The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL
WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV
GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN
AVYLFGPLKEVQ
Sequence Info Allergen Name Length Opt Bits Score E Value
P05946 Pon l 4.0101 192 1265 295.3 7.8e-82
I2DDG2 Scy p 4.0101 193 1106 259.0 6.4e-71
FJ184279 Lit v 4.0101 193 1087 254.7 1.3e-69
ADV17343 Pen m 4.0101 193 1087 254.7 1.3e-69
Q16XK7 Aed a 5.0101 191 749 177.7 2e-46
CAQ72970 Clu h 1.0101 109 116 33.8 0.0022
Q91482 Sal s 1 109 116 33.8 0.0022
Q91483 Sal s 1 107 114 33.4 0.0029
CAA66404 Sal s 1 108 114 33.4 0.003
AAK63087 Gad m 1.0201 109 114 33.4 0.003
Q90YK9 Gad m 1.0201 109 114 33.4 0.003
CAM56786 Gad m 1.0202 109 114 33.4 0.003
CAC83658 Cyp c 1.01 109 109 32.3 0.0067
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pon l 4.0101 Sequence ID: P05946

 Score = 295.3 bits 1265,  Expect = 8e-82
 Identities = 192/192 100%, Positives = 192/192 100%, Gaps = 0/192 0%
Query  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
            AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL
Sbjct  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
Query  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
            WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV
Sbjct  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
Query  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
            GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN
Sbjct  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
Query  181  AVYLFGPLKEVQ 192
            AVYLFGPLKEVQ
Sbjct  181  AVYLFGPLKEVQ 192

Sequence Alignment: 2. Allergen Name: Scy p 4.0101 Sequence ID: I2DDG2

 Score = 259.0 bits 1106,  Expect = 6e-71
 Identities = 162/192 84%, Positives = 173/192 90%, Gaps = 0/192 0%
Query  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
            AYSWDNRVKYVVRYMYDIDNNG+LDKNDFECLALRNTLIEGRGEFN  AYANNQKIMSNL
Sbjct  2    AYSWDNRVKYVVRYMYDIDNNGYLDKNDFECLALRNTLIEGRGEFNSDAYANNQKIMSNL 61
Query  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
            WNEIAELADFNKDG+VT+DEFK+AVQN+C GK+F  FP  FK  I   FKT+D+NGDGL 
Sbjct  62   WNEIAELADFNKDGQVTVDEFKQAVQNLCCGKSFDGFPPCFKTVIGRLFKTIDINGDGLA 121
Query  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
            GVDEYRLDCISRSAF+++KEIDDAY KL TD DKKAGGISL RYQELYAQFISNPDE  N
Sbjct  122  GVDEYRLDCISRSAFSSVKEIDDAYAKLCTDDDKKAGGISLNRYQELYAQFISNPDEKCN 181
Query  181  AVYLFGPLKEVQ 192
            AVYLFGPLKEVQ
Sbjct  182  AVYLFGPLKEVQ 193

Sequence Alignment: 3. Allergen Name: Lit v 4.0101 Sequence ID: FJ184279

 Score = 254.7 bits 1087,  Expect = 1e-69
 Identities = 158/192 82%, Positives = 173/192 90%, Gaps = 0/192 0%
Query  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
            AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLA+RNTLIEGRGEF+  AYANNQKIM NL
Sbjct  2    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNL 61
Query  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
            WNEIAELADFNKDGEVT+DEFK+AVQ  C GK +  FP AFKVFIANQFK +DVNGDG V
Sbjct  62   WNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKV 121
Query  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
            G+DEYRLDCI+RSAFA +KEIDDAYNKL T+ D+KAGG++L RYQ+LYAQFISNPDES +
Sbjct  122  GLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCS 181
Query  181  AVYLFGPLKEVQ 192
            A YLFGPLK VQ
Sbjct  182  ACYLFGPLKVVQ 193

Sequence Alignment: 4. Allergen Name: Pen m 4.0101 Sequence ID: ADV17343

 Score = 254.7 bits 1087,  Expect = 1e-69
 Identities = 158/192 82%, Positives = 173/192 90%, Gaps = 0/192 0%
Query  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
            AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLA+RNTLIEGRGEF+  AYANNQKIM NL
Sbjct  2    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNL 61
Query  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
            WNEIAELADFNKDGEVT+DEFK+AVQ  C GK +  FP AFKVFIANQFK +DVNGDG V
Sbjct  62   WNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKV 121
Query  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
            G+DEYRLDCI+RSAFA +KEIDDAYNKL T+ D+KAGG++L RYQ+LYAQFISNPDES +
Sbjct  122  GLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCS 181
Query  181  AVYLFGPLKEVQ 192
            A YLFGPLK VQ
Sbjct  182  ACYLFGPLKVVQ 193

Sequence Alignment: 5. Allergen Name: Aed a 5.0101 Sequence ID: Q16XK7

 Score = 177.7 bits 749,  Expect = 2e-46
 Identities = 99/190 52%, Positives = 142/190 74%, Gaps = 0/190 0%
Query  1    AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNL 60
            +Y W+ RV+++V +MYDIDNNGFLD NDF C+ALR T++EG+G  N A     + IM  L
Sbjct  2    SYPWEKRVEFIVGHMYDIDNNGFLDNNDFMCMALRATVVEGKGTINPARLNEYRTIMKAL 61
Query  61   WNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLV 120
            W+EI+ LAD++ DG++T +EFK AV+  CVGK+++ FP A K FI  +++ +D+N DGLV
Sbjct  62   WDEISALADLDHDGKITTEEFKDAVKATCVGKSYSDFPKAMKAFIDAHYQMMDINNDGLV 121
Query  121  GVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESAN 180
             ++EYR +CISR A  +IK++DD+YN+L +D D K GGI+L RYQELYAQF+ N  +   
Sbjct  122  SIEEYRYNCISRIAMDDIKKVDDSYNQLVSDEDNKRGGITLQRYQELYAQFMGNESDKCA 181
Query  181  AVYLFGPLKE 190
            A++L+GP+ E
Sbjct  182  AIFLYGPIPE 191

