The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAAS
VPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT
EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM
SEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV
Sequence Info Allergen Name Length Opt Bits Score E Value
CAB05371 Phl p 5.0202 281 1723 396.9 4.4e-112
Q40963 Phl p 5.0201 284 1693 390.1 4.9e-110
AAC25996 Phl p 5.0204 265 1592 367.4 3.2e-103
9249029 Phl p 5.0205 265 1573 363.1 6.2e-102
Q9FPR0 Poa p 5.0101 303 1313 304.3 3.4e-84
CAB10765 Hol l 5.0101 264 1217 282.8 9.1e-78
AAD20386 Lol p 5 301 1211 281.3 2.8e-77
AAK62277 Dac g 5.02 265 1207 280.5 4.4e-77
AAK62276 Dac g 5.01 265 1200 278.9 1.3e-76
CAB10766 Hol l 5.0201 240 1010 236.1 9e-64
P22285 Poa p 5 333 893 209.5 1.3e-55
P56164 Pha a 5 320 872 204.8 3.2e-54
P22284 Poa p 5 373 871 204.5 4.7e-54
CAA52753 Phl p 5.0101 312 869 204.2 5e-54
AAC16526 Phl p 5.0106 276 866 203.6 6.6e-54
AAC16527 Phl p 5.0107 276 866 203.6 6.6e-54
CAD87529 Phl p 5.0109 284 863 202.9 1.1e-53
AAC16528 Phl p 5.0108 276 861 202.4 1.4e-53
P22286 Poa p 5 307 861 202.4 1.7e-53
Q40962 Phl p 5.0102 286 858 201.7 2.4e-53
AAK25823 Phl p 5 275 856 201.3 3.1e-53
AAC16525 Phl p 5.0105 276 846 199.1 1.5e-52
CAB05372 Phl p 5.0104 276 836 196.8 7.2e-52
P56167 Pha a 5 175 777 183.8 3.7e-48
CBG76811 Sec c 5.0101 292 754 178.3 2.9e-46
Q40237 Lol p 5 339 729 172.5 1.8e-44
Q40240 Lol p 5 308 678 161.1 4.5e-41
U57845 Hor v 5.0101 313 677 160.8 5.4e-41
P56166 Pha a 5 294 666 158.4 2.8e-40
P56165 Pha a 5 305 602 143.9 6.5e-36
P43215 Phl p 6.0101 132 429 105.5 1e-24
CAA76556 Phl p 6.0102 138 423 104.1 2.8e-24
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Phl p 5.0202 Sequence ID: CAB05371

 Score = 396.9 bits 1723,  Expect = 4e-112
 Identities = 281/281 100%, Positives = 281/281 100%, Gaps = 0/281 0%
Query  1    AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAAS 60
            AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAAS
Sbjct  1    AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAAS 60
Query  61   VPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT 120
            VPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT
Sbjct  61   VPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT 120
Query  121  EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV 180
            EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
Sbjct  121  EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV 180
Query  181  FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM 240
            FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM
Sbjct  181  FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM 240
Query  241  SEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            SEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV
Sbjct  241  SEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281

Sequence Alignment: 2. Allergen Name: Phl p 5.0201 Sequence ID: Q40963

 Score = 390.1 bits 1693,  Expect = 5e-110
 Identities = 276/281 98%, Positives = 276/281 98%, Gaps = 0/281 0%
Query  1    AVPRRGPRGGPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAAS 60
            AVPRRGPRGGPGRSY ADAGYAPATPAAAGA AGKATTEEQKLIEDINVGFKAAVAAAAS
Sbjct  4    AVPRRGPRGGPGRSYTADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAAS 63
Query  61   VPAGDKFKTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT 120
            VPA DKFKTFEAAFTSSSKAA AKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT
Sbjct  64   VPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLT 123
Query  121  EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV 180
            EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV
Sbjct  124  EALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTV 183
Query  181  FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM 240
            FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM
Sbjct  184  FEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAM 243
Query  241  SEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            SEVQKVSQPATGAATVAAGAATTA GAASGAATVAAGGYKV
Sbjct  244  SEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV 284

Sequence Alignment: 3. Allergen Name: Phl p 5.0204 Sequence ID: AAC25996

 Score = 367.4 bits 1592,  Expect = 3e-103
 Identities = 263/265 99%, Positives = 263/265 99%, Gaps = 0/265 0%
Query  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
            ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPA DKFKTFEAAFTS
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTS 60
Query  77   SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVK 136
            SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVK
Sbjct  61   SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVK 120
Query  137  PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA 196
            PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA
Sbjct  121  PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA 180
Query  197  YDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV 256
            YDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV
Sbjct  181  YDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV 240
Query  257  AAGAATTATGAASGAATVAAGGYKV 281
            AAGAATTA GAASGAATVAAGGYKV
Sbjct  241  AAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 4. Allergen Name: Phl p 5.0205 Sequence ID: 9249029

 Score = 363.1 bits 1573,  Expect = 6e-102
 Identities = 260/265 98%, Positives = 261/265 98%, Gaps = 0/265 0%
Query  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
            ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGF AAVAAAASVPA DKFKTFEAAFTS
Sbjct  1    ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFNAAVAAAASVPAADKFKTFEAAFTS 60
Query  77   SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVK 136
            SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDS+VASLTEALRVIAGALEVHAVK
Sbjct  61   SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSLVASLTEALRVIAGALEVHAVK 120
Query  137  PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA 196
            PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA
Sbjct  121  PVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGA 180
Query  197  YDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV 256
            YDTYKCIPSLEAAVKQ YAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV
Sbjct  181  YDTYKCIPSLEAAVKQPYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATV 240
Query  257  AAGAATTATGAASGAATVAAGGYKV 281
            AAGAATTA GAASGAATVAAGGYKV
Sbjct  241  AAGAATTAAGAASGAATVAAGGYKV 265

Sequence Alignment: 5. Allergen Name: Poa p 5.0101 Sequence ID: Q9FPR0

 Score = 304.3 bits 1313,  Expect = 3e-84
 Identities = 220/272 80%, Positives = 243/272 89%, Gaps = 13/272 4%
Query  10   GPGRSYAADAGYAPATPAAAGAEAGKAT-TEEQKLIEDINVGFKAAVAAAASVPAGDKFK 68
            GP  SYAADAGYAPATPAAAGA AGK T T+EQKL+EDINVGFKAAVAAAA  P  DKFK
Sbjct  19   GPAASYAADAGYAPATPAAAGAAAGKITPTQEQKLMEDINVGFKAAVAAAAGAPPADKFK 78
Query  69   TFEAAFTSSSKAATAK-----APGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEAL 123
            TF+AAF++S +A+ AK     APG+V  + A     YKAAVGATPEAKFDSFVA++TEAL
Sbjct  79   TFQAAFSASVEASAAKLNAAQAPGFVSHVAATSDATYKAAVGATPEAKFDSFVAAFTEAL 138
Query  124  RVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEA 183
            R+IAG L+VHAVKP+TEE G AKIPAGE QIIDKIDAAFKVAATAA  APA+DKFTVFEA
Sbjct  139  RIIAGVLKVHAVKPITEETGAAKIPAGEQQIIDKIDAAFKVAATAANAAPANDKFTVFEA 198
Query  184  AFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEV 243
            AFN AIKESTGGAYDTYK IPSLEAAVKQAYAAT+AAAP+VK+AVF+AALTKAITAM+EV
Sbjct  199  AFNNAIKESTGGAYDTYKSIPSLEAAVKQAYAATIAAAPEVKFAVFKAALTKAITAMAEV 258
Query  244  QKVSQPATGAATVAAGAATTATGAASGAA-------TVAAGGYKV 281
            QKVS+P  GAATVAAGAAT ATGAA+GAA       TV+AGGYKV
Sbjct  259  QKVSKPVAGAATVAAGAATAATGAATGAAGAATGAATVSAGGYKV 303

Sequence Alignment: 6. Allergen Name: Hol l 5.0101 Sequence ID: CAB10765

 Score = 282.8 bits 1217,  Expect = 9e-78
 Identities = 202/260 77%, Positives = 225/260 86%, Gaps = 9/260 3%
Query  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
            ADAGY PA PAAAGA  GKATT+EQKL+ED+N GFK AVAAAA+VP  DK+KTFEAAFT+
Sbjct  1    ADAGYTPAAPAAAGA-GGKATTDEQKLLEDVNAGFKTAVAAAANVPPADKYKTFEAAFTA 59
Query  77   SSKAATA----KAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 132
            SSKA+ A    KAPGL+P+L+AA + AY AA GATPEAK+D+FV +LTEALRVIAGALEV
Sbjct  60   SSKASIAAAATKAPGLIPQLNAATNTAYAAAQGATPEAKYDAFVTTLTEALRVIAGALEV 119
Query  133  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 192
            HAVKP TEE G AKIPAGELQI+DKIDAAF++AATAA  AP +DKFTVFE AFNKAIKES
Sbjct  120  HAVKPATEEVGAAKIPAGELQIVDKIDAAFRIAATAANAAPVNDKFTVFEGAFNKAIKES 179
Query  193  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 252
            TGGAY+ YK IPSLE AVKQAYAATVA AP+VKY VFE AL KAITAMSE QK ++P   
Sbjct  180  TGGAYEAYKFIPSLETAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKEAKPVA- 238
Query  253  AATVAAGAATTATGAASGAATVAAGGYKV 281
            AAT   GAAT A G A+GAAT AAGGYKV
Sbjct  239  AAT---GAATAAAGVAAGAATAAAGGYKV 264

Sequence Alignment: 7. Allergen Name: Lol p 5 Sequence ID: AAD20386

 Score = 281.3 bits 1211,  Expect = 3e-77
 Identities = 209/271 77%, Positives = 230/271 84%, Gaps = 11/271 4%
Query  10   GPGRSYAADAGYAPA------TPAAAGAEAG-KATTEEQKLIEDINVGFKAAVAAAASVP 62
            GP  SYAADAGY PA      TPAA  A AG KATT+EQKL+ED+N GFKAAVAAAA+ P
Sbjct  19   GPAASYAADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAP 78
Query  63   AGDKFKTFEAAFTSSSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVAS 118
              DKFK FEAAF+ SSK     + AKAPGL+PKLD AY VAYKAA GATPEAK+D+FV +
Sbjct  79   PADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEGATPEAKYDAFVTA 138
Query  119  LTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKF 178
            LTEALRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA  AP +DKF
Sbjct  139  LTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKF 198
Query  179  TVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAIT 238
            TVFE+AFNKA+ E TGGAY+TYK IPSLEAAVKQAYAATVAAAP+VKYAVFEAALTKAIT
Sbjct  199  TVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAIT 258
Query  239  AMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYK 280
            AM++ QK  +PA  AAT AA  AT A  AA+GAAT AAGGYK
Sbjct  259  AMTQAQKAGKPAAAAATGAATVATGAATAAAGAATAAAGGYK 300

Sequence Alignment: 8. Allergen Name: Dac g 5.02 Sequence ID: AAK62277

 Score = 280.5 bits 1207,  Expect = 4e-77
 Identities = 203/261 77%, Positives = 222/261 85%, Gaps = 8/261 3%
Query  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
            ADAGY PA  A   A  GKA TEEQKLIED+N GFKAAVAAA+S P  DKFKTFEA FT+
Sbjct  1    ADAGYTPAAAATPAAAGGKAMTEEQKLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  77   SSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 132
            + KA    A  K P +V KLDAAY+VAYK A G TPEAK+D+FVA+LTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTAAGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  133  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 192
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  193  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 252
            TGGAY++YK IP+LEAAVKQAYAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAA- 239
Query  253  AATVAAGAATTATGAASGAATVAAGGYKV 281
            AAT   GAAT A  AA+GAAT AAGGYKV
Sbjct  240  AAT---GAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 9. Allergen Name: Dac g 5.01 Sequence ID: AAK62276

