The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA
VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH
HLDWNDTMKSTWDLALNNMFFYILHALEVAQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P02227 Chi t 8 151 996 234.2 1.1e-63
P02222 Chi t 3 160 596 143.0 3.5e-36
P02223 Chi t 6.0201 161 577 138.7 7.1e-35
P02226 Chi t 6.01 145 574 138.1 9.7e-35
P02224 Chi t 5 162 529 127.7 1.4e-31
P02228 Chi t 9 151 511 123.7 2.2e-30
P84298 Chi t 7 161 508 123.0 3.8e-30
P84299 Chi t 7 161 508 123.0 3.8e-30
P02221 Chi t 2.0101 158 479 116.4 3.6e-28
AAA80190 Chi t 2.0102 158 478 116.1 4.3e-28
P02229 Chi t 1.01 151 403 99.1 5.6e-23
P02230 Chi t 1.0201 151 402 98.8 6.6e-23
P02231 Chi t 4 151 253 64.9 1.1e-12
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Chi t 8 Sequence ID: P02227

 Score = 234.2 bits 996,  Expect = 1e-63
 Identities = 151/151 100%, Positives = 151/151 100%, Gaps = 0/151 0%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
            AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA
Sbjct  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
Query  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
            VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH
Sbjct  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
Query  121  HLDWNDTMKSTWDLALNNMFFYILHALEVAQ 151
            HLDWNDTMKSTWDLALNNMFFYILHALEVAQ
Sbjct  121  HLDWNDTMKSTWDLALNNMFFYILHALEVAQ 151

Sequence Alignment: 2. Allergen Name: Chi t 3 Sequence ID: P02222

 Score = 143.0 bits 596,  Expect = 3e-36
 Identities = 83/144 57%, Positives = 110/144 76%, Gaps = 0/144 0%
Query  4    PMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHS 63
            P+SAD+ +L + SW  VKH+EVDILY +FKANPDI AKFPQFAGKDL+++K +  FA H+
Sbjct  17   PLSADEASLVRGSWAQVKHSEVDILYYIFKANPDIMAKFPQFAGKDLETLKGTGQFATHA 76
Query  64   GRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLD 123
            GRIVGF SE++ L+GN  N PA++TLI  +A++HKARGI KAQF EFRASLV YL   + 
Sbjct  77   GRIVGFVSEIVALMGNSANMPAMETLIKDMAANHKARGIPKAQFNEFRASLVSYLQSKVS 136
Query  124  WNDTMKSTWDLALNNMFFYILHAL 147
            WND++ + W   L+N+F  ++  L
Sbjct  137  WNDSLGAAWTQGLDNVFNMMFSYL 160

Sequence Alignment: 3. Allergen Name: Chi t 6.0201 Sequence ID: P02223

 Score = 138.7 bits 577,  Expect = 7e-35
 Identities = 84/144 58%, Positives = 103/144 71%, Gaps = 0/144 0%
Query  4    PMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHS 63
            P+S+DQ    ++SW  VKHNEVDIL AVF  +PDIQA+FPQFAGKDL SIKD+  FA H+
Sbjct  18   PVSSDQANAIRASWAGVKHNEVDILAAVFSDHPDIQARFPQFAGKDLASIKDTGAFATHA 77
Query  64   GRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLD 123
            GRIVGF SE++ L+GN  N PA+ TLI+ L++SH  RGI K QF EFR+SLV YLS H  
Sbjct  78   GRIVGFISEIVALVGNESNAPAMATLINELSTSHHNRGITKGQFNEFRSSLVSYLSSHAS 137
Query  124  WNDTMKSTWDLALNNMFFYILHAL 147
            WND     W   L+N+F  I+  L
Sbjct  138  WNDATADAWTHGLDNIFGMIFAHL 161

Sequence Alignment: 4. Allergen Name: Chi t 6.01 Sequence ID: P02226

 Score = 138.1 bits 574,  Expect = 1e-34
 Identities = 85/144 59%, Positives = 110/144 76%, Gaps = 0/144 0%
Query  4    PMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHS 63
            P+SADQ +L KS+W  V+++EV+IL AVF A PDIQA+FPQFAGKD+ SIKD+  FA H+
Sbjct  2    PLSADQASLVKSTWAQVRNSEVEILAAVFTAYPDIQARFPQFAGKDVASIKDTGAFATHA 61
Query  64   GRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLD 123
            GRIVGF SE+I LIGN  N PA++TL+  LA+SHKARGI +AQF EFRA LV Y+S ++ 
Sbjct  62   GRIVGFVSEIIALIGNESNAPAVQTLVGQLAASHKARGISQAQFNEFRAGLVSYVSSNVA 121
Query  124  WNDTMKSTWDLALNNMFFYILHAL 147
            WN   +S W   L+N+F  ++ AL
Sbjct  122  WNAAAESAWTAGLDNIFGLLFAAL 145

