The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC
QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR
CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD
DQTTTFTCPGGTNYRVVFCP
Sequence Info Allergen Name Length Opt Bits Score E Value
1Z3Q_A Mus a 4.0101 200 1478 279.4 5.1e-77
P81370 Act c 2 225 1205 229.4 6.6e-62
Q9ARG0 Cap a 1.0101 246 1109 211.7 1.4e-56
CAC34055 Cap a 1w 246 1109 211.7 1.4e-56
P12670 Lyc e NP24 247 1081 206.6 5.1e-55
E3SU11 Ole e 13.0101 226 1074 205.4 1.1e-54
AAG34078 Cap a 1 180 921 177.5 2.2e-46
P81295 Jun a 3 225 891 171.9 1.3e-44
AAR21074 Cup s 3.0102 225 868 167.7 2.5e-43
AAR21073 Cup s 3.0101 225 868 167.7 2.5e-43
CAC05258 Cup a 3 199 866 167.4 2.7e-43
AAF80165 Jun v 3.010102 97 419 85.8 4.6e-19
AAF80167 Jun v 3.010101 97 419 85.8 4.6e-19
P50694 Pru av 2 245 261 56.5 7.9e-10
ACE80957 Pru p 2.0201 246 259 56.1 1e-09
ACE80959 Pru p 2.0101 246 258 55.9 1.2e-09
CAC10270 Mal d 2 246 254 55.2 1.9e-09
ACE80955 Pru p 2.0301 242 251 54.7 2.8e-09
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Mus a 4.0101 Sequence ID: 1Z3Q_A

 Score = 279.4 bits 1478,  Expect = 5e-77
 Identities = 200/200 100%, Positives = 200/200 100%, Gaps = 0/200 0%
Query  1    ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC 60
            ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC
Sbjct  1    ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC 60
Query  61   QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR 120
            QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR
Sbjct  61   QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR 120
Query  121  CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD 180
            CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD
Sbjct  121  CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD 180
Query  181  DQTTTFTCPGGTNYRVVFCP 200
            DQTTTFTCPGGTNYRVVFCP
Sbjct  181  DQTTTFTCPGGTNYRVVFCP 200

Sequence Alignment: 2. Allergen Name: Act c 2 Sequence ID: P81370

 Score = 229.4 bits 1205,  Expect = 7e-62
 Identities = 155/200 77%, Positives = 177/200 88%, Gaps = 1/200 0%
Query  1    ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC 60
            ATF I+N C +TVWAAAVPGGG++L++GQ+W IN  AGT G R+W RTGC+FDG+GRG+C
Sbjct  25   ATFNIINNCPFTVWAAAVPGGGKRLDRGQNWIINPGAGTKGARVWPRTGCNFDGAGRGKC 84
Query  61   QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGC-RGI 119
            QTGDC G+L C A+G PPNTLAE+ALNQFNNLDFFDISLVDGFNV M+FSPTSGGC RGI
Sbjct  85   QTGDCNGLLQCQAFGQPPNTLAEYALNQFNNLDFFDISLVDGFNVAMEFSPTSGGCTRGI 144
Query  120  RCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPK 179
            +C ADINGQCP  L+APGGCNNPCTVFKTDQYCCNSG C  T++S+FFK  CPDAYSYPK
Sbjct  145  KCTADINGQCPNELRAPGGCNNPCTVFKTDQYCCNSGNCGLTNFSKFFKDRCPDAYSYPK 204
Query  180  DDQTTTFTCPGGTNYRVVFCP 200
            DDQT+TFTCP GTNY+VVFCP
Sbjct  205  DDQTSTFTCPAGTNYKVVFCP 225

Sequence Alignment: 3. Allergen Name: Cap a 1.0101 Sequence ID: Q9ARG0

 Score = 211.7 bits 1109,  Expect = 1e-56
 Identities = 146/200 73%, Positives = 168/200 84%, Gaps = 5/200 2%
Query  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR 59
            ATFE+ N C YTVWAA+ P GGGR+L++GQ+WTIN   GT   RIWGRT C+FDGSGRG 
Sbjct  22   ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGS 81
Query  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT--SGG-C 116
            CQTGDCGGVL CT +G PPNTLAE+ALNQFNNLDF+DISLVDGFN+PM F+PT  SGG C
Sbjct  82   CQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKC 141
Query  117  RGIRCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYS 176
              I+C A+ING+CPG+L+ PGGCNNPCT F   QYCC  G C PT+ S+FFK+ CPDAYS
Sbjct  142  HAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYS 201
Query  177  YPKDDQTTTFTCPGG-TNYRVVFCP 200
            YP+DD T+TFTCP G TNYRVVFCP
Sbjct  202  YPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 4. Allergen Name: Cap a 1w Sequence ID: CAC34055

 Score = 211.7 bits 1109,  Expect = 1e-56
 Identities = 146/200 73%, Positives = 168/200 84%, Gaps = 5/200 2%
Query  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR 59
            ATFE+ N C YTVWAA+ P GGGR+L++GQ+WTIN   GT   RIWGRT C+FDGSGRG 
Sbjct  22   ATFEVRNNCPYTVWAASTPVGGGRRLDRGQTWTINAPPGTAMARIWGRTNCNFDGSGRGS 81
Query  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT--SGG-C 116
            CQTGDCGGVL CT +G PPNTLAE+ALNQFNNLDF+DISLVDGFN+PM F+PT  SGG C
Sbjct  82   CQTGDCGGVLQCTGWGKPPNTLAEYALNQFNNLDFWDISLVDGFNIPMTFAPTNPSGGKC 141
Query  117  RGIRCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYS 176
              I+C A+ING+CPG+L+ PGGCNNPCT F   QYCC  G C PT+ S+FFK+ CPDAYS
Sbjct  142  HAIQCTANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYS 201
Query  177  YPKDDQTTTFTCPGG-TNYRVVFCP 200
            YP+DD T+TFTCP G TNYRVVFCP
Sbjct  202  YPQDDATSTFTCPSGSTNYRVVFCP 226

Sequence Alignment: 5. Allergen Name: Lyc e NP24 Sequence ID: P12670

 Score = 206.6 bits 1081,  Expect = 5e-55
 Identities = 143/200 71%, Positives = 165/200 82%, Gaps = 5/200 2%
Query  1    ATFEIVNRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGR 59
            AT E+ N C YTVWAA+ P GGGR+LN+GQ+W IN   GT   RIWGRTGC+F+ +GRG 
Sbjct  22   ATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGT 81
Query  60   CQTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT--SGG-C 116
            CQTGDCGGVL CT +G PPNTLAE+AL+QF+NLDF+DISLVDGFN+PM F+PT  SGG C
Sbjct  82   CQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKC 141
Query  117  RGIRCAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYS 176
              I C A+ING+CP ALK PGGCNNPCT F   QYCC  G C PT+ S+FFK+ CPDAYS
Sbjct  142  HAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYS 201
Query  177  YPKDDQTTTFTCPGG-TNYRVVFCP 200
            YP+DD T+TFTCPGG TNYRVVFCP
Sbjct  202  YPQDDPTSTFTCPGGSTNYRVVFCP 226

Sequence Alignment: 6. Allergen Name: Ole e 13.0101 Sequence ID: E3SU11

 Score = 205.4 bits 1074,  Expect = 1e-54
 Identities = 140/200 70%, Positives = 163/200 81%, Gaps = 2/200 1%
Query  1    ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC 60
            ATF+IVN+C+YTVWAAA PGGGR+L+QGQSW INV  GTT  RIWGRT C+FD +GRG+C
Sbjct  25   ATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVAPGTTQARIWGRTNCNFDANGRGQC 84
Query  61   QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR 120
            +TGDC G+L C  YG PPNTLAEFALNQ NNLDF DIS VDGFN+P++FSPT+  CR + 
Sbjct  85   ETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVDISNVDGFNIPLEFSPTTNVCRRLV 144
Query  121  CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG--ACSPTDYSQFFKRNCPDAYSYP 178
            C A I  QCP  L+ PGGCNNPCTVF T++YCC +G  +C PT  S+FFK  CPDAYSYP
Sbjct  145  CNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNGPGSCGPTPLSRFFKERCPDAYSYP 204
Query  179  KDDQTTTFTCPGGTNYRVVFCP 200
            +DD T+ FTCP GTNYRVVFCP
Sbjct  205  QDDPTSLFTCPAGTNYRVVFCP 226

Sequence Alignment: 7. Allergen Name: Cap a 1 Sequence ID: AAG34078

 Score = 177.5 bits 921,  Expect = 2e-46
 Identities = 118/175 67%, Positives = 138/175 78%, Gaps = 4/175 2%
Query  7    NRCSYTVWAAAVP-GGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQTGDC 65
            N C YTVWAAA P GGG++L +GQSW      GT   RIWGRT C+FDG+GRG CQTGDC
Sbjct  1    NNCPYTVWAAATPVGGGKRLERGQSWWFWAPPGTKMARIWGRTNCNFDGAGRGWCQTGDC 60
Query  66   GGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGG---CRGIRCA 122
            GGVL C  +G PPNTLAE+ALNQF+NLDF+DIS++DGFN+PM F PT  G   C  I+C 
Sbjct  61   GGVLECKGWGKPPNTLAEYALNQFSNLDFWDISVIDGFNIPMSFGPTKPGPGKCHPIQCV 120
Query  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKDD 181
            A+ING+CPG+L+ PGGCNNPCT F   QYCC  G C PTD S+FFK+ CPDAYSYP+DD
Sbjct  121  ANINGECPGSLRVPGGCNNPCTTFGGQQYCCTQGPCGPTDLSRFFKQRCPDAYSYPQDD 179

