The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA
VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF
RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD
LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA
LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK
QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR
LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ
NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY
NRQESRLLSATSPPRGRLMSILGY
Sequence Info Allergen Name Length Opt Bits Score E Value
ADN39441 Pru du 6.0201 504 3415 377.5 9.6e-106
A0A1L6K371 Jug n 4.0101 510 1799 205.8 4.6e-54
Q2TPW5 Jug r 4.0101 507 1437 167.4 1.7e-42
ABW86978 Car i 4.0101 505 1401 163.5 2.4e-41
ADN39440 Pru du 6.0101 551 1401 163.6 2.6e-41
3EHK_A Pru du 6 531 1385 161.9 8.2e-41
AAL73404 Cor a 9 515 1376 160.9 1.6e-40
P09800 Gos h 4 516 1170 139.0 6e-34
P09802 Gos h 3 509 1121 133.8 2.2e-32
P04405 Gly m 6.0201 485 1039 125.1 8.9e-30
CAA68460 Gly m glycinin G2 485 1039 125.1 8.9e-30
Q2TLW0 Sin a 2.0101 510 982 119.0 6.1e-28
P11828 Gly m 6.0301 481 940 114.5 1.3e-26
AAA33966 Gly m glycinin G1 495 750 94.4 1.6e-20
P04776 Gly m 6.0101 495 750 94.4 1.6e-20
DQ631676 Pis v 2.0101 496 742 93.5 2.8e-20
AAO38859 Ber e 2 465 723 91.5 1.1e-19
DQ631677 Pis v 2.0201 472 721 91.3 1.3e-19
EU410073 Pis v 5.0101 473 718 91.0 1.6e-19
AAN76862 Ana o 2 457 717 90.8 1.7e-19
Q9AUD2 Ses i 7.0101 497 716 90.8 1.9e-19
P13744 Cuc ma 4.0101 480 711 90.2 2.7e-19
BAA21758 Fag e 1 565 711 90.3 3e-19
O82580 Ara h 3 507 708 89.9 3.5e-19
AAC63045 Ara h 3 510 708 89.9 3.5e-19
Q9XFM4 Fag e 1 538 694 88.5 1e-18
QYU76045 Zan b 2.0101 389 690 87.9 1.1e-18
QYU76046 Zan b 2.0102 388 682 87.0 2e-18
QYS16039 Zan b 2.03 389 681 86.9 2.2e-18
QYU76044 Zan b 2.02 383 679 86.7 2.5e-18
AAD47382 Ara h 4 530 681 87.1 2.6e-18
BAA21760 Fag e 1 504 622 80.8 2e-16
Q7GC77 Gly m 6.0501 517 616 80.2 3.1e-16
Q9SB11 Gly m 6.0401 563 608 79.4 6e-16
Q9XHP0 Ses i 6.0101 459 588 77.1 2.3e-15
A0A0S3B0K0 Coc n 1.0101 490 237 39.9 0.0004
CAA31395 Tri a glutenin 839 231 39.5 0.00088
P10388 Tri a 26.0101 839 231 39.5 0.00088
CAA43331 Tri a glutenin 830 221 38.4 0.0018
AAB02788 Tri a glutenin 815 211 37.4 0.0038
CAA31396 Tri a glutenin 648 201 36.2 0.0068
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Pru du 6.0201 Sequence ID: ADN39441

 Score = 377.5 bits 3415,  Expect = 1e-105
 Identities = 504/504 100%, Positives = 504/504 100%, Gaps = 0/504 0%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA
Sbjct  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF
Sbjct  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
            RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD
Sbjct  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
            LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA
Sbjct  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
Query  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
            LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK
Sbjct  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
Query  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
            QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR
Sbjct  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
Query  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
            LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ
Sbjct  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
Query  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
            NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY
Sbjct  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
Query  481  NRQESRLLSATSPPRGRLMSILGY 504
            NRQESRLLSATSPPRGRLMSILGY
Sbjct  481  NRQESRLLSATSPPRGRLMSILGY 504

Sequence Alignment: 2. Allergen Name: Jug n 4.0101 Sequence ID: A0A1L6K371

 Score = 205.8 bits 1799,  Expect = 5e-54
 Identities = 286/472 60%, Positives = 372/472 78%, Gaps = 42/472 8%
Query  1    CLLLLFNGCLAS---RQHI-FGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQL 56
            CL+ L NGCLA    RQ+  FG+ K   L +L A EP N I++EAGV ESW+P++ QFQ 
Sbjct  12   CLVALVNGCLAQSGGRQQPRFGECK---LKRLVALEPSNRIEAEAGVIESWDPNNQQFQC 68
Query  57   AGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQ 116
            AGVAVVRRTIEPNGL LP Y NAPQL+YIV+GRG+ G +FPGC ETFE+SQ       Q 
Sbjct  69   AGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQ-------QG 121
Query  117  QQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAV 176
            Q + RPS +        FQ    +DRHQKIRH REGD+IA+PAGVA+W YN+G+ P+VAV
Sbjct  122  QSRIRPSLR-----SASFQ----RDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAV 172
Query  177  SLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQ-----QQGRQQQQQQQ-----GQQ--GN 224
            +L+D  N+ NQLDQ PR FYLAGNP DEF PQ     +Q R+QQQ+QQ     GQQ  G+
Sbjct  173  ALMDTTNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGS 232
Query  225  GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGRGD 283
            GNN+FSGFD  +LA A+NV+ ETAR LQ ++D+R  IVRV+G QL  + P       R +
Sbjct  233  GNNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRP----RWSREE 288
Query  284  QERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGG 343
            QER+ E ++ +RERE +   ++ + GG  DNG+EET C+ RL +NIGDPSRAD Y  + G
Sbjct  289  QERE-ERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAG 347
Query  344  RISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGD 403
            RIS  N + LP+LR+L+LSAE+G LY++A+Y PHW+ NA+++VYA+RG A VQVV+  G 
Sbjct  348  RISTANSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQ 407
Query  404  PILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEV 463
             ++DDE+REGQL+ IPQN AV+ +A NEGFE++SF+T+EN   + LAGRTS +RALP+EV
Sbjct  408  TVFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEV 467
Query  464  LQNAFRISRQEARNLKYNRQESRLLSATSPPRGR 497
            L NA++I R++AR LK+NRQES L+  + P   R
Sbjct  468  LANALQIPREDARRLKFNRQESTLVR-SRPSSSR 500

Sequence Alignment: 3. Allergen Name: Jug r 4.0101 Sequence ID: Q2TPW5

 Score = 167.4 bits 1437,  Expect = 2e-42
 Identities = 292/467 62%, Positives = 373/467 79%, Gaps = 46/467 9%
Query  2    LLLLFNGCLAS----RQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLA 57
            ++ LFNGCLA     +Q+ FGQ    QLN+L+A EP N I++EAGV ESW+P++ QFQ A
Sbjct  14   IVALFNGCLAQSGGRQQQQFGQC---QLNRLDALEPTNRIEAEAGVIESWDPNNQQFQCