The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA
QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN
GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN
KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW
IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG
IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY
VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF
RNE
Sequence Info Allergen Name Length Opt Bits Score E Value
CAH92637 Lol p 4.0101 423 2896 666.5 6.9e-193
CAD54671 Phl p 4.0201 508 2715 625.2 2.2e-180
CAD54670 Phl p 4.0101 508 2679 617.0 6.6e-178
P82946 Dac g 4 55 111 37.0 0.00027
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Lol p 4.0101 Sequence ID: CAH92637

 Score = 666.5 bits 2896,  Expect = 7e-193
 Identities = 423/423 100%, Positives = 423/423 100%, Gaps = 0/423 0%
Query  1    AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA 60
            AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA
Sbjct  1    AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA 60
Query  61   QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN 120
            QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN
Sbjct  61   QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN 120
Query  121  GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN 180
            GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN
Sbjct  121  GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN 180
Query  181  KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW 240
            KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW
Sbjct  181  KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW 240
Query  241  IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG 300
            IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG
Sbjct  241  IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG 300
Query  301  IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY 360
            IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY
Sbjct  301  IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY 360
Query  361  VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF 420
            VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF
Sbjct  361  VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF 420
Query  421  RNE 423
            RNE
Sbjct  421  RNE 423

Sequence Alignment: 2. Allergen Name: Phl p 4.0201 Sequence ID: CAD54671

 Score = 625.2 bits 2715,  Expect = 2e-180
 Identities = 393/423 92%, Positives = 409/423 96%, Gaps = 0/423 0%
Query  1    AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA 60
            AVVCGRR+ VRIRVRSGGHDYEGLSYRSLQPE FAVVDLN+MRAV VDGKARTAWVDSGA
Sbjct  76   AVVCGRRHSVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGA 135
Query  61   QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN 120
            QLGELYYAI K S TLAFPAGVCPTIGVGGN+AGGGFGMLLRKYGIAAENVIDVKLVDAN
Sbjct  136  QLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDAN 195
Query  121  GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN 180
            GKLHDKKSMGDDHFWAVRGGGGESFGIVV+WQVKLLPVPPTVTIFKI K+VSEGAVDIIN
Sbjct  196  GKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIIN 255
Query  181  KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW 240
            KWQ+VAPQLPADLMIRIIA GPKATFEAMYLGTCKTLTP+M SKFPELGMN SHCNEMSW
Sbjct  256  KWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSW 315
Query  241  IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG 300
            I+SIPFVHLGHRD+LE DLLNRNN+FKPFAEYKSDYVY+PFPK+VWEQI+ TWLVKPGAG
Sbjct  316  IQSIPFVHLGHRDALEDDLLNRNNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAG 375
Query  301  IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY 360
            IMIFDPYGATISATPE+ATPFPHRKGVLFNIQYVNYWFAPGA AAPLSWSK+IYNYMEPY
Sbjct  376  IMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPY 435
Query  361  VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF 420
            VSKNPRQAYANYRDIDLGRNEVVN VSTY+SGKVWGQKYFKGNFERLAITKGKVDPTDYF
Sbjct  436  VSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYF 495
Query  421  RNE 423
            RNE
Sbjct  496  RNE 498

Sequence Alignment: 3. Allergen Name: Phl p 4.0101 Sequence ID: CAD54670

 Score = 617.0 bits 2679,  Expect = 7e-178
 Identities = 385/423 91%, Positives = 403/423 95%, Gaps = 0/423 0%
Query  1    AVVCGRRYDVRIRVRSGGHDYEGLSYRSLQPENFAVVDLNQMRAVLVDGKARTAWVDSGA 60
            AVVCGRR+ VRIRVRSGGHDYEGLSYRSLQPE FAVVDL++MRAV VDGKARTAWVDSGA
Sbjct  76   AVVCGRRHGVRIRVRSGGHDYEGLSYRSLQPEEFAVVDLSKMRAVWVDGKARTAWVDSGA 135
Query  61   QLGELYYAISKYSRTLAFPAGVCPTIGVGGNLAGGGFGMLLRKYGIAAENVIDVKLVDAN 120
            QLGELYYAI K S  LAFPAGVCPTIGVGGN+AGGGFGMLLRKYGIAAENVIDVKLVDAN
Sbjct  136  QLGELYYAIHKASPVLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDAN 195
Query  121  GKLHDKKSMGDDHFWAVRGGGGESFGIVVSWQVKLLPVPPTVTIFKIPKSVSEGAVDIIN 180
            G LHDKKSMGDDHFWAVRGGGGESFGIVV+W+V+LLPVPPTVT+FKIPK  SEGAVDIIN
Sbjct  196  GTLHDKKSMGDDHFWAVRGGGGESFGIVVAWKVRLLPVPPTVTVFKIPKKASEGAVDIIN 255
Query  181  KWQLVAPQLPADLMIRIIAMGPKATFEAMYLGTCKTLTPMMQSKFPELGMNASHCNEMSW 240
            +WQ+VAPQLP DLMIR+IA GP ATFEAMYLGTC+TLTPMM SKFPELGMNASHCNEMSW
Sbjct  256  RWQVVAPQLPDDLMIRVIAQGPTATFEAMYLGTCQTLTPMMSSKFPELGMNASHCNEMSW 315
Query  241  IESIPFVHLGHRDSLEGDLLNRNNTFKPFAEYKSDYVYEPFPKSVWEQIFGTWLVKPGAG 300
            I+SIPFVHLGHRD++E DLLNRNNTFKPFAEYKSDYVYEPFPK VWEQIF TWL+KPGAG
Sbjct  316  IQSIPFVHLGHRDNIEDDLLNRNNTFKPFAEYKSDYVYEPFPKEVWEQIFSTWLLKPGAG 375
Query  301  IMIFDPYGATISATPEAATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY 360
            IMIFDPYGATISATPE ATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY
Sbjct  376  IMIFDPYGATISATPEWATPFPHRKGVLFNIQYVNYWFAPGAGAAPLSWSKEIYNYMEPY 435
Query  361  VSKNPRQAYANYRDIDLGRNEVVNGVSTYSSGKVWGQKYFKGNFERLAITKGKVDPTDYF 420
            VSKNPRQAYANYRDIDLGRNEVVN VST+SSG VWGQKYFKGNF+RLAITKGKVDPTDYF
Sbjct  436  VSKNPRQAYANYRDIDLGRNEVVNDVSTFSSGLVWGQKYFKGNFQRLAITKGKVDPTDYF 495
Query  421  RNE 423
            RNE
Sbjct  496  RNE 498

Sequence Alignment: 4. Allergen Name: Dac g 4 Sequence ID: P82946

 Score = 37.0 bits 111,  Expect = 0.0003
 Identities = 16/20 80%, Positives = 18/20 90%, Gaps = 0/20 0%
Query  50   KARTAWVDSGAQLGELYYAI 69
            +ARTAWVDSGAQLGEL Y +
Sbjct  23   QARTAWVDSGAQLGELSYGV 42

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.