The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK
Sequence Info Allergen Name Length Opt Bits Score E Value
Exo m 1.0101 40 339
P0DKH8 Fag e 4.0102 40 336 85.4 5e-20
CAD24068 Hev b 11.0102 295 266 69.5 2.3e-14
CAC42881 Hev b 11.0101 295 266 69.5 2.3e-14
Q8VXF1 Mus a 2.0101 318 259 67.9 7.6e-14
CAB01591 Pers a 1 326 252 66.2 2.5e-13
P02877 Hev b 6.01 204 239 62.9 1.5e-12
Q42428 Cas s 5 316 240 63.3 1.8e-12
AAA34256 Tri a 18 212 210 56.0 1.9e-10
AAA34258 Tri a 18 213 210 56.0 1.9e-10
AAA34257 Tri a 18 186 206 55.0 3.4e-10
P81729 Bra r 2 91 154 42.3 1.1e-06
P29022 Zea m 8.0101 280 155 43.0 2.1e-06
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Exo Sequence ID:

 Score = 86.1 bits 339,  Expect = 3e-20
 Identities = 40/40 100%, Positives = 40/40 100%, Gaps = 0/40 0%
Query  1    AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK 40
            AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK
Sbjct  1    AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK 40

Sequence Alignment: 2. Allergen Name: Fag e 4.0102 Sequence ID: P0DKH8

 Score = 85.4 bits 336,  Expect = 5e-20
 Identities = 39/40 97%, Positives = 40/40 100%, Gaps = 0/40 0%
Query  1    AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK 40
            AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC+
Sbjct  1    AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR 40

Sequence Alignment: 3. Allergen Name: Hev b 11.0102 Sequence ID: CAD24068

 Score = 69.5 bits 266,  Expect = 2e-14
 Identities = 29/38 76%, Positives = 33/38 86%, Gaps = 0/38 0%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39
            QCG Q GGA CPGGLCCSQ+GWC +TP+YCG+GCQS C
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC 39

Sequence Alignment: 4. Allergen Name: Hev b 11.0101 Sequence ID: CAC42881

 Score = 69.5 bits 266,  Expect = 2e-14
 Identities = 29/38 76%, Positives = 33/38 86%, Gaps = 0/38 0%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39
            QCG Q GGA CPGGLCCSQ+GWC +TP+YCG+GCQS C
Sbjct  2    QCGRQAGGALCPGGLCCSQYGWCANTPEYCGSGCQSQC 39

Sequence Alignment: 5. Allergen Name: Mus a 2.0101 Sequence ID: Q8VXF1

 Score = 67.9 bits 259,  Expect = 8e-14
 Identities = 29/38 76%, Positives = 31/38 81%, Gaps = 0/38 0%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39
            QCG Q GGA CPGGLCCSQ+GWCG+T  YCG GCQS C
Sbjct  21   QCGRQAGGALCPGGLCCSQYGWCGNTDPYCGQGCQSQC 58

Sequence Alignment: 6. Allergen Name: Pers a 1 Sequence ID: CAB01591

 Score = 66.2 bits 252,  Expect = 2e-13
 Identities = 29/38 76%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39
            QCG Q GGA CPGGLCCSQ+GWCGST  YCG  CQS C
Sbjct  27   QCGRQAGGALCPGGLCCSQFGWCGSTSDYCGPTCQSQC 64

Sequence Alignment: 7. Allergen Name: Hev b 6.01 Sequence ID: P02877

 Score = 62.9 bits 239,  Expect = 2e-12
 Identities = 28/39 71%, Positives = 29/39 74%, Gaps = 2/39 5%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGA--GCQSNCK 40
            QCG Q GG  CP  LCCSQWGWCGST +YC     CQSNCK
Sbjct  19   QCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCK 59

Sequence Alignment: 8. Allergen Name: Cas s 5 Sequence ID: Q42428

 Score = 63.3 bits 240,  Expect = 2e-12
 Identities = 27/38 71%, Positives = 30/38 78%, Gaps = 0/38 0%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNC 39
            QCG Q GGA C   LCCSQ+GWCG+T +YCGAGCQS C
Sbjct  20   QCGRQAGGAACANNLCCSQFGWCGNTAEYCGAGCQSQC 57