Sequence Alignment: 8. Allergen Name: Jun a 3 Sequence ID: P81295

 Score = 171.9 bits 891,  Expect = 1e-44
 Identities = 116/194 59%, Positives = 143/194 73%, Gaps = 7/194 3%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G CQT
Sbjct  29   FDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQT 88
Query  63   GDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIRCA 122
            GDCGG LSCT  G  P TLAE+  +   + D++D+SLVDGFN+P+  +PT+  C    C 
Sbjct  89   GDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNAQCTAPACK 145
Query  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG---ACSPTDYSQFFKRNCPDAYSYPK 179
            ADIN  CP  LK  GGCN+ C VFKTDQYCC +     C  T+YS+ FK  CP AYSY K
Sbjct  146  ADINAVCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  180  DDQTTTFTCPGGTNYRVVFCP 200
            DD T TF C  GT+Y +VFCP
Sbjct  206  DD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 9. Allergen Name: Cup s 3.0102 Sequence ID: AAR21074

 Score = 167.7 bits 868,  Expect = 2e-43
 Identities = 112/194 57%, Positives = 143/194 73%, Gaps = 7/194 3%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G C++
Sbjct  29   FDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 88
Query  63   GDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIRCA 122
            GDCGG LSCT  G  P TLAE+  +   + D++D+SLVDGFN+P+  +PT+  C    C 
Sbjct  89   GDCGGQLSCTVSGAVPATLAEYTQS---DKDYYDVSLVDGFNIPLAINPTNTKCTAPACK 145
Query  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG---ACSPTDYSQFFKRNCPDAYSYPK 179
            ADIN  CP  LK  GGCN+ C V++TDQYCC +     C  T+YS+ FK  CP AYSY K
Sbjct  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  180  DDQTTTFTCPGGTNYRVVFCP 200
            DD T TF C  GT+Y +VFCP
Sbjct  206  DD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 10. Allergen Name: Cup s 3.0101 Sequence ID: AAR21073

 Score = 167.7 bits 868,  Expect = 2e-43
 Identities = 112/194 57%, Positives = 143/194 73%, Gaps = 7/194 3%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G C++
Sbjct  29   FDIKNQCRYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 88
Query  63   GDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIRCA 122
            GDCGG LSCT  G  P TLAE+  +   + D++D+SLVDGFN+P+  +PT+  C    C 
Sbjct  89   GDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNTKCTAPACK 145
Query  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG---ACSPTDYSQFFKRNCPDAYSYPK 179
            ADIN  CP  LK  GGCN+ C V++TDQYCC +     C  T+YS+ FK  CP AYSY K
Sbjct  146  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVDNCPATNYSKIFKNQCPQAYSYAK 205
Query  180  DDQTTTFTCPGGTNYRVVFCP 200
            DD T TF C  GT+Y +VFCP
Sbjct  206  DD-TATFACASGTDYSIVFCP 225

Sequence Alignment: 11. Allergen Name: Cup a 3 Sequence ID: CAC05258

 Score = 167.4 bits 866,  Expect = 3e-43
 Identities = 111/194 57%, Positives = 143/194 73%, Gaps = 7/194 3%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++++QGQ+WT+N+ AGT   R WGRTGC+FD SG+G C++
Sbjct  3    FDIKNQCGYTVWAAGLPGGGKEFDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCRS 62
Query  63   GDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIRCA 122
            GDCGG LSCT  G  P TLAE+  +   + D++D+SLVDGFN+P+  +PT+  C    C 
Sbjct  63   GDCGGQLSCTVSGAVPATLAEYTQS---DQDYYDVSLVDGFNIPLAINPTNTKCTAPACK 119
Query  123  ADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSG---ACSPTDYSQFFKRNCPDAYSYPK 179
            ADIN  CP  LK  GGCN+ C V++TDQYCC +     C  T+YS+ FK  CP AYSY K
Sbjct  120  ADINAVCPSELKVDGGCNSACNVLQTDQYCCRNAYVNNCPATNYSKIFKNQCPQAYSYAK 179
Query  180  DDQTTTFTCPGGTNYRVVFCP 200
            DD T TF C  GT+Y +VFCP
Sbjct  180  DD-TATFACASGTDYSIVFCP 199

Sequence Alignment: 12. Allergen Name: Jun v 3.010102 Sequence ID: AAF80165

 Score = 85.8 bits 419,  Expect = 5e-19
 Identities = 53/82 64%, Positives = 65/82 79%, Gaps = 0/82 0%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G CQT
Sbjct  9    FDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQT 68
Query  63   GDCGGVLSCTAYGNPPNTLAEF 84
            GDCG  LSCT  G  P TLAE+
Sbjct  69   GDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 13. Allergen Name: Jun v 3.010101 Sequence ID: AAF80167

 Score = 85.8 bits 419,  Expect = 5e-19
 Identities = 53/82 64%, Positives = 65/82 79%, Gaps = 0/82 0%
Query  3    FEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRCQT 62
            F+I N+C YTVWAA +PGGG++L+QGQ+WT+N+ AGT   R WGRTGC+FD SG+G CQT
Sbjct  9    FDIKNQCGYTVWAAGLPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQT 68
Query  63   GDCGGVLSCTAYGNPPNTLAEF 84
            GDCG  LSCT  G  P TLAE+
Sbjct  69   GDCGRQLSCTVSGAVPATLAEY 90

Sequence Alignment: 14. Allergen Name: Pru av 2 Sequence ID: P50694

 Score = 56.5 bits 261,  Expect = 8e-10
 Identities = 91/199 45%, Positives = 113/199 56%, Gaps = 24/199 12%
Query  1    ATFEIVNRCSYTVWAAAVPGG--------GRQLNQGQSWTINVNAGTTGGRIWGRTGCSF 52
            AT    N C Y VW   +           G +L    S+ ++       GR W RTGCS 
Sbjct  24   ATISFKNNCPYMVWPGTLTSDQKPQLSTTGFELASQASFQLDTPV-PWNGRFWARTGCST 82
Query  53   DGSGRGRCQTGDCG-GVLSCTAYGN-PPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFS 110
            D SG+  C T DC  G + C   G  PP TLAEF +      DF+D+SLVDGFN+PM  +
Sbjct  83   DASGKFVCATADCASGQVMCNGNGAIPPATLAEFNIPAGGGQDFYDVSLVDGFNLPMSVT 142
Query  111  PT--SGGCRGIRCAADINGQCPGALKAPGG------CNNPCTVFKTDQYCCNSG-----A 157
            P   +G C+   C A++N  CP  L+  G       C + C  F T QYCC         
Sbjct  143  PQGGTGDCKTASCPANVNAVCPSELQKKGSDGSVVACLSACVKFGTPQYCCTPPQNTPET 202
Query  158  CSPTDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200
            C PT+YS+ F   CPDAYSY  DD+  TFTC GG NY + FCP
Sbjct  203  CPPTNYSEIFHNACPDAYSYAYDDKRGTFTCNGGPNYAITFCP 245

Sequence Alignment: 15. Allergen Name: Pru p 2.0201 Sequence ID: ACE80957

 Score = 56.1 bits 259,  Expect = 1e-09
 Identities = 92/199 46%, Positives = 121/199 60%, Gaps = 24/199 12%
Query  1    ATFEIVNRCSYTVWAAAVPGG--------GRQLNQGQSWTINVNAGTTGGRIWGRTGCSF 52
            A     N+CSYTVW   + G         G +L  G S +++  +  +G R +GRT CS 
Sbjct  25   AKITFTNKCSYTVWPGTLTGDQKPQLSLTGFELATGISNSVDAPSPWSG-RFFGRTRCST 83
Query  53   DGSGRGRCQTGDCG-GVLSCTAYGN-PPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFS 110
            D SG+  C T DCG G +SC   G  PP TL E  + +    DF+D+SLVDGFN+PM  +
Sbjct  84   DASGKFTCATADCGSGQVSCNGNGAVPPATLVEITIAENGGQDFYDVSLVDGFNLPMSVA 143
Query  111  PT--SGGCRGIRCAADINGQCPGALKAPGG------CNNPCTVFKTDQYCCNSG-----A 157
            P   +G C+   C ADIN  CP  L+  G       C + C  +   QYCC         
Sbjct  144  PQGGTGECKASTCPADINKVCPAELQVKGSDGSVIACKSACLALNQPQYCCTPPNDKPET 203
Query  158  CSPTDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200
            C PTDYS++FK  CP AYSY  DD+++TFTC G  +Y + FCP
Sbjct  204  CPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDYLITFCP 246