Sequence Alignment: 5. Allergen Name: Chi t 5 Sequence ID: P02224

 Score = 127.7 bits 529,  Expect = 1e-31
 Identities = 79/144 54%, Positives = 104/144 72%, Gaps = 0/144 0%
Query  5    MSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHSG 64
            ++ +Q  L K +W+TVK NEVDILYAVFKA PDI AKFPQFAGKDLDSIKDSA FA H+ 
Sbjct  18   LTTEQADLVKKTWSTVKFNEVDILYAVFKAYPDIMAKFPQFAGKDLDSIKDSAAFATHAT 77
Query  65   RIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLDW 124
            RIV F+SEVI L G+  N PA++ L   LA+SHK RG+ K QF EFR +L  YL  H+++
Sbjct  78   RIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQFTEFRTALFTYLKAHINF 137
Query  125  NDTMKSTWDLALNNMFFYILHALE 148
            +   ++ W LAL+  +  ++ A++
Sbjct  138  DGPTETAWTLALDTTYAMLFSAMD 161

Sequence Alignment: 6. Allergen Name: Chi t 9 Sequence ID: P02228

 Score = 123.7 bits 511,  Expect = 2e-30
 Identities = 72/144 50%, Positives = 101/144 70%, Gaps = 0/144 0%
Query  5    MSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHSG 64
            + A ++   +++W  V H+EV+ILY VFKA+PDI AKFP+FAGKDL++IKD+ADFAVH+ 
Sbjct  7    LDAHEVEQVQATWKAVSHDEVEILYTVFKAHPDIMAKFPKFAGKDLEAIKDTADFAVHAS 66
Query  65   RIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHLDW 124
            RI+GFF E + L+G+  N+ A++TL+  L   HK RGI KAQF EFR ++  YL  H  W
Sbjct  67   RIIGFFGEYVTLLGSSGNQAAIRTLLHDLGVFHKTRGITKAQFGEFRETMTAYLKGHNKW 126
Query  125  NDTMKSTWDLALNNMFFYILHALE 148
            N  +  +WD A++  F  I+  LE
Sbjct  127  NADISHSWDDAFDKAFSVIFEVLE 150

Sequence Alignment: 7. Allergen Name: Chi t 7 Sequence ID: P84298

 Score = 123.0 bits 508,  Expect = 4e-30
 Identities = 76/145 52%, Positives = 99/145 68%, Gaps = 0/145 0%
Query  3    TPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVH 62
            +P++AD+ +L +SSW  V HNEV+IL AVF A PDIQ KF QFAGKDL SIKD+  FA H
Sbjct  17   SPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFAGKDLASIKDTGAFATH 76
Query  63   SGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHL 122
            + RIV F+SEVI L GN  N  A+ +L+  L   HKARG+  AQF EFR +LV YL  ++
Sbjct  77   ATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQFGEFRTALVAYLQANV 136
Query  123  DWNDTMKSTWDLALNNMFFYILHAL 147
             W D + + W+ AL+N F  ++  L
Sbjct  137  SWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 8. Allergen Name: Chi t 7 Sequence ID: P84299

 Score = 123.0 bits 508,  Expect = 4e-30
 Identities = 76/145 52%, Positives = 99/145 68%, Gaps = 0/145 0%
Query  3    TPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVH 62
            +P++AD+ +L +SSW  V HNEV+IL AVF A PDIQ KF QFAGKDL SIKD+  FA H
Sbjct  17   SPLTADEASLVQSSWKAVSHNEVEILAAVFAAYPDIQNKFSQFAGKDLASIKDTGAFATH 76
Query  63   SGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSHHL 122
            + RIV F+SEVI L GN  N  A+ +L+  L   HKARG+  AQF EFR +LV YL  ++
Sbjct  77   ATRIVSFLSEVIALSGNTSNAAAVNSLVSKLGDDHKARGVSAAQFGEFRTALVAYLQANV 136
Query  123  DWNDTMKSTWDLALNNMFFYILHAL 147
             W D + + W+ AL+N F  ++  L
Sbjct  137  SWGDNVAAAWNKALDNTFAIVVPRL 161

Sequence Alignment: 9. Allergen Name: Chi t 2.0101 Sequence ID: P02221

 Score = 116.4 bits 479,  Expect = 4e-28
 Identities = 74/139 53%, Positives = 97/139 69%, Gaps = 1/139 0%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
            A+   S DQ+A  K+SWNTVK+N+VDILYAVFKANPDIQ  F QFAGKDLDSIK + DF+
Sbjct  13   AMAGPSGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFAGKDLDSIKGTPDFS 72
Query  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
             H+GR+VG+FSEV+ L+GN  N P +      +  SHK+R    AQ++ FR SLV YL  
Sbjct  73   KHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSRA-SPAQLDNFRKSLVVYLKG 131
Query  121  HLDWNDTMKSTWDLALNNMF 140
               W+  ++S+W   L+ +F
Sbjct  132  ATKWDSAVESSWAPVLDFVF 151