Sequence Alignment: 9. Allergen Name: Tri a 18 Sequence ID: AAA34256

 Score = 56.0 bits 210,  Expect = 2e-10
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  114  KCGSQAGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 152
 Score = 53.1 bits 198,  Expect = 1e-09
 Identities = 23/39 58%, Positives = 29/39 74%, Gaps = 1/39 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-CK 40
            +CG+Q GGATC    CCSQ+G+CG   +YCGAGCQ   C+
Sbjct  71   RCGSQAGGATCTNNQCCSQYGYCGFGAEYCGAGCQGGPCR 110
 Score = 51.0 bits 189,  Expect = 6e-09
 Identities = 22/37 59%, Positives = 23/37 62%, Gaps = 1/37 2%
Query  3    CGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            CG   GG  C    CCS+WG CG  P YCGAGCQS  C
Sbjct  158  CGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGC 195
 Score = 49.8 bits 184,  Expect = 1e-08
 Identities = 21/38 55%, Positives = 25/38 65%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG QG    CP  LCCSQ+G+CG    YCG GCQ+  C
Sbjct  28   RCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGAC 66

Sequence Alignment: 10. Allergen Name: Tri a 18 Sequence ID: AAA34258

 Score = 56.0 bits 210,  Expect = 2e-10
 Identities = 23/38 60%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQS  C
Sbjct  115  KCGSQSGGKLCPNNLCCSQWGFCGLGSEFCGGGCQSGAC 153
 Score = 54.3 bits 203,  Expect = 6e-10
 Identities = 24/39 61%, Positives = 29/39 74%, Gaps = 1/39 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-CK 40
            +CG+Q GGATCP   CCSQ+G CG   +YCGAGCQ   C+
Sbjct  72   RCGSQAGGATCPNNHCCSQYGHCGFGAEYCGAGCQGGPCR 111
 Score = 51.0 bits 189,  Expect = 6e-09
 Identities = 22/37 59%, Positives = 23/37 62%, Gaps = 1/37 2%
Query  3    CGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            CG   GG  C    CCS+WG CG  P YCGAGCQS  C
Sbjct  159  CGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGC 196
 Score = 49.8 bits 184,  Expect = 1e-08
 Identities = 21/38 55%, Positives = 25/38 65%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG QG    CP  LCCSQ+G+CG    YCG GCQ+  C
Sbjct  29   RCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGAC 67

Sequence Alignment: 11. Allergen Name: Tri a 18 Sequence ID: AAA34257

 Score = 55.0 bits 206,  Expect = 3e-10
 Identities = 22/38 57%, Positives = 28/38 73%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG+Q GG  CP  LCCSQWG+CG   ++CG GCQ+  C
Sbjct  88   KCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGAC 126
 Score = 52.9 bits 197,  Expect = 1e-09
 Identities = 23/39 58%, Positives = 28/39 71%, Gaps = 1/39 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-CK 40
            +CG+Q GG TCP   CCSQ+G CG   +YCGAGCQ   C+
Sbjct  45   RCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCR 84
 Score = 51.7 bits 192,  Expect = 3e-09
 Identities = 22/38 57%, Positives = 26/38 68%, Gaps = 1/38 2%
Query  2    QCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            +CG QG G  CP  LCCSQ+G+CG    YCG GCQ+  C
Sbjct  2    RCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGAC 40
 Score = 50.9 bits 189,  Expect = 6e-09
 Identities = 22/37 59%, Positives = 23/37 62%, Gaps = 1/37 2%
Query  3    CGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSN-C 39
            CG   GG  C    CCS+WG CG  P YCGAGCQS  C
Sbjct  132  CGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGC 169

Sequence Alignment: 12. Allergen Name: Bra r 2 Sequence ID: P81729

 Score = 42.3 bits 154,  Expect = 1e-06
 Identities = 18/33 54%, Positives = 24/33 72%, Gaps = 2/33 6%
Query  6    QGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK 40
            Q GG TC G +CCSQ+G+CG+T  YC     +NC+
Sbjct  1    QAGGQTCAGNICCSQYGYCGTTADYCSP--DNNCQ 33

Sequence Alignment: 13. Allergen Name: Zea m 8.0101 Sequence ID: P29022

 Score = 43.0 bits 155,  Expect = 2e-06
 Identities = 20/38 52%, Positives = 26/38 68%, Gaps = 5/38 13%
Query  3    CGAQGGGAT----CPGGLCCSQWGWCGSTPKYCGAGCQSN-CK 40
            C A G  A     C   +CCS++G+CG+T  YCG GCQS  C+
Sbjct  17   CAAAGPAAAQNCGCQPNFCCSKFGYCGTTDAYCGDGCQSGPCR 59

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.