

Sequence Alignment: 12. Allergen Name: Phl p 1 Sequence ID: P43213

 Score = 289.5 bits 1218,  Expect = 7e-80
 Identities = 168/235 71%, Positives = 191/235 81%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGDKWLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
             G  CGSC+EIKC +P  CSGEPV++ ITD N E IA YHFDLSG AFGAMAKKG+E KL
Sbjct  88   SGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP  TK+ FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGAIWR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y+SK
Sbjct  208  KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK 263

Sequence Alignment: 13. Allergen Name: Phl p 1.0101 Sequence ID: CAA81613

 Score = 286.7 bits 1206,  Expect = 5e-79
 Identities = 166/235 70%, Positives = 193/235 82%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGDKWLDAK+T+YG  P  A P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  29   PGPNITATYGDKWLDAKSTWYGK-PTAAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
             G  CGSC+EIKC +P  CSGEPV++ ITD N E IAAYHFDLSG AFG+MAKKG+E KL
Sbjct  88   SGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAAYHFDLSGIAFGSMAKKGDEQKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGE+ +QFRRVKC+YP  TK+ FHVEKGS+PNYLALLVK+ AGDG++V VDIK KG D
Sbjct  148  RSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKFVAGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGAIWR+D P+ LKGPFT+R T+E G   E  DVIPE WK DT Y+SK
Sbjct  208  KWIALKESWGAIWRIDTPEVLKGPFTVRYTTEGGTKGEAKDVIPEGWKADTAYESK 263

Sequence Alignment: 14. Allergen Name: Hol l 1.0102 Sequence ID: CAA93121

 Score = 285.1 bits 1199,  Expect = 1e-78
 Identities = 165/235 70%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  14   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 72
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  73   DGRGCGSCFEIKCSKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 132
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL L+FRRVKC+YP  TK  FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  133  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 192
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y++K
Sbjct  193  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 248

Sequence Alignment: 15. Allergen Name: Hol l 1 Sequence ID: P43216

 Score = 284.9 bits 1198,  Expect = 2e-78
 Identities = 165/235 70%, Positives = 190/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITATYGD+WLDAK+T+YG  P GA P D+GGACGYKDVDK PF GMTGCGN PIFK
Sbjct  31   PGPNITATYGDEWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK 89
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGEPV + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  90   DGRGCGSCFEIKCTKPESCSGEPVTVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 149
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL L+FRRVKC+YP  TK  FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  150  RSAGELELKFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYIDGDGDVVAVDIKEKGKD 209
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y++K
Sbjct  210  KWIELKESWGAVWRVDTPDKLTGPFTVRYTTEGGTKGEAEDVIPEGWKADTAYEAK 265

Sequence Alignment: 16. Allergen Name: Lol p 1.0102 Sequence ID: AAA63278

 Score = 283.7 bits 1193,  Expect = 4e-78
 Identities = 164/235 69%, Positives = 189/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF+GMTGCGN PIFK
Sbjct  18   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 76
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE  +
Sbjct  77   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 136
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP DTK  FHVEKGS+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  137  RSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVDGDGDVVAVDIKEKGKD 196
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  197  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 252

Sequence Alignment: 17. Allergen Name: Ory s 1 Sequence ID: AAF72983

 Score = 283.2 bits 1191,  Expect = 6e-78
 Identities = 161/237 67%, Positives = 198/237 83%, Gaps = 1/237 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNIT +YGDKWL+AKAT+YG+ P+GA P D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  29   PGPNITTSYGDKWLEAKATWYGA-PKGAGPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG AFGAMAK G++++L
Sbjct  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLAFGAMAKDGKDEEL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  148  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
            E+  +K+SWGAIWR+D PKPLKGPF++R+T+E G  +  +D IP+ WK D+VYKS +Q
Sbjct  208  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGGEKIIAEDAIPDGWKADSVYKSNVQ 265

Sequence Alignment: 18. Allergen Name: Pha a 1 Sequence ID: Q41260

 Score = 282.5 bits 1188,  Expect = 1e-77
 Identities = 164/235 69%, Positives = 189/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF+GMTGCGN PIFK
Sbjct  35   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 93
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+E+KC +P  CSGEP+ + ITD N E IA YHFDLSG AFG+MAKKGEE+ +
Sbjct  94   DGRGCGSCFELKCSKPESCSGEPITVHITDDNEEPIAPYHFDLSGHAFGSMAKKGEEENV 153
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP  TK  FHVEKGS+PNYLALLVKY  GDG++V VDIK KG D
Sbjct  154  RGAGELELQFRRVKCKYPDGTKPTFHVEKGSNPNYLALLVKYVDGDGDVVAVDIKEKGKD 213
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGAIWR+D P  L GPFT+R T+E G   E +DVIPE WK DT   SK
Sbjct  214  KWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKAEFEDVIPEGWKADTHDASK 269

Sequence Alignment: 19. Allergen Name: Lol p 1.0103 Sequence ID: CAB63699

 Score = 282.1 bits 1186,  Expect = 1e-77
 Identities = 164/235 69%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYKDVDKAPF+GMTGCGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKDVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE KL
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP  TK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELQFRRVKCKYPDGTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIPEGWKADTSYSAK 263

Sequence Alignment: 20. Allergen Name: Lol p 1 Sequence ID: P14946

 Score = 280.2 bits 1178,  Expect = 5e-77
 Identities = 162/235 68%, Positives = 188/235 80%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+VDKAPF+GMTGCGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE  +
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP DTK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            +++ +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  208  KWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 21. Allergen Name: Lol p 1.0101 Sequence ID: AAA63279