 Score = 278.9 bits 1200,  Expect = 1e-76
 Identities = 200/261 76%, Positives = 219/261 83%, Gaps = 8/261 3%
Query  17   ADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTS 76
            ADAGY PA  A      GKA TEEQ LIED+N GFKAAVAAA+S P  DKFKTFEA FT+
Sbjct  1    ADAGYTPAAAATPATAGGKAMTEEQTLIEDVNAGFKAAVAAASSAPPADKFKTFEATFTA 60
Query  77   SSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEV 132
            + KA    A  K P +V KLDAAY+VAYK A G TPEAK+D+FVA+LTEALRVIAGALEV
Sbjct  61   ACKANIAAAATKVPLFVAKLDAAYAVAYKTATGPTPEAKYDAFVAALTEALRVIAGALEV 120
Query  133  HAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKES 192
            HAVKP  EE   AKIPAGELQI+DKIDAA+K+AATAA  APA+DKFTVFE AFNKAIKES
Sbjct  121  HAVKPAAEEVPAAKIPAGELQIVDKIDAAYKIAATAANAAPANDKFTVFEGAFNKAIKES 180
Query  193  TGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATG 252
            TGGAY++YK IP+LEAAVKQAYAATVAAAP+VKYAVFEAALTKAITAMSE QKV+ PA  
Sbjct  181  TGGAYESYKFIPTLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMSEAQKVATPAA- 239
Query  253  AATVAAGAATTATGAASGAATVAAGGYKV 281
               VA GAAT A  AA+GAAT AAGGYKV
Sbjct  240  ---VATGAATAAASAATGAATAAAGGYKV 265

Sequence Alignment: 10. Allergen Name: Hol l 5.0201 Sequence ID: CAB10766

 Score = 236.1 bits 1010,  Expect = 9e-64
 Identities = 171/226 75%, Positives = 192/226 84%, Gaps = 10/226 4%
Query  41   QKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFT-------SSSKAATAKAPGLVPKLD 93
            QKL+ED+N  FKAAVAAAA VP  DK+KTF  AFT         SKA   K P L  KL 
Sbjct  1    QKLLEDVNASFKAAVAAAAKVPPADKYKTFLRAFTVLDRGSTEQSKAEETKMPELSSKLV 60
Query  94   AAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQ 153
             AY  A+KA+ G T EAK+D+FV +LTEALRVIAGALEVHAVKP TEE   AKIPAG+LQ
Sbjct  61   DAYMAAFKASTGGTQEAKYDAFVTTLTEALRVIAGALEVHAVKPATEEVPAAKIPAGDLQ 120
Query  154  IIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQA 213
            ++DKIDA+FK+AATAA  APA+DKFTVFE AFNKA+KESTGGAY++YK IPSLEAAVKQA
Sbjct  121  VVDKIDASFKIAATAANAAPANDKFTVFETAFNKALKESTGGAYESYKFIPSLEAAVKQA 180
Query  214  YAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAATVAAGAATTATG 266
            YA+TVAAAP+VKYAVFEAALTKAITAMS+ QKV+QPA   TGAATVAAGAATTA G
Sbjct  181  YASTVAAAPEVKYAVFEAALTKAITAMSQAQKVAQPAAAATGAATVAAGAATTAAG 236

Sequence Alignment: 11. Allergen Name: Poa p 5 Sequence ID: P22285

 Score = 209.5 bits 893,  Expect = 1e-55
 Identities = 199/269 73%, Positives = 223/269 82%, Gaps = 35/269 13%
Query  10   GPGRSYAADAGYA-------PATPAA--AG----AEAG---KATTEEQKLIEDINVGFKA 53
            GP  SYAAD GY        PATPAA  AG    A AG   KATT+EQKLIE IN GFKA
Sbjct  19   GPAASYAADVGYGAPATLATPATPAAPAAGYTPAAPAGAAPKATTDEQKLIEKINAGFKA 78
Query  54   AVAAAASVPAGDKFKTFEAAFTSSSKAATAKAPGLVPK--------------LDAAYSVA 99
            AVAAAA VPA DK+KTF A F ++S  A A+A    PK              LDAAY +A
Sbjct  79   AVAAAAGVPAVDKYKTFVATFGTASNKAFAEALSTEPKGAAAASSNAVLTSKLDAAYKLA 138
Query  100  YKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKID 159
            YK+A GATPEAK+D++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+IDK+D
Sbjct  139  YKSAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAGEE--VKAIPAGELQVIDKVD 196
Query  160  AAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVA 219
            AAFKVAATAA  APA+DKFTVFEAAFN AIK STGGAY +YK IP+LEAAVKQ+YAATVA
Sbjct  197  AAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVA 256
Query  220  AAPQVKYAVFEAALTKAITAMSEVQKVSQPA---TGAATVAAGAATTATGAASGAATVAA 276
             AP VKY VFE AL KAITAMS+ QK ++PA   T  AT A GAAT A GAA+GAAT AA
Sbjct  257  TAPAVKYTVFETALKKAITAMSQAQKAAKPAAAVTATATGAVGAATGAVGAATGAATAAA 316
Query  277  GGYK 280
            GGYK
Sbjct  317  GGYK 320