Sequence Alignment: 6. Allergen Name: Clu h 1.0101 Sequence ID: CAQ72970

 Score = 33.8 bits 116,  Expect = 0.002
 Identities = 23/55 41%, Positives = 34/55 61%, Gaps = 5/55 9%
Query  66   ELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEY 125
            E+ D +K G +  +E+K  +QN   G A A   A  K F+    K  D +GDG++GVDE+
Sbjct  49   EIIDQDKSGFIEEEELKLFLQNFKAG-ARALTDAETKAFL----KAGDADGDGMIGVDEF 103

Sequence Alignment: 7. Allergen Name: Sal s 1 Sequence ID: Q91482

 Score = 33.8 bits 116,  Expect = 0.002
 Identities = 20/55 36%, Positives = 34/55 61%, Gaps = 5/55 9%
Query  66   ELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEY 125
            ++ D +  G + ++E+K  +QN C  KA     A  K F+    K  D +GDG++G+DE+
Sbjct  49   KVIDQDASGFIEVEELKLFLQNFC-PKARELTDAETKAFL----KAGDADGDGMIGIDEF 103

Sequence Alignment: 8. Allergen Name: Sal s 1 Sequence ID: Q91483

 Score = 33.4 bits 114,  Expect = 0.003
 Identities = 26/76 34%, Positives = 43/76 56%, Gaps = 8/76 10%
Query  45   FNEAAYANNQKIMSNLWNEIAE---LADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAF 101
            FN  A+     + S   +++ +   + D +K G +  DE+K  +QN     A A   A  
Sbjct  23   FNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSAS-ARALTDAET 81
Query  102  KVFIANQFKTVDVNGDGLVGVDEY 125
            K F+A+     D +GDG++GVDE+
Sbjct  82   KAFLADG----DKDGDGMIGVDEF 101

Sequence Alignment: 9. Allergen Name: Sal s 1 Sequence ID: CAA66404

 Score = 33.4 bits 114,  Expect = 0.003
 Identities = 26/76 34%, Positives = 43/76 56%, Gaps = 8/76 10%
Query  45   FNEAAYANNQKIMSNLWNEIAE---LADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAF 101
            FN  A+     + S   +++ +   + D +K G +  DE+K  +QN     A A   A  
Sbjct  24   FNHKAFFAKVGLASKSSDDVKKAFYVIDQDKSGFIEEDELKLFLQNFSAS-ARALTDAET 82
Query  102  KVFIANQFKTVDVNGDGLVGVDEY 125
            K F+A+     D +GDG++GVDE+
Sbjct  83   KAFLADG----DKDGDGMIGVDEF 102

Sequence Alignment: 10. Allergen Name: Gad m 1.0201 Sequence ID: AAK63087

 Score = 33.4 bits 114,  Expect = 0.003
 Identities = 25/58 43%, Positives = 35/58 60%, Gaps = 5/58 8%
Query  63   EIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGV 122
            ++ E+ D +K   V  DE+K  +QN   G A A   A  KVF+    K  D +GDG +GV
Sbjct  46   KVFEIIDQDKSDFVEEDELKLFLQNFSAG-ARALSDAETKVFL----KAGDSDGDGKIGV 100
Query  123  DEY 125
            DE+
Sbjct  101  DEF 103

Sequence Alignment: 11. Allergen Name: Gad m 1.0201 Sequence ID: Q90YK9

 Score = 33.4 bits 114,  Expect = 0.003
 Identities = 25/58 43%, Positives = 35/58 60%, Gaps = 5/58 8%
Query  63   EIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGV 122
            ++ E+ D +K   V  DE+K  +QN   G A A   A  KVF+    K  D +GDG +GV
Sbjct  46   KVFEIIDQDKSDFVEEDELKLFLQNFSAG-ARALSDAETKVFL----KAGDSDGDGKIGV 100
Query  123  DEY 125
            DE+
Sbjct  101  DEF 103

Sequence Alignment: 12. Allergen Name: Gad m 1.0202 Sequence ID: CAM56786

 Score = 33.4 bits 114,  Expect = 0.003
 Identities = 25/58 43%, Positives = 35/58 60%, Gaps = 5/58 8%
Query  63   EIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGV 122
            ++ E+ D +K   V  DE+K  +QN   G A A   A  KVF+    K  D +GDG +GV
Sbjct  46   KVFEIIDQDKSDFVEEDELKLFLQNFSAG-ARALSDAETKVFL----KAGDSDGDGKIGV 100
Query  123  DEY 125
            DE+
Sbjct  101  DEF 103

Sequence Alignment: 13. Allergen Name: Cyp c 1.01 Sequence ID: CAC83658

 Score = 32.3 bits 109,  Expect = 0.007
 Identities = 23/52 44%, Positives = 31/52 59%, Gaps = 5/52 9%
Query  69   DFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEY 125
            D +K G +  DE+K  +QN   G A A   A  K F+    K  D +GDG +GVDE+
Sbjct  52   DQDKSGFIEEDELKLFLQNFSAG-ARALTDAETKAFL----KAGDSDGDGKIGVDEF 103

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.