 Score = 279.5 bits 1175,  Expect = 7e-77
 Identities = 162/235 68%, Positives = 187/235 79%, Gaps = 1/235 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YGDKWLDAK+T+YG  P GA P D+GGACGYK+VDKAPF+GMTGCGN PIFK
Sbjct  29   PGPNITAEYGDKWLDAKSTWYGK-PTGAGPKDNGGACGYKNVDKAPFNGMTGCGNTPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CSGE V + ITD N E IA YHFDLSG AFG+MAKKGEE  +
Sbjct  88   DGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLSGHAFGSMAKKGEEQNV 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R AGEL LQFRRVKC+YP DTK  FHVEK S+PNYLA+LVKY  GDG++V VDIK KG D
Sbjct  148  RSAGELELQFRRVKCKYPDDTKPTFHVEKASNPNYLAILVKYVDGDGDVVAVDIKEKGKD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            ++  +K+SWGA+WR+D P  L GPFT+R T+E G   E +DVIPE WK DT Y +K
Sbjct  208  KWTELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEFEDVIPEGWKADTSYSAK 263

Sequence Alignment: 22. Allergen Name: Ory s 1 Sequence ID: AAF72991

 Score = 278.6 bits 1171,  Expect = 1e-76
 Identities = 153/237 64%, Positives = 200/237 84%, Gaps = 1/237 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNITA YG +WL+A+ T+YG  P+GA PDD+GGACGYKD+DKAPF GM  CGN+PIFK
Sbjct  29   PGPNITAAYGKQWLEARGTWYGK-PKGAGPDDNGGACGYKDIDKAPFLGMNSCGNDPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+E+KC +P  CS +PV+I ITD N E IAAYHFDLSG AFGAMAK+G++++L
Sbjct  88   DGKGCGSCFEVKCSKPEACSDKPVIIHITDMNTEPIAAYHFDLSGHAFGAMAKEGKDEEL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            RKAG + +QFRRV+C+YP +TK+ FHVEKGS+PNY+A+LVKY  GDG++V V++K KGS+
Sbjct  148  RKAGIIDMQFRRVRCKYPGETKVTFHVEKGSNPNYFAVLVKYVGGDGDVVKVELKEKGSE 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
            E+ P+ +SWGAIWR+D PKPLKGPF++R+T+ES   +  +DVIP++WK + +YKS+IQ
Sbjct  208  EWKPLNESWGAIWRIDTPKPLKGPFSLRVTTESDQKLVANDVIPDNWKANALYKSEIQ 265

Sequence Alignment: 23. Allergen Name: Sor h 1.0101 Sequence ID: ABC58726

 Score = 263.2 bits 1104,  Expect = 6e-72
 Identities = 158/231 68%, Positives = 187/231 80%, Gaps = 6/231 2%
Query  7    GPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKD 66
            G NIT TYG  WL+ KAT+YG  P GA PDD+GGACGYKDV+KAPF+ M  CGN PIFKD
Sbjct  7    GKNITETYGSDWLERKATWYGK-PTGAGPDDNGGACGYKDVNKAPFNSMGACGNLPIFKD 65
Query  67   GLACGSCYEIKCKEP--AECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDK 124
            GL CGSC+EIKC +P  AECSGE V++ ITD NYE+IAAYHFDL+G AFGAMAKKG+E+K
Sbjct  66   GL-CGSCFEIKCDKPKPAECSGEAVVVHITDMNYEQIAAYHFDLAGHAFGAMAKKGQEEK 124
Query  125  LRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGS 184
            L KAG + ++FRRVKC+Y    K+ FHVEKGS+PNYLALLVKY  GDG+IVGVDIK KG 
Sbjct  125  LAKAGIIDMKFRRVKCKY--GEKVTFHVEKGSNPNYLALLVKYVDGDGDIVGVDIKEKGG 182
Query  185  DEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSK 241
            D + P+K+SWGAIWR D P P+K P T+++T+E G     DDVIPE WK DT Y +K
Sbjct  183  DAYQPLKHSWGAIWRKDSPDPIKFPVTVQITTEGGTKTAYDDVIPEGWKADTTYTAK 239

Sequence Alignment: 24. Allergen Name: Pas n 1.0101 Sequence ID: ACA23876

 Score = 261.5 bits 1097,  Expect = 2e-71
 Identities = 158/236 66%, Positives = 183/236 77%, Gaps = 3/236 1%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNIT  Y  KWL AKAT+YG  P GA PDD+GGACG K+V+  P++G T CGN PIFK
Sbjct  30   PGPNITTNYNGKWLPAKATWYGQ-PNGAGPDDNGGACGIKNVNLPPYNGFTACGNPPIFK 88
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSCYEI+C +P ECSG+PV + ITD NYE IA YHFDLSGKAFGAMAK G  DKL
Sbjct  89   DGKGCGSCYEIRCNKP-ECSGQPVTVFITDMNYEPIAPYHFDLSGKAFGAMAKPGLNDKL 147
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R  G + L+FRRV+C+Y    KI FHVEKGS+PNYLA+LVK+ A DG+IV +++K K SD
Sbjct  148  RHYGIFDLEFRRVRCKYQGGQKIVFHVEKGSNPNYLAMLVKFVADDGDIVLMELKEKSSD 207
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
             + PMK SWGAIWRMD PK L  PF+IRLTSESG  V   DVIP +WKPDTVY S +QF
Sbjct  208  -WKPMKLSWGAIWRMDTPKALVPPFSIRLTSESGKKVIAQDVIPVNWKPDTVYNSNVQF 265