Sequence Alignment: 12. Allergen Name: Pha a 5 Sequence ID: P56164

 Score = 204.8 bits 872,  Expect = 3e-54
 Identities = 162/252 64%, Positives = 183/252 72%, Gaps = 14/252 5%
Query  16   AADAGYAPATPAA-AGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAF 74
            AA     P TP       A    T   + +EDIN   +    A  SVP  DKFKTF    
Sbjct  21   AAPTPPTPRTPPLLPPPRARDKATLTSRSVEDINAASRRPWWA--SVPPADKFKTFADHV 78
Query  75   TSSSKA----ATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGAL 130
                 A    A  KAP L  KLDAAY VAY+AA G+TPEAK+D+F+A+LTEALRVIAGA+
Sbjct  79   LCVPNADVTSAATKAPQLKAKLDAAYRVAYEAAEGSTPEAKYDAFIAALTEALRVIAGAF 138
Query  131  EVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIK 190
            EVHAVKP TEE  +   P GELQI+DKIDAAFK+AATAA +APA+DKFTVFE AFNKAIK
Sbjct  139  EVHAVKPATEE--VVADPVGELQIVDKIDAAFKIAATAANSAPANDKFTVFEGAFNKAIK 196
Query  191  ESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPA 250
            EST GAY+TYK IPSLEAAVKQAY ATVA AP+VKYAVFEA LTKAITAMSE QKV++P 
Sbjct  197  ESTAGAYETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLTKAITAMSEAQKVAKPP 256
Query  251  TGAATVAAGAATTATGAASGAATVAA 276
                 ++         AA GAATVAA
Sbjct  257  -----LSPQPPQVLPLAAGGAATVAA 277

Sequence Alignment: 13. Allergen Name: Poa p 5 Sequence ID: P22284

 Score = 204.5 bits 871,  Expect = 5e-54
 Identities = 185/262 70%, Positives = 211/262 80%, Gaps = 23/262 8%
Query  11   PGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTF 70
            P +     A Y PA PA A   A KATT+EQKLIE INVGFKAAVAAAA VPA  K+KTF
Sbjct  98   PAKPAPKVAAYTPAAPAGA---APKATTDEQKLIEKINVGFKAAVAAAAGVPAASKYKTF 154
Query  71   EAAFTSSSKAATAKAPGLVPK--------------LDAAYSVAYKAAVGATPEAKFDSFV 116
             A F ++S  A A+A    PK              LDAAY +AYK+A GATPEAK+D++V
Sbjct  155  VATFGAASNKAFAEALSTEPKGAAVASSKAVLTSKLDAAYKLAYKSAEGATPEAKYDAYV 214
Query  117  ASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADD 176
            A+L+EALR+IAG LEVH VKP  EE  +  IPAGELQ+IDK+DAAFKVAATAA  APA+D
Sbjct  215  ATLSEALRIIAGTLEVHGVKPAAEE--VKAIPAGELQVIDKVDAAFKVAATAANAAPAND 272
Query  177  KFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKA 236
            KFTVFEAAFN AIK STGGAY +YK IP+LEAAVKQ+YAATVA AP VKY VFE AL KA
Sbjct  273  KFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVKYTVFETALKKA 332
Query  237  ITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            ITAMS+ QK ++PA  A T   G AT+A GAA+GAAT AAGGYKV
Sbjct  333  ITAMSQAQKAAKPAA-AVT---GTATSAVGAATGAATAAAGGYKV 373
 Score = 51.3 bits 192,  Expect = 6e-08
 Identities = 35/88 39%, Positives = 52/88 59%, Gaps = 2/88 2%
Query  44   IEDINVGFKAAVAAAASVPAGDKFKTFEAAFTSSSKAATA--KAPGLVPKLDAAYSVAYK 101
            ++  N  +K A+ AA++V   +KF  F+A F  + K   +   A G+  KLDA    +Y 
Sbjct  1    MDKANGAYKTALKAASAVAPAEKFPVFQATFDKNLKEGLSGPDAVGFAKKLDAFIQTSYL 60
Query  102  AAVGATPEAKFDSFVASLTEALRVIAGALE 131
            +   A P+ KFD FV SLTE LR +AGA++
Sbjct  61   STKAAEPKEKFDLFVLSLTEVLRFMAGAVK 90

Sequence Alignment: 14. Allergen Name: Phl p 5.0101 Sequence ID: CAA52753

 Score = 204.2 bits 869,  Expect = 5e-54
 Identities = 192/266 72%, Positives = 217/266 81%, Gaps = 34/266 12%
Query  10   GPGRSYAADAGYAPATPAA--AG------------AEAGKATTEEQKLIEDINVGFKAAV 55
            GP  SYAAD GY PATPAA  AG            A AGKATTEEQKLIE IN GFKAA+
Sbjct  19   GPAASYAADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAAL 78
Query  56   AAAASVPAGDKFKTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYK 101
            AAAA V   DK++TF A F ++S  A A+     P           L  KLDAAY +AYK
Sbjct  79   AAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYK 138
Query  102  AAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAA 161
             A GATPEAK+D++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAA
Sbjct  139  TAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAA 196
Query  162  FKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAA 221
            FKVAATAA  APA+DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA A
Sbjct  197  FKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATA 256
Query  222  PQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            P+VKY VFE AL KAITAMSE QK ++PA  A       AT A GAA+GAAT A GGYKV
Sbjct  257  PEVKYTVFETALKKAITAMSEAQKAAKPAAAATA----TATAAVGAATGAATAATGGYKV 312

Sequence Alignment: 15. Allergen Name: Phl p 5.0106 Sequence ID: AAC16526

 Score = 203.6 bits 866,  Expect = 7e-54
 Identities = 187/259 72%, Positives = 212/259 81%, Gaps = 23/259 8%
Query  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            MSE QK ++PAT A       AT A GAA+GAAT A GGYKV
Sbjct  239  MSEAQKAAKPATEATA----TATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 16. Allergen Name: Phl p 5.0107 Sequence ID: AAC16527