Sequence Alignment: 10. Allergen Name: Chi t 2.0102 Sequence ID: AAA80190

 Score = 116.1 bits 478,  Expect = 4e-28
 Identities = 74/139 53%, Positives = 97/139 69%, Gaps = 1/139 0%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
            A+   S DQ+A  K+SWNTVK+N+VDILYAVFKANPDIQ  F QFAGKDLDSIK + DF+
Sbjct  13   AMAGPSGDQIAAAKASWNTVKNNQVDILYAVFKANPDIQTAFSQFAGKDLDSIKGTPDFS 72
Query  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
             H+GR+VG+FSEV+ L+GN  N P +      +  SHK+R    AQ++ FR SLV YL  
Sbjct  73   KHAGRVVGLFSEVMDLLGNDANTPTILAKAKDFGKSHKSR-TSPAQLDNFRKSLVVYLKG 131
Query  121  HLDWNDTMKSTWDLALNNMF 140
               W+  ++S+W   L+ +F
Sbjct  132  ATKWDSAVESSWAPVLDFVF 151

Sequence Alignment: 11. Allergen Name: Chi t 1.01 Sequence ID: P02229

 Score = 99.1 bits 403,  Expect = 6e-23
 Identities = 62/140 44%, Positives = 95/140 67%, Gaps = 7/140 5%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
            A + +SADQ++  ++S++ VK + V ILYAVFKA+P I AKF QFAGKDL+SIK +A F 
Sbjct  12   AASALSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFE 71
Query  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
            +H+ RIVGFFS++IG +      P ++  ++ + +SHK RG+   Q+  FRA +V Y+  
Sbjct  72   IHANRIVGFFSKIIGEL------PNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKA 125
Query  121  HLDWNDTMKSTWDLALNNMFFYILHAL 147
            H D+    ++ W   L+  F  I+  +
Sbjct  126  HTDFAGA-EAAWGATLDTFFGMIFSKM 151

Sequence Alignment: 12. Allergen Name: Chi t 1.0201 Sequence ID: P02230

 Score = 98.8 bits 402,  Expect = 7e-23
 Identities = 63/137 45%, Positives = 92/137 67%, Gaps = 7/137 5%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFA 60
            A + ++ADQ++  +SS+  VK + V ILYAVFKA+P IQAKF QFAGKDLDSIK SADF+
Sbjct  12   AASALTADQISTVQSSFAGVKGDAVGILYAVFKADPSIQAKFTQFAGKDLDSIKGSADFS 71
Query  61   VHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYLSH 120
             H+ +IVGFFS++IG      + P +   +  + +SH  RG+   Q+  FRA +V Y+  
Sbjct  72   AHANKIVGFFSKIIG------DLPNIDGDVTTFVASHTPRGVTHDQLNNFRAGFVSYMKA 125
Query  121  HLDWNDTMKSTWDLALNNMFFYIL 144
            H D+    ++ W   L+  F  ++
Sbjct  126  HTDFAGA-EAAWGATLDAFFGMVF 148

Sequence Alignment: 13. Allergen Name: Chi t 4 Sequence ID: P02231

 Score = 64.9 bits 253,  Expect = 1e-12
 Identities = 49/141 34%, Positives = 83/141 58%, Gaps = 9/141 6%
Query  1    AVTPMSADQLALFKSSWNTVKHNEVDILYAVFKANPDIQAKFPQFA--GKDLDSIKDSAD 58
            A+  M+  Q+A  K  W  +K + V+ILY  +   P     FP F   G DL + K +A+
Sbjct  5    AMPSMTDAQVAAVKGDWEKIKGSGVEILYFFLNKFP---GNFPMFKKLGNDLAAAKGTAE 61
Query  59   FAVHSGRIVGFFSEVIGLIGNPENRPALKTLIDGLASSHKARGIEKAQFEEFRASLVDYL 118
            F  ++ +I+ F+  VI  +G+  +    K L++ L +SHKA GI K QF++FR +L + L
Sbjct  62   FKDQADKIIAFLQGVIEKLGS--DMGGAKALLNQLGTSHKAMGITKDQFDQFRQALTELL 119
Query  119  SHHLDWNDTMKSTWDLALNNMFFYILHALE 148
             + L +   +   W+  ++ MF  I++AL+
Sbjct  120  GN-LGFGGNI-GAWNATVDLMFHVIFNALD 147

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.