Sequence Alignment: 25. Allergen Name: Zea m 1 Sequence ID: P58738

 Score = 258.7 bits 1085,  Expect = 1e-70
 Identities = 151/238 63%, Positives = 181/238 76%, Gaps = 1/238 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNIT  Y  KWL A+AT+YG  P GA   D+GGACG K+V+  P+ GMT CGN PIFK
Sbjct  31   PGPNITTNYNGKWLTARATWYGQ-PNGAGAPDNGGACGIKNVNLPPYSGMTACGNVPIFK 89
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG++AK G  DK+
Sbjct  90   DGKGCGSCYEVRCKEKPECSGNPVTVYITDMNYEPIAPYHFDLSGKAFGSLAKPGLNDKI 149
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            R  G + ++FRRV+C+YP+  KI FH+EKG +PNYLA+LVKY A DG+IV ++I+ K S 
Sbjct  150  RHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYLAVLVKYVADDGDIVLMEIQDKLSA 209
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            E+ PMK SWGAIWRMD  K LKGPF+IRLTSESG  V   DVIP +W+PD VY S +QF
Sbjct  210  EWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDVIPANWRPDAVYTSNVQF 268

Sequence Alignment: 26. Allergen Name: Ory s 1 Sequence ID: AAF72990

 Score = 249.6 bits 1046,  Expect = 8e-68
 Identities = 141/238 59%, Positives = 180/238 75%, Gaps = 1/238 0%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNIT  Y   WL A+AT+YG  P G+   D+GGACG K+V+  P++GM  CGN PIFK
Sbjct  31   PGPNITTNYNAPWLPARATWYGQ-PYGSGSTDNGGACGIKNVNLPPYNGMISCGNVPIFK 89
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSCYE+KC++PA CS +PV + ITD NYE I+AYHFD+SGKAFGAMA  G+E +L
Sbjct  90   DGRGCGSCYEVKCEQPAACSKQPVTVFITDMNYEPISAYHFDFSGKAFGAMACPGKETEL 149
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            RKAG + +QFRRV+C+YP   K+ FHVEKGS+PNYLA+LVK+ A DG+++ +D++  G  
Sbjct  150  RKAGIIDMQFRRVRCKYPGGQKVTFHVEKGSNPNYLAVLVKFVADDGDVIQMDLQEAGLP 209
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
             + PMK SWGAIWRMD   PLK PF+IR+T+ESG  +   DVIP +W PD +Y S +QF
Sbjct  210  AWRPMKLSWGAIWRMDTATPLKAPFSIRVTTESGKSLIAKDVIPVNWMPDAIYVSNVQF 268

Sequence Alignment: 27. Allergen Name: Ory s 1 Sequence ID: Q40638

 Score = 245.5 bits 1028,  Expect = 1e-66
 Identities = 144/221 65%, Positives = 176/221 79%, Gaps = 4/221 1%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFK 65
            PGPNIT +YGDKWL+A+       PR  AP D+GGACGYKDVDKAPF GM  CGN+PIFK
Sbjct  29   PGPNITTSYGDKWLEARPPGM-VRPRVLAPKDNGGACGYKDVDKAPFLGMNSCGNDPIFK 87
Query  66   DGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKL 125
            DG  CGSC+EIKC +P  CS +P LI +TD N E IAAYHFDLSG A   MAK G++++L
Sbjct  88   DGKGCGSCFEIKCSKPEACSDKPALIHVTDMNDEPIAAYHFDLSGLA---MAKDGKDEEL 144
Query  126  RKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD 185
            RKAG +  QFRRVKC+YP+DTKI FH+EK S+PNYLALLVKY AGDG++V V+IK KGS+
Sbjct  145  RKAGIIDTQFRRVKCKYPADTKITFHIEKASNPNYLALLVKYVAGDGDVVEVEIKEKGSE 204
Query  186  EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPE 230
            E+  +K+SWGAIWR+D PKPLKGPF++R+T+E       +D IP+
Sbjct  205  EWKALKESWGAIWRIDTPKPLKGPFSVRVTTEGARRSSAEDAIPD 249

Sequence Alignment: 28. Allergen Name: Ory s 1 Sequence ID: AAF72984

 Score = 218.6 bits 912,  Expect = 2e-58
 Identities = 126/239 52%, Positives = 170/239 71%, Gaps = 6/239 2%
Query  3    GDKPGPNITA---TYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCG 59
            G +PG N +A   T    W  A+AT+YG+ P GA PDD GGACG+K+ ++ PF  MT CG
Sbjct  25   GARPG-NFSASDFTADPNWEVARATWYGA-PTGAGPDDDGGACGFKNTNQYPFSSMTSCG 82
Query  60   NEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK 119
            NEPIFKDG  CGSCY+I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK 
Sbjct  83   NEPIFKDGKGCGSCYQIRCVNHPACSGNPETVIITDMNYYPVSKYHFDLSGTAFGAMAKP 142
Query  120  GEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI 179
            G+ D+LR AG + +QF+RV C +P   K+ FHVE+GS+P Y+A+LV+Y  GDG++V VD+
Sbjct  143  GQNDQLRHAGIIDIQFKRVPCNFPG-LKVTFHVEEGSNPVYFAVLVEYEDGDGDVVQVDL 201
Query  180  KPKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
                S  + PM++SWG+IWR+D    L  PF++R+T+ESG ++    VIP +W P  VY+
Sbjct  202  MEANSQSWTPMRESWGSIWRLDSNHRLTAPFSLRITNESGKQLVASQVIPANWAPMAVYR 261
Query  240  SKIQF 244
            S +Q+
Sbjct  262  SFVQY 266