 Score = 203.6 bits 866,  Expect = 7e-54
 Identities = 186/259 71%, Positives = 212/259 81%, Gaps = 23/259 8%
Query  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            MSE QK ++PA  A       AT+A GAA+GA T AAGGYKV
Sbjct  239  MSEAQKAAKPAAAATA----TATSAVGAATGATTAAAGGYKV 276

Sequence Alignment: 17. Allergen Name: Phl p 5.0109 Sequence ID: CAD87529

 Score = 202.9 bits 863,  Expect = 1e-53
 Identities = 188/264 71%, Positives = 214/264 81%, Gaps = 23/264 8%
Query  10   GPGRSYAADAGYAPATPAAAGAE-AGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFK 68
            GP    A  AGY PA P  AGAE AGKATTEEQKLIE IN GFKAA+AAAA VP  DK++
Sbjct  6    GPATPAAPAAGYTPAAP--AGAEPAGKATTEEQKLIEKINAGFKAALAAAAGVPPADKYR 63
Query  69   TFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDS 114
            TF A F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D+
Sbjct  64   TFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDA 123
Query  115  FVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPA 174
            +VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  APA
Sbjct  124  YVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAPA 181
Query  175  DDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALT 234
            +DKFTVFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL 
Sbjct  182  NDKFTVFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALK 241
Query  235  KAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            KAITAMSE QK ++PA  A       AT+A GAA+GAAT A GGYKV
Sbjct  242  KAITAMSEAQKAAKPAAAATA----TATSAVGAATGAATAATGGYKV 284

Sequence Alignment: 18. Allergen Name: Phl p 5.0108 Sequence ID: AAC16528

 Score = 202.4 bits 861,  Expect = 1e-53
 Identities = 186/259 71%, Positives = 211/259 81%, Gaps = 23/259 8%
Query  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEAK+D++VA+L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATL 120
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+AFKVAATAA  APA+DKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSAFKVAATAANAAPANDKFT 178
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KA TA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAFTA 238
Query  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            MSE QK ++PAT A       AT A GAA+GAAT A GGYKV
Sbjct  239  MSEAQKAAKPATEATA----TATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 19. Allergen Name: Poa p 5 Sequence ID: P22286

 Score = 202.4 bits 861,  Expect = 2e-53
 Identities = 195/266 73%, Positives = 220/266 82%, Gaps = 30/266 11%
Query  10   GPGRSYAADAGY-APATPAA--AG----AEAG---KATTEEQKLIEDINVGFKAAVAAAA 59
            GP  SYAAD  Y APATPAA  AG    A AG   KATT+EQK+IE INVGFKAAVAAA 
Sbjct  18   GPAASYAADLSYGAPATPAAPAAGYTPAAPAGAAPKATTDEQKMIEKINVGFKAAVAAAG 77
Query  60   SVPAGDKFKTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVG 105
             VPA +K+KTF A F ++S  A A+A    P           L  KLDAAY +AYK+A G
Sbjct  78   GVPAANKYKTFVATFGAASNKAFAEALSTEPKGAAVDSSKAALTSKLDAAYKLAYKSAEG 137
Query  106  ATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVA 165
            ATPEAK+D +VA+L+EALR+IAG LEVH VKP  EE  +   PAGELQ+IDK+DAAFKVA
Sbjct  138  ATPEAKYDDYVATLSEALRIIAGTLEVHGVKPAAEE--VKATPAGELQVIDKVDAAFKVA 195
Query  166  ATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVK 225
            ATAA  APA+DKFTVFEAAFN AIK STGGAY +YK IP+LEAAVKQ+YAATVA AP VK
Sbjct  196  ATAANAAPANDKFTVFEAAFNDAIKASTGGAYQSYKFIPALEAAVKQSYAATVATAPAVK 255
Query  226  YAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            Y VFE AL KAITAMS+ QK ++PA  AAT   G AT A GAA+GAAT AAGGYKV
Sbjct  256  YTVFETALKKAITAMSQAQKAAKPAA-AAT---GTATAAVGAATGAATAAAGGYKV 307

Sequence Alignment: 20. Allergen Name: Phl p 5.0102 Sequence ID: Q40962

 Score = 201.7 bits 858,  Expect = 2e-53
 Identities = 187/265 70%, Positives = 212/265 80%, Gaps = 23/265 8%
Query  10   GPGRSYAADAGYAPATPAA-AGAEA-GKATTEEQKLIEDINVGFKAAVAAAASVPAGDKF 67
            GP    A  AGY PATPAA AGA+A GKATTEEQKLIE IN GFKAA+A A   PA DK+
Sbjct  6    GPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPA-DKY 64
Query  68   KTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFD 113
            +TF A F  +S  A A+     P           L  KLDAAY +AYK A GATPEAK+D
Sbjct  65   RTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYD 124
Query  114  SFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAP 173
            ++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+DAAFKVAATAA  AP
Sbjct  125  AYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDAAFKVAATAANAAP 182
Query  174  ADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL 233
            A+DKFTVFEAAFN  IK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL
Sbjct  183  ANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETAL 242
Query  234  TKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
             KAITAMSE QK ++PA  A       AT A GAA+GAAT A GGYKV
Sbjct  243  KKAITAMSEAQKAAKPAAAATA----TATAAVGAATGAATAATGGYKV 286

Sequence Alignment: 21. Allergen Name: Phl p 5 Sequence ID: AAK25823

 Score = 201.3 bits 856,  Expect = 3e-53
 Identities = 152/224 67%, Positives = 177/224 79%, Gaps = 20/224 8%
Query  52   KAAVAAAASVPAGDKFKTFEAAFTSSSKAATAKA----P----------GLVPKLDAAYS 97
            KA     A VP  DK++TF A F ++S  A A+     P           L  KLDAAY 
Sbjct  38   KARSERPAIVPPADKYRTFVATFGAASNKAFAEGLSGEPKGGAESSSKAALTSKLDAAYK 97
Query  98   VAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDK 157
            +AYK A GATPEAK+D++VA+L+EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K
Sbjct  98   LAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEK 155
Query  158  IDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAAT 217
            +DAAFKVAATAA  APA+DKFTVFEAAFN AIK  TGGAY++YK IP+LEAAVKQAYAAT
Sbjct  156  VDAAFKVAATAANAAPANDKFTVFEAAFNNAIKAGTGGAYESYKFIPALEAAVKQAYAAT 215
Query  218  VAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAG 277
            VA AP+VKY VFE AL KAITAMSE QK ++PA  A       AT+A GA +GA T AAG
Sbjct  216  VATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATA----TATSAVGAPTGATTAAAG 271
Query  278  GYKV 281
            GYKV
Sbjct  272  GYKV 275

Sequence Alignment: 22. Allergen Name: Phl p 5.0105 Sequence ID: AAC16525

 Score = 199.1 bits 846,  Expect = 2e-52
 Identities = 184/259 71%, Positives = 211/259 81%, Gaps = 23/259 8%
Query  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            F ++S  A A+     P           L  KLDAAY +AYK A GATPEA++D++VA+L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAEYDAYVATL 120
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ+I+K+D+A+KVAATAA  APA+DKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQVIEKVDSALKVAATAANAAPANDKFT 178
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  179  VFEAAFNNAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
             SE QK ++PAT A       AT A GAA+GAAT A GGYKV
Sbjct  239  TSEAQKAAKPATEATA----TATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 23. Allergen Name: Phl p 5.0104 Sequence ID: CAB05372

 Score = 196.8 bits 836,  Expect = 7e-52
 Identities = 183/259 70%, Positives = 210/259 81%, Gaps = 23/259 8%
Query  17   ADAGYA-PATPAAAG--AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAA 73
            AD GY  PATPAA    A AGKATTEEQKLIE IN GFKAA+AAAA VP  DK+KTF A 
Sbjct  1    ADLGYGGPATPAAPAEAAPAGKATTEEQKLIEKINDGFKAALAAAAGVPPADKYKTFVAT 60
Query  74   FTSSSKAATAKA----P----------GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            F ++S  A A+     P           L  KL+AAY +AYK + GATPEAK+D++VA+L
Sbjct  61   FGAASNKAFAEGLSAEPKGAAESSSKGALTSKLEAAYKLAYKTSEGATPEAKYDAYVATL 120
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            +EALR+IAG LEVHAVKP  EE  +  IPAGELQ I+K+D+A+KVAATAA  A A+DKFT
Sbjct  121  SEALRIIAGTLEVHAVKPAAEE--VKVIPAGELQFIEKVDSALKVAATAANAAAANDKFT 178
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFEAAFN AIK STGGAY++YK IP+LEAAVKQAYAATVA AP+VKY VFE AL KAITA
Sbjct  179  VFEAAFNHAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITA 238
Query  240  MSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYKV 281
            MSE QK ++PAT A       AT A GAA+GAAT A GGYKV
Sbjct  239  MSEAQKAAKPATEATA----TATAAVGAATGAATAATGGYKV 276

Sequence Alignment: 24. Allergen Name: Pha a 5 Sequence ID: P56167

 Score = 183.8 bits 777,  Expect = 4e-48
 Identities = 130/172 75%, Positives = 147/172 85%, Gaps = 3/172 1%
Query  110  AKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAA 169
            AK+D+F+A+LTEALRVIAGA+EVHAVKP TEE   AKIPAGELQI+DKIDAAFK+AATAA
Sbjct  1    AKYDAFIAALTEALRVIAGAFEVHAVKPATEEVPAAKIPAGELQIVDKIDAAFKIAATAA 60
Query  170  ATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAA-VKQAYAATVAAAPQVKYAV 228
             +APA+DKFTVFE AFNKAIKE  GGAY+TYK IPSLEA+  KQAY ATVA AP+VKYAV
Sbjct  61   NSAPANDKFTVFEGAFNKAIKERHGGAYETYKFIPSLEASRSKQAYGATVARAPEVKYAV 120
Query  229  FEAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAAT--VAAGGYKV 281
            FEA LTKAITAMSE QKV++P       AAGAAT A GAA+ AA+   +AGGYKV
Sbjct  121  FEAGLTKAITAMSEAQKVAKPVRSVTAAAAGAATAAGGAATVAASRPTSAGGYKV 175

Sequence Alignment: 25. Allergen Name: Sec c 5.0101 Sequence ID: CBG76811

 Score = 178.3 bits 754,  Expect = 3e-46
 Identities = 161/257 62%, Positives = 205/257 79%, Gaps = 30/257 11%
Query  10   GPGRSYAADAGYAPATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKT 69
            GP  SY     YAPA P   G +  KATT EQKL+E+IN GFKAAV AAA+V   DK+KT
Sbjct  19   GPAVSYGT---YAPAAP---GTQP-KATTPEQKLMENINNGFKAAVEAAAAVAPADKYKT 71
Query  70   FEAAFTSSSKAA-----TAKAPGLVP-----------KLDAAYSVAYKAAVGATPEAKFD 113
            F+  F   S  A     TA A G +P            L+++Y +AY +A GATPE K+D
Sbjct  72   FQTTFIKGSNKAFADVLTAAASGQIPAQSDSMARLSTSLESSYKLAYDSAEGATPETKYD 131
Query  114  SFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAP 173
            ++VASLTE+LRVI+GA+EVHAVKP +EE  +  +PA +L+++D+IDAA++ AATAA  AP
Sbjct  132  TYVASLTESLRVISGAFEVHAVKPASEE--VKGVPAPQLKVVDQIDAAYRTAATAANAAP 189
Query  174  ADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAAL 233
             +DKF VFE++FNKAIKE+TGGAY +Y  +P+LE+AVKQAYAATVA+AP+VKYAVF+AAL
Sbjct  190  TNDKFNVFESSFNKAIKENTGGAYASYTFVPALESAVKQAYAATVASAPEVKYAVFQAAL 249
Query  234  TKAITAMSEVQKVSQPATGAATVAAGAATTATGAASGAATVAAGGYK 280
            +KAI AM E +K ++PA  AA  A   AT   GAA+GAA   AGGYK
Sbjct  250  SKAINAMVEAEKDAKPAAAAAATATATATV--GAAAGAA---AGGYK 291

Sequence Alignment: 26. Allergen Name: Lol p 5 Sequence ID: Q40237

 Score = 172.5 bits 729,  Expect = 2e-44
 Identities = 183/272 67%, Positives = 208/272 76%, Gaps = 49/272 18%
Query  10   GPGRSYAADAGYAPATPAAAGAEA-------------------GKATTEEQKLIEDINVG 50
            GP  SYAADAGYAPATPA   A A                   GKATTEEQKLIE IN G
Sbjct  19   GPAASYAADAGYAPATPATPAAPATAATPATPATPATPAAVPSGKATTEEQKLIEKINAG 78
Query  51   FKAAVAAAASVPAGDKFKTFEAAFTSSSKAATAK--APG--------LVPKLDAAYSVAY 100
            FKAAVAAAA VP  DK+KTF   F +++  A  +  A G        L  KLDAA  +AY
Sbjct  79   FKAAVAAAAVVPPADKYKTFVETFGTATNKAFVEGLASGYADQSKNQLTSKLDAALKLAY 138
Query  101  KAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDA 160
            +AA GATPEAK+D++VA+LTEALRVIAG LEVHAVKP  EE  +  IPA E+Q+IDK+DA
Sbjct  139  EAAQGATPEAKYDAYVATLTEALRVIAGTLEVHAVKPAAEEVKVGAIPAAEVQLIDKVDA 198
Query  161  AFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAA 220
            A++ AATAA  APA+DKFTVFE  FN AIK S G AYD+YK IP+L AAVKQAYAA  A 
Sbjct  199  AYRTAATAANAAPANDKFTVFENTFNNAIKVSLGAAYDSYKFIPTLVAAVKQAYAAKQAT 258
Query  221  APQVKYAVFEAALTKAITAMSEVQKVSQPATGA------------ATVAAGAAT------ 262
            AP+VKY V E AL KA+TAMSE +K + PA  A            AT AA  AT      
Sbjct  259  APEVKYTVSETALKKAVTAMSEAEKEATPAAAATATPTPAAATATATPAAAYATATPAAA 318
Query  263  --TATGAASGAATVAAGGYKV 281
              TAT AA+ A   AAGGYKV
Sbjct  319  TATATPAAATATPAAAGGYKV 339

Sequence Alignment: 27. Allergen Name: Lol p 5 Sequence ID: Q40240

 Score = 161.1 bits 678,  Expect = 5e-41
 Identities = 147/263 55%, Positives = 171/263 65%, Gaps = 17/263 6%
Query  4    RRGPRGGPGRSYAADAGYAPA---TPAA-AGAEAGKATTEEQKLIEDINVGFKAAVAAAA 59
            RRGPRGGPGRSYAADAGY PA   TPA  A   AG     + +  E    G +  +A+  
Sbjct  13   RRGPRGGPGRSYAADAGYTPAAAATPATPAATPAGGWREGDDRRAE--AAGGRQRLASRQ 70
Query  60   SVPAGDKFKTFEAAFTS----------SSKAATAKAPGLVPKLDAAYSVAYKAAVGATPE 109
              P         ++ +S          SS  + AKAPGL+PKLD AY VAYKAA  A P 
Sbjct  71   PWPPLPTPLRRTSSRSSRPPSPSPPRASSPTSAAKAPGLIPKLDTAYDVAYKAAE-AHPR 129
Query  110  AKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAA 169
             +   +      +LRVIAGALEVHAVKP TEE   AKIP GELQI+DKIDAAFK+AATAA
Sbjct  130  GQVRRLRHCPHRSLRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAA 189
Query  170  ATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVF 229
              AP +DKFTVFE+AFNKA+ E TGGA       P       +       AAP+VKYAVF
Sbjct  190  NAAPTNDKFTVFESAFNKALNECTGGAMRPTSSSPPSRPRSSRPTPPPSPAAPEVKYAVF 249
Query  230  EAALTKAITAMSEVQKVSQPATGAATVAAGAATTATGAAS 269
            EAALTKAITAM++ QK  +PA  AAT AA  AT A  AA+
Sbjct  250  EAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAA 289

Sequence Alignment: 28. Allergen Name: Hor v 5.0101 Sequence ID: U57845

 Score = 160.8 bits 677,  Expect = 5e-41
 Identities = 118/195 60%, Positives = 151/195 77%, Gaps = 13/195 6%
Query  68   KTFEAAFTSSSK-AATAKAPG-------LVPKLDAAYSVAYKAAVGATPEAKFDSFVASL 119
            + F  AF    K AAT +  G       L   L+ +Y +AY  A GATPEAK+D++VA+L
Sbjct  103  REFRKAFAEVLKGAATGQIAGQSSSMAKLSSSLELSYKLAYDKAQGATPEAKYDAYVATL 162
Query  120  TEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFT 179
            TE+LRVI+G LEVH+VKP  EE  +  +PAGEL+ ID++DAAF+ AATAA  APA+DKFT
Sbjct  163  TESLRVISGTLEVHSVKPAAEE--VKGVPAGELKAIDQVDAAFRTAATAADAAPANDKFT 220
Query  180  VFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITA 239
            VFE+      ++  GGAY++YK IP+LEAAVKQAYAATVAAAP+VK+ VF+ AL+KAI A
Sbjct  221  VFESLQQGPSRKPRGGAYESYKFIPALEAAVKQAYAATVAAAPEVKFTVFQTALSKAINA 280
Query  240  MSEVQKVSQPATGA---ATVAAGAATTA 264
            M++  KV++PA  A   ATVAAGAA TA
Sbjct  281  MTQAGKVAKPAAAATATATVAAGAAATA 308

Sequence Alignment: 29. Allergen Name: Pha a 5 Sequence ID: P56166

 Score = 158.4 bits 666,  Expect = 3e-40
 Identities = 169/260 65%, Positives = 193/260 74%, Gaps = 28/260 10%
Query  10   GPGRSYAADAGY--APATPAAAGAEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKF 67
            GP  SYAADAG    PATPA  GA AGKATT EQKLIEDIN  FK      AS P  DK+
Sbjct  19   GPAASYAADAGTPPTPATPAVPGAAAGKATTHEQKLIEDINAAFK---WWPASAPPADKY 75
Query  68   KTFEAAFTSSSKAATAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIA 127
            KTFE AF S +  A A   GL    DAAYSV Y  A GATPEAK+DSFV +LTEALR++A
Sbjct  76   KTFETAF-SKANIAGASTKGL----DAAYSVVYNTAAGATPEAKYDSFVTALTEALRIMA 130
Query  128  GALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAA----FKVAAT---------AAATAPA 174
            G LEVHAVKP TEE    ++P+ ++   +   +     FK+AAT         AA +APA
Sbjct  131  GTLEVHAVKPATEE----EVPSAKILRANSRSSTRSSRFKIAATVATPLSHSTAANSAPA 186
Query  175  DDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALT 234
            +DKFTVFE AFNKAIKE  GG  +TYK IPSLEAAVKQAY ATVA AP+VKYAVFEA LT
Sbjct  187  NDKFTVFEGAFNKAIKERHGGPTETYKFIPSLEAAVKQAYGATVARAPEVKYAVFEAGLT 246
Query  235  KAITAMSEVQKVSQPATGAATVAAGAATTATGAAS-GAATVAAGGYKV 281
            KAITAMSE QKV++P   +          A GAA+  AA+ + GGYKV
Sbjct  247  KAITAMSEAQKVAKPVRLSPQPPQVLPLAAGGAATVAAASDSRGGYKV 294

Sequence Alignment: 30. Allergen Name: Pha a 5 Sequence ID: P56165

 Score = 143.9 bits 602,  Expect = 6e-36
 Identities = 131/264 49%, Positives = 177/264 67%, Gaps = 31/264 11%
Query  10   GPGRSYAADAGYAPATPAAAGAEAGKAT---TEEQKLIEDINVGFKAAVAA---AASVPA 63
            GP   YA D GYAPATPAA+   A  AT   + ++    + ++  KA +     AA    
Sbjct  19   GPAALYAGD-GYAPATPAASATLATPATPAASPQHAGTTEYHIVRKAGLNEEKNAARQTD 77
Query  64   GDKFKTFEAAFTSSSKAATAKAPGL---------VPKLDAAYSVAYKAAVGATPEAKFDS 114
             ++ ++ E      +K+   +A  L           K D A+ + Y +  G + +   D+
Sbjct  78   DEQKRSDEINCPDFNKSVHCRADRLPVCSSTSAHSSKQDVAWMLGYGSIQGFSMD---DA 134
Query  115  FVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPA 174
             V S++  + VI  A+EV  +  + EE  +  IPAGE+++I+K+ AAF  AATAA  APA
Sbjct  135  SVGSVSSEFHVIESAIEV--ITYIGEE--VKVIPAGEVEVINKVKAAFSTAATAADEAPA 190
Query  175  DDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALT 234
            +DKFTVF ++FNKAIKE+TGGAY  YK IP+LEAAVKQAYAA+ A AP+VKYAVFE AL 
Sbjct  191  NDKFTVFVSSFNKAIKETTGGAYAGYKFIPTLEAAVKQAYAASSATAPEVKYAVFETALK 250
Query  235  KAITAMSEVQKVSQPATG-AATVAAGAATTATGAAS-----GAATVAA--GGYKV 281
            KAI+AMSE QK ++PA   +A     +A+TAT AA      G AT AA  GGYKV
Sbjct  251  KAISAMSEAQKEAKPAAAISAATTTISASTATPAAPPPPQLGTATPAAVAGGYKV 305

Sequence Alignment: 31. Allergen Name: Phl p 6.0101 Sequence ID: P43215

 Score = 105.5 bits 429,  Expect = 1e-24
 Identities = 71/107 66%, Positives = 84/107 78%, Gaps = 4/107 3%
Query  31   AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTSSSKA----ATAKAP 86
            AE GKATTEEQKLIED+N  F+AA+A  A+VP  DK+KTFEAAFT SSK     A +KAP
Sbjct  20   AEGGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAP 79
Query  87   GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKP 137
             LVPKLD  Y+ AY AA  A PE K+++FV  ++EALR+IAG  EVHAVKP
Sbjct  80   QLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKP 130

Sequence Alignment: 32. Allergen Name: Phl p 6.0102 Sequence ID: CAA76556

 Score = 104.1 bits 423,  Expect = 3e-24
 Identities = 71/107 66%, Positives = 83/107 77%, Gaps = 4/107 3%
Query  31   AEAGKATTEEQKLIEDINVGFKAAVAAAASVPAGDKFKTFEAAFTSSSKA----ATAKAP 86
            AE GKATTEEQKLIEDIN  F+AA+A  A+VP  DK+KTFEAAFT SSK     A +KAP
Sbjct  26   AEGGKATTEEQKLIEDINASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAP 85
Query  87   GLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKP 137
             LVPKLD  Y+ AY AA  A PE K+++FV  ++EAL +IAG  EVHAVKP
Sbjct  86   QLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALHIIAGTPEVHAVKP 136

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.