Sequence Alignment: 16. Allergen Name: Pru p 2.0101 Sequence ID: ACE80959

 Score = 55.9 bits 258,  Expect = 1e-09
 Identities = 92/199 46%, Positives = 120/199 60%, Gaps = 24/199 12%
Query  1    ATFEIVNRCSYTVWAAAVPGG--------GRQLNQGQSWTINVNAGTTGGRIWGRTGCSF 52
            A     N+CSYTVW   + G         G +L  G S +++  +  +G R +GRT CS 
Sbjct  25   AKITFTNKCSYTVWPGTLTGDQKPQLSLTGFKLATGISRSVDAPSPWSG-RFFGRTRCST 83
Query  53   DGSGRGRCQTGDCG-GVLSCTAYGN-PPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFS 110
            D SG+  C T DCG G +SC   G  PP TL E  +      DF+D+SLVDGFN+PM  +
Sbjct  84   DASGKFTCATADCGSGQVSCNGNGAAPPATLVEITIASNGGQDFYDVSLVDGFNLPMSVA 143
Query  111  PT--SGGCRGIRCAADINGQCPGALKAPGG------CNNPCTVFKTDQYCCNSG-----A 157
            P   +G C+   C ADIN  CP  L+  G       C + C  F   +YCC         
Sbjct  144  PQGGTGKCKASTCPADINKVCPAPLQVKGSDGSVIACKSACLAFNQPKYCCTPPNDKPET 203
Query  158  CSPTDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200
            C PTDYS++FK  CP AYSY  DD+++TFTC G  +Y + FCP
Sbjct  204  CPPTDYSKLFKTQCPQAYSYAYDDKSSTFTCSGRPDYLITFCP 246

Sequence Alignment: 17. Allergen Name: Mal d 2 Sequence ID: CAC10270

 Score = 55.2 bits 254,  Expect = 2e-09
 Identities = 86/199 43%, Positives = 118/199 59%, Gaps = 24/199 12%
Query  1    ATFEIVNRCSYTVWAAAVPGG--------GRQLNQGQSWTINVNAGTTGGRIWGRTGCSF 52
            A     N C  TVW   + G         G +L    S +++  +  +G R WGRT CS 
Sbjct  25   AKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAPSPWSG-RFWGRTRCST 83
Query  53   DGSGRGRCQTGDCG-GVLSCTAYGN-PPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFS 110
            D +G+  C+T DCG G ++C   G  PP TL E  +      D++D+SLVDGFN+PM  +
Sbjct  84   DAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVA 143
Query  111  PT--SGGCRGIRCAADINGQCPGAL--KAPGG----CNNPCTVFKTDQYCCNSG-----A 157
            P   +G C+   C A++N  CP  L  KA  G    C + C  F   +YCC         
Sbjct  144  PQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPET 203
Query  158  CSPTDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200
            C PT+YS+ F++ CP AYSY  DD+ +TFTC GG +Y + FCP
Sbjct  204  CPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP 246

Sequence Alignment: 18. Allergen Name: Pru p 2.0301 Sequence ID: ACE80955

 Score = 54.7 bits 251,  Expect = 3e-09
 Identities = 93/199 46%, Positives = 115/199 57%, Gaps = 21/199 10%
Query  1    ATFEIVNRCSYTVWAAA-----VPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGS 55
            AT    N C YTVW A+     +   G +L    S+ ++     +G R W RT CS D S
Sbjct  24   ATMSFKNNCPYTVWPASFGNPQLSTTGFELASQASFQLDTPVPWSG-RFWARTRCSTDAS 82
Query  56   GRGRCQTGDC-GGVLSCTAY-GNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPT- 112
            G+  C+T DC  G L C    G PP TLAEF +      DF+D+SLVDGFN+PM  +P  
Sbjct  83   GKFVCETADCDSGQLMCNGKTGIPPATLAEFTIAAGGGQDFYDVSLVDGFNLPMSVTPQG 142
Query  113  -SGGCRGIRCAADINGQCPGALKAPGG------CNNPCTVFKTDQYCCNSGA-----CSP 160
             +G C+   CAA++N  CP  L+  G       C + C  F   QYCC         C P
Sbjct  143  GTGTCKMGSCAANVNLVCPSELQKIGSDGSVVACLSACVKFGEPQYCCTPPQETKEKCPP 202
Query  161  TDYSQFFKRNCPDAYSYPKDDQTTTFTCPGGTNYRVVFCP 200
            T+YSQ F   CPDAYSY  DD    FTC GG NY + FCP
Sbjct  203  TNYSQIFHEQCPDAYSYAFDDNKGLFTCSGGPNYLITFCP 242

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.