Sequence Alignment: 29. Allergen Name: Ory s 1 Sequence ID: AAF72987

 Score = 214.6 bits 895,  Expect = 3e-57
 Identities = 125/231 54%, Positives = 168/231 72%, Gaps = 8/231 3%
Query  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
            + YG  WL A+AT+YG+ P GA PDD+GGACG+K+V++ PF  MT CGNEPIFKDG  CG
Sbjct  38   SAYGSGWLPARATWYGA-PTGAGPDDNGGACGFKNVNQYPFSSMTSCGNEPIFKDGKGCG 96
Query  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
            SCY+I+C +   CSG    + ITD NY  +A YHFDLSG AFGAMAK G  DKLR +G +
Sbjct  97   SCYQIRCNKDPSCSGNIETVIITDMNYYPVARYHFDLSGTAFGAMAKPGLNDKLRHSGII 156
Query  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDE----- 186
             +QFRRV C YP   KI FHVE+GS+P Y+A+LV+Y   DG++V VD+    S       
Sbjct  157  DIQFRRVPCNYPG-LKINFHVEEGSNPVYFAVLVEYEDLDGDVVQVDLMESKSAYGGATG 215
Query  187  -FLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
             + PM++SWG+IWR+D    L+ PF++R+ S+SG  +  ++VIP +W P++ Y+S +QF
Sbjct  216  VWTPMRESWGSIWRLDSNHRLQAPFSLRIRSDSGKTLVANNVIPANWSPNSNYRSIVQF 274

Sequence Alignment: 30. Allergen Name: Zea m 1 Sequence ID: Q07154

 Score = 210.1 bits 874,  Expect = 4e-56
 Identities = 121/190 63%, Positives = 147/190 77%, Gaps = 0/190 0%
Query  55   MTGCGNEPIFKDGLACGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFG 114
            MT CGN PIFKDG  CGSCYE++CKE  ECSG PV + ITD NYE IA YHFDLSGKAFG
Sbjct  1    MTACGNVPIFKDGKGCGSCYEVRCKEKPECSGNPVTVFITDMNYEPIAPYHFDLSGKAFG 60
Query  115  AMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNI 174
            ++AK G  DKLR  G + ++FRRV+C+YP+  KI FH+EKG +PNY+A+LVK+ A DG+I
Sbjct  61   SLAKPGLNDKLRHCGIMDVEFRRVRCKYPAGQKIVFHIEKGCNPNYVAVLVKFVADDGDI 120
Query  175  VGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKP 234
            V ++I+ K S E+ PMK SWGAIWRMD  K LKGPF+IRLTSESG  V   D+IP +W+P
Sbjct  121  VLMEIQDKLSAEWKPMKLSWGAIWRMDTAKALKGPFSIRLTSESGKKVIAKDIIPANWRP 180
Query  235  DTVYKSKIQF 244
            D VY S +QF
Sbjct  181  DAVYTSNVQF 190

Sequence Alignment: 31. Allergen Name: Ory s 1 Sequence ID: AAB61710

 Score = 208.4 bits 868,  Expect = 2e-55
 Identities = 122/229 53%, Positives = 162/229 70%, Gaps = 7/229 3%
Query  14   YGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSC 73
            Y + WL AKAT+YG  P GA PDD+GGACG+K+ ++ PF  MT CGNEP+F+DG  CG+C
Sbjct  27   YTNDWLPAKATWYGQ-PNGAGPDDNGGACGFKNTNQYPFMSMTSCGNEPLFQDGKGCGAC 85
Query  74   YEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELML 133
            Y+I+C     CSG+P  + ITD NY  +A YHFDLSG AFGAMA+ G  D+LR AG + +
Sbjct  86   YQIRCTNNPSCSGQPRTVIITDMNYYPVARYHFDLSGTAFGAMARPGLNDQLRHAGIIDI 145
Query  134  QFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIK---PKGSDE--FL 188
            QFRRV C Y     + FHVE GS+P YLA+LV++A  DG +V +D+    P G     + 
Sbjct  146  QFRRVPC-YHRGLYVNFHVEAGSNPVYLAVLVEFANKDGTVVQLDVMESLPSGKPTRVWT 204
Query  189  PMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            PM++SWG+IWR+D    L+GP ++R+ SESG  V    VIP +W+ +T Y SK+QF
Sbjct  205  PMRRSWGSIWRLDANHRLQGPXSLRMVSESGQTVIAHQVIPANWRANTNYGSKVQF 260

Sequence Alignment: 32. Allergen Name: Ory s 1 Sequence ID: AAF72989

 Score = 204.9 bits 853,  Expect = 2e-54
 Identities = 116/225 51%, Positives = 159/225 70%, Gaps = 4/225 1%
Query  18   WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCYEIK 77
            W +AKAT+YG  P GA   D+GGACG+K V++ PF GMT CGN+P++K G  CGSCY ++
Sbjct  43   WGNAKATWYGQ-PNGAGAADNGGACGFKKVNQYPFMGMTSCGNQPLYKGGKGCGSCYRVR 101
Query  78   CKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRR 137
            C     CSG    + ITD NY  ++ YHFDLSG AFG +AK G  D LR+AG + +QF R
Sbjct  102  CNRNPACSGNAQTVAITDMNYFPLSQYHFDLSGIAFGRLAKPGRADDLRRAGIIDVQFAR 161
Query  138  VKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSD--EFLPMKQSWG 195
            V CE+P   K+ FHVE+GSSP YLA+LV+Y  GDG++  VD+K  G+    + PM++SWG
Sbjct  162  VPCEFPG-LKVGFHVEEGSSPVYLAVLVEYENGDGDVAQVDLKEAGAGGGRWTPMRESWG 220
Query  196  AIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            ++WR+D    L+ PF+IR+ S+SG  +   DVIP +W P+T Y+S +Q+
Sbjct  221  SVWRLDSNHRLRAPFSIRIRSDSGKTLVAPDVIPLNWTPNTFYRSFVQY 269

Sequence Alignment: 33. Allergen Name: Tri a ps93 Sequence ID: AAD10496

 Score = 204.7 bits 852,  Expect = 3e-54
 Identities = 121/230 52%, Positives = 168/230 73%, Gaps = 14/230 6%
Query  10   ITATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLA 69
            +  +Y   WL AKAT+YG+ P GA PDD+GGACG+K+V++ P   M  CGNEPIF  G  
Sbjct  32   VARSYTSGWLPAKATWYGA-PNGAGPDDNGGACGFKNVNQYPISSMGACGNEPIFAGGEG 90
Query  70   CGSCYEIKCK---EPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLR 126
            CG CYEIKC+    P+ CSG+P  I ITD NY  +A YH+DLSG AFG+MAK G  D+LR
Sbjct  91   CGMCYEIKCEYSNNPS-CSGQPRRIVITDMNYYPVARYHLDLSGTAFGSMAKYGLNDRLR 149
Query  127  KAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI------K 180
             AG + +QFRRV C +P   K+ FHV++GS+PNYLA+LV+Y   DG +V +++      +
Sbjct  150  HAGIIDMQFRRVPCNFPG-MKVTFHVQRGSNPNYLAVLVEYVNVDGTVVRMELMQTMNGR 208
Query  181  PKGSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKS 240
            P G   +  M++SWG++WRMD  +P++GPF+IR+TS++G  +  ++ IP  W+ D  Y S
Sbjct  209  PTG--YWQDMRRSWGSVWRMDTNRPVQGPFSIRITSDTGKTLVANNAIPAYWQQDHAYWS 266
Query  241  KIQF 244
             +QF
Sbjct  267  NLQF 270

Sequence Alignment: 34. Allergen Name: Ory s 1 Sequence ID: AAF72985

 Score = 203.7 bits 848,  Expect = 5e-54
 Identities = 118/229 51%, Positives = 165/229 72%, Gaps = 12/229 5%
Query  12   ATYGDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACG 71
            A Y   W  A+AT+YG  P GA PDD+GGACG+K  ++ PF  MT CGN+P+FKDG  CG
Sbjct  49   AVYWGPWTKARATWYGQ-PNGAGPDDNGGACGFKHTNQYPFMSMTSCGNQPLFKDGKGCG 107
Query  72   SCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGEL 131
            SCY+I+C +   CSG    + ITD NY  +A +HFDLSG AFG +AK G  DKLR +G +
Sbjct  108  SCYKIRCTKDQSCSGRSETVIITDMNYYPVAPFHFDLSGTAFGRLAKPGLNDKLRHSGII 167
Query  132  MLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI--------KPKG 183
             ++F RV CE+P   KI FHVE+ S+P Y+A+LV+Y  GDG++V VD+         P G
Sbjct  168  DIEFTRVPCEFPG-LKIGFHVEEYSNPVYFAVLVEYEDGDGDVVQVDLMESKTAHGPPTG 226
Query  184  SDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
              ++ PM++SWG+IWR+D    L+ PF+IR+ +ESG  +  ++VIP +W+P+T Y+S +Q
Sbjct  227  --KWTPMRESWGSIWRLDTNHRLQAPFSIRIRNESGKTLVANNVIPANWRPNTFYRSFVQ 284
Query  244  F 244
            +
Sbjct  285  Y 285

Sequence Alignment: 35. Allergen Name: Ory s 1 Sequence ID: AAF72988

 Score = 168.8 bits 698,  Expect = 2e-43
 Identities = 131/226 57%, Positives = 171/226 75%, Gaps = 16/226 7%
Query  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLACGSCY 74
            G  WL+A+AT+YG+ P GA PDD+GGACG+K+V+  PF  MT CGNEP+FKDG  CGSCY
Sbjct  89   GGGWLNARATWYGA-PNGAGPDDNGGACGFKNVNLPPFSAMTSCGNEPLFKDGKGCGSCY 147
Query  75   EIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
            +I+C     CSG P  + ITD NY  ++ YHFDLSG AFGAMAK    D+LR AG + +Q
Sbjct  148  QIRCVGHPACSGLPETVIITDMNYYPVSLYHFDLSGTAFGAMAKDNRNDELRHAGIIDIQ 207
Query  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIV------------GVDIKPK 182
            FRRV C+YP  T + FHVE+GS+P Y+A+LV+Y  GDG++V            GVD  P 
Sbjct  208  FRRVPCQYPGLT-VTFHVEQGSNPVYMAILVEYENGDGDVVQVDLMESRYSTGGVDGTPT 266
Query  183  GSDEFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKI 242
            G   + PM++SWG+IWR+D   PL+GPF++R+T+ESG  +  D VIP DW+P+TVY S +
Sbjct  267  GV--WTPMRESWGSIWRLDTNHPLQGPFSLRITNESGKTLIADQVIPADWQPNTVYSSIV 324
Query  243  QF 244
            QF
Sbjct  325  QF 326

Sequence Alignment: 36. Allergen Name: Ory s 1 Sequence ID: AAF72986

 Score = 166.7 bits 688,  Expect = 7e-43
 Identities = 107/225 47%, Positives = 145/225 64%, Gaps = 12/225 5%
Query  15   GDKWLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSC 73
            G  W    AT+YG  P+G   +  GGACGY+  V + PF  M   G   +FK+G  CGSC
Sbjct  42   GYGWSSGGATWYGG-PQGDGSE--GGACGYQSAVGQRPFSSMIAAGGPSLFKNGKGCGSC 98
Query  74   YEIKCKEPAECSGEPVLIKITDKNYEHIA---AYHFDLSGKAFGAMAKKGEEDKLRKAGE 130
            Y+IKC     CSG PV + ITD     +    A HFD+SG AFGAMA +G  D+LR AG 
Sbjct  99   YQIKCTGNRACSGRPVTVVITDSCPGGVCLNEAAHFDMSGTAFGAMANRGMGDRLRSAGV 158
Query  131  LMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDI-KPKGSDEFLP 189
            L +Q++RV C +  +  +AF V+ GS+P YLA+LV+YA GDG++  V I K +G   +  
Sbjct  159  LKIQYKRVPCRFAMN--VAFKVDAGSNPYYLAILVQYANGDGDLAAVHIMKARGGGGWKA 216
Query  190  MKQSWGAIWRMDPP--KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            M+QSWGA WR++    KPL  PF+IRLTS SG  +  ++VIP  W+    Y+S + +
Sbjct  217  MQQSWGATWRLNSNTGKPLSPPFSIRLTSGSGKVLVANNVIPSGWQAGLTYRSTVNY 273

Sequence Alignment: 37. Allergen Name: Gly m 2 Sequence ID: AAA50175

 Score = 166.7 bits 688,  Expect = 7e-43
 Identities = 104/223 46%, Positives = 144/223 64%, Gaps = 9/223 4%
Query  18   WLDAKATFYGSDPRGAAPDDHGGACGYKD-VDKAPFDGMTGCGNEPIFKDGLACGSCYEI 76
            W  A AT+YG  P        GGACGY + V + PF  +   G+  I+  G  CGSCYE+
Sbjct  48   WSPAVATWYG--P-ANGDGSEGGACGYGNAVGQPPFSSLISAGSPLIYDSGKGCGSCYEV 104
Query  77   KCKEPAECSGEPVLIKITDK--NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQ 134
            KC   + CSG PV + ITD+       A YHFDLSG AFGAMA  G+++ LR AG++ +Q
Sbjct  105  KCTGNSACSGNPVKVVITDECAGCGSDAQYHFDLSGNAFGAMAISGQDENLRNAGKINIQ 164
Query  135  FRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPK-GSDEFLPMKQS 193
             RR++C YP  + IAFHV+ GS+  Y+A LV+Y  GDG++  V++K    S  +  M+QS
Sbjct  165  HRRIECNYPGRS-IAFHVDSGSNQEYFATLVEYEDGDGDLAKVELKEALDSGSWDSMQQS 223
Query  194  WGAIWRMDPPKPLKGPFTIRLTS-ESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            WGA+W+ D   PL+ PF+I+LT+ ESG  +  ++VIP  W P   Y+S + F
Sbjct  224  WGAVWKFDKGSPLRAPFSIKLTTLESGQTIVANNVIPAGWTPGQTYRSIVNF 275

Sequence Alignment: 38. Allergen Name: Ara t expansin Sequence ID: CAB37496

 Score = 98.3 bits 393,  Expect = 3e-22
 Identities = 76/224 33%, Positives = 118/224 52%, Gaps = 15/224 6%
Query  11   TATYGDKWL-DAKATFYGSDPRGAAPDDHGGACGYKDVDKAPFDGMTGCGNEPIFKDGLA 69
            +A   D+ L  +KA ++ S     A     GAC Y  +    F G        I+KDG  
Sbjct  18   SAAACDRCLHSSKAAYFSS-----ASALSSGACAYGSMATGFFAGHIAAALPSIYKDGSG 72
Query  70   CGSCYEIKCKEPAECSGEPVLIKITDKNYEHIAAYHFDLSGKAFGAMAKK--GEEDKLRK 127
            CG+C++++CK P  CS +   + +TD N  +     + LS +AF AMAK   G +  L K
Sbjct  73   CGACFQVRCKNPTLCSSKGTTVIVTDLNKTNQT--DLVLSSRAFRAMAKPVVGADRDLLK 130
Query  128  AGELMLQFRRVKCEYPSDTKIAFHVEKGS-SPNYLALLVKYAAGDGNIVGVDIKPKGSDE 186
             G + +++RRV C+Y  + K+   VE+ S +PNYLA+ + Y  G   +V + I   GS  
Sbjct  131  QGIVDIEYRRVPCDY-GNKKMNVRVEESSKNPNYLAIKLLYQGGQTEVVAIYIAQVGSSH 189
Query  187  FLPMKQSWGAIWRMD--PPKPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
            +  M +S GA+W  D  P   L+  F +      G  V    V+P +W+    Y + +Q
Sbjct  190  WSYMTRSHGAVWVTDKVPNGALQFRFVVT-AGYDGKMVWSQRVLPANWEAGKSYDAGVQ 247

Sequence Alignment: 39. Allergen Name: Ory s 1 Sequence ID: AAG13596

 Score = 87.0 bits 344,  Expect = 7e-19
 Identities = 63/202 31%, Positives = 105/202 51%, Gaps = 10/202 4%
Query  38   HGGACGYKDVDKAPFDGMTGCGNEP-IFKDGLACGSCYEIKCKEPAECSGEPVLIKITDK 96
            + G+CGY  +  A F+G       P +F+ G+ CG+C++++CK+   CS     + +TD+
Sbjct  50   NAGSCGYGSL-AASFNGGHLAAASPALFRGGVGCGACFQVRCKDGKLCSTAGAKVVVTDE 108
Query  97   NYEHIAAYHFDLSGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVE-KG 155
                     + LS  A+ AMA+ G   +LR    + ++++RV CEY +   ++  VE K 
Sbjct  109  A-RSTNRTDLVLSAAAYAAMARPGMAAQLRTRRAVDVEYKRVPCEYAAGRNLSIRVEEKS 167
Query  156  SSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWR--MDPPKPLKGPFTIR 213
              P  L++   Y  G  +IV VD+   GS  +  M + +G  W     P  PL+  F + 
Sbjct  168  RPPRELSIRFLYQGGQTDIVAVDVATVGSSNWKFMTRDYGPAWSTAQAPAGPLQ--FRVV 225
Query  214  LTSESGGH-VEQD-DVIPEDWKPDTVYKSKIQ 243
            +T    G  V  D +V+P  W    VY + +Q
Sbjct  226  VTGGYDGKWVWADGEVLPRRWTAGRVYDAGVQ 257

Sequence Alignment: 40. Allergen Name: Ory s 1 Sequence ID: BAA85432

 Score = 77.9 bits 305,  Expect = 4e-16
 Identities = 72/227 31%, Positives = 116/227 51%, Gaps = 32/227 14%
Query  5    KPGPNITATYGDK-WLDAKATFYGSDPRGAAPDDHGGACGYKDVDKAP-FDGMTGCGNEP 62
            +P P     Y    W D  ATFYG DP G   DD GGACGY   D    +   T   + P
Sbjct  38   QPAPGAVTPYKTSDWHDGSATFYG-DPSGMG-DDFGGACGYVSNDIVSLYSTKTAALSTP 95
Query  63   IFKDGLACGSCYEIKCKEPAECS-GEP-VLIKIT------------DKNYEHIAAYHFDL 108
            +F DG  CG CYE++C +   C+ G P V+I  T            D  + +   +HFD+
Sbjct  96   LFADGNGCGQCYELRCVKSPWCNPGSPSVVITGTNLCPPNWYLPNDDGGWCNPPRHHFDM 155
Query  109  SGKAFGAMAKKGEEDKLRKAGELMLQFRRVKCEYPSDTKIAFHVEKGSSPNYLALLVKYA 168
            +  +F  +A+       R AG + +Q+RRV C+     +  +   +G+   +L L V   
Sbjct  156  APPSFLKLAQ-------RVAGIVPVQYRRVPCQRTGGVRFCL---QGNH-YWLLLYVMNV 204
Query  169  AGDGNIVGVDIKPKGSD-EFLPMKQSWGAIWRMDPPKPLKGPFTIRLTSESGGH--VEQD 225
             G G++  + +K  G    ++   ++WG  +++         +T++LT+ S  +  +   
Sbjct  205  GGAGDVSSLSVKTSGGGGAWIQAAHNWGITYQVFAALDNSDGLTVKLTTYSTPQQTIIVS 264
Query  226  DVIPEDWKPDTVYKSKIQF 244
            D I   W     Y+    F
Sbjct  265  DAISPWWITGLCYQGSNNF 283

Sequence Alignment: 41. Allergen Name: Cyn d 15 Sequence ID: AAP80171

 Score = 71.5 bits 274,  Expect = 1e-14
 Identities = 48/90 53%, Positives = 64/90 71%, Gaps = 7/90 7%
Query  148  IAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPLK 207
            I FHVE+ SSP + AL +K +A +  I  VD++  G+D   PM +S G  W +D  KPLK
Sbjct  22   IIFHVEE-SSPKF-ALSIKDSAKE--ITQVDVREHGADNMDPMTKS-GDSWTID--KPLK 74
Query  208  GPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQF 244
            GP+ IRL +E GG   QDDVIPE+WK  T Y +K++F
Sbjct  75   GPLNIRLRAEGGGSRVQDDVIPENWKAGTDYPTKLHF 111

Sequence Alignment: 42. Allergen Name: Lol p 2 Sequence ID: P14947

 Score = 67.4 bits 256,  Expect = 2e-13
 Identities = 39/92 42%, Positives = 55/92 59%, Gaps = 0/92 0%
Query  148  IAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPLK 207
            + F VEKGS    LAL +KY     ++  V++K  GS+E+L +K++   +W +   KPLK
Sbjct  4    VEFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLK 63
Query  208  GPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
            GPF  R+ SE G     DDV+P D+K  T YK
Sbjct  64   GPFNFRFVSEKGMRNVFDDVVPADFKVGTTYK 95

Sequence Alignment: 43. Allergen Name: Cyn d 2 Sequence ID: CAA10346

 Score = 66.3 bits 252,  Expect = 5e-13
 Identities = 39/90 43%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ F VEKGS+  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238
            KGPF  R+ +E G     DDV+PE +     Y
Sbjct  87   KGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 44. Allergen Name: Poa p 2 Sequence ID: CAA10348

 Score = 65.4 bits 248,  Expect = 1e-12
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ F VEKGS+  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238
            +GPF  R+ +E G     DDV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 45. Allergen Name: Phl p 2 Sequence ID: P43214

 Score = 65.4 bits 248,  Expect = 1e-12
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ F VEKGS+  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238
            +GPF  R+ +E G     DDV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 46. Allergen Name: Dac g 2 Sequence ID: CAA10345

 Score = 65.4 bits 248,  Expect = 1e-12
 Identities = 38/90 42%, Positives = 56/90 62%, Gaps = 2/90 2%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ F VEKGS+  +LA+LVKY  GD  +  V+++  GSDE++ M +  G +W  D  +PL
Sbjct  29   KVTFTVEKGSNEKHLAVLVKYE-GD-TMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL 86
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238
            +GPF  R+ +E G     DDV+PE +     Y
Sbjct  87   QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATY 118

Sequence Alignment: 47. Allergen Name: Lol p 2 Sequence ID: CAA51775

 Score = 62.9 bits 236,  Expect = 4e-12
 Identities = 37/87 42%, Positives = 52/87 59%, Gaps = 0/87 0%
Query  150  FHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPLKGP 209
            F VEKGS    LAL +KY+     +  V++K  GS+E+L +K++   +W +   KPLKGP
Sbjct  2    FTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKGP 61
Query  210  FTIRLTSESGGHVEQDDVIPEDWKPDT 236
            F  R+ SE G     DDV+P D+K  T
Sbjct  62   FNFRFVSEKGMWNVFDDVVPADFKVGT 88

Sequence Alignment: 48. Allergen Name: Dac g 3 Sequence ID: P93124

 Score = 60.0 bits 224,  Expect = 3e-11
 Identities = 35/91 38%, Positives = 51/91 56%, Gaps = 1/91 1%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ F VEKGS P  L L +KY      +  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  2    KVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKK-GNLWEVKSSKPL 60
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVY 238
             GPF  R+ S+ G     D+VIP  +K  T Y
Sbjct  61   TGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTY 92

Sequence Alignment: 49. Allergen Name: Phl p 3.0101 Sequence ID: 2JNZ_A

 Score = 57.1 bits 212,  Expect = 3e-10
 Identities = 33/95 34%, Positives = 52/95 54%, Gaps = 1/95 1%
Query  144  SDTKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPP 203
            S  ++ F V+KGS P  L L +KY     ++  V+++  GS+E+ P+ +  G +W +   
Sbjct  11   SAVQVTFTVQKGSDPKKLVLDIKYTRPGDSLAEVELRQHGSEEWEPLTKK-GNVWEVKSS 69
Query  204  KPLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
            KPL GPF  R+ S+ G     D+VIP  +     YK
Sbjct  70   KPLVGPFNFRFMSKGGMRNVFDEVIPTAFSIGKTYK 105

Sequence Alignment: 50. Allergen Name: Lol p 3 Sequence ID: P14948

 Score = 52.1 bits 190,  Expect = 8e-09
 Identities = 31/83 37%, Positives = 46/83 55%, Gaps = 1/83 1%
Query  146  TKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKP 205
            TK+ + VEKGS    L L +KY      +  V+++  GS+E+ PM +  G +W +   KP
Sbjct  1    TKVDLTVEKGSDAKTLVLNIKYTRPGDTLAEVELRQHGSEEWEPMTKK-GNLWEVKSAKP 59
Query  206  LKGPFTIRLTSESGGHVEQDDVIP 229
            L GP   R+ S+ G     D+VIP
Sbjct  60   LTGPMNFRFLSKGGMKNVFDEVIP 83

Sequence Alignment: 51. Allergen Name: Tri a 3 Sequence ID: CAA90746

 Score = 51.0 bits 186,  Expect = 2e-08
 Identities = 30/92 32%, Positives = 52/92 56%, Gaps = 1/92 1%
Query  147  KIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLPMKQSWGAIWRMDPPKPL 206
            K+ + V+KGS    LAL + Y   + ++  V+++  GS+E+ P+ +  G +W +   KPL
Sbjct  24   KVKLTVQKGSDKKKLALKIDYTRPNDSLSEVELRQYGSEEWQPLTKK-GDVWEVSCSKPL 82
Query  207  KGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYK 239
             GPF  R+ S++G     D+V   D+K    Y+
Sbjct  83   VGPFNFRFLSKNGMKKVFDEVFSTDFKIGKTYE 115

Sequence Alignment: 52. Allergen Name: Sor h 2.0101 Sequence ID: A0A077B7S9

 Score = 50.3 bits 183,  Expect = 3e-08
 Identities = 33/93 35%, Positives = 58/93 62%, Gaps = 6/93 6%
Query  146  TKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLP-MKQSWGAIWRMDPPK 204
            T + + + K S+   L L+   A+ D  +  V +K KG+ +F   +K+S    +  +  +
Sbjct  25   TLMTWTIGKDSTSTRLVLV---ASAD--VSEVAVKDKGATDFSDDLKESPAKTFTYESKE 79
Query  205  PLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
            P+KGP+++R+  +  G+   DDVIP D+KP +VYK+K Q
Sbjct  80   PIKGPLSVRFAVKGQGYRTTDDVIPADFKPGSVYKTKEQ 118

Sequence Alignment: 53. Allergen Name: Sor h 2.0201 Sequence ID: A0A077B2S0

 Score = 49.6 bits 180,  Expect = 6e-08
 Identities = 31/93 33%, Positives = 54/93 58%, Gaps = 6/93 6%
Query  146  TKIAFHVEKGSSPNYLALLVKYAAGDGNIVGVDIKPKGSDEFLP-MKQSWGAIWRMDPPK 204
            T +   V K S+   L+L+   A  +     V +KPKG+ +F   +K+S    + +D  +
Sbjct  27   TTLTIEVGKDSTSTKLSLITNVAISE-----VSVKPKGATDFTDDLKESEPKTFTLDSKE 81
Query  205  PLKGPFTIRLTSESGGHVEQDDVIPEDWKPDTVYKSKIQ 243
            P++GP   R+ ++ GG+   D+ IP D+K  +VYK+  Q
Sbjct  82   PIEGPIAFRFLAKGGGYRVVDNAIPADFKAGSVYKTTEQ 120

Sequence Alignment: 54. Allergen Name: Dac g 1.0101 Sequence ID: Q7M1X8

 Score = 47.6 bits 167,  Expect = 6e-08
 Identities = 24/29 82%, Positives = 26/29 89%, Gaps = 1/29 3%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGAAP 35
            PGPNITATYGDKWLDAK+T+YG  P GA P
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGAGP 34

Sequence Alignment: 55. Allergen Name: Ant o 1.0101 Sequence ID: Q7M1X6

 Score = 45.4 bits 157,  Expect = 3e-07
 Identities = 23/27 85%, Positives = 25/27 92%, Gaps = 1/27 3%
Query  6    PGPNITATYGDKWLDAKATFYGSDPRGA 33
            PGPNITATYGDKWLDAK+T+YG  P GA
Sbjct  6    PGPNITATYGDKWLDAKSTWYGK-PTGA 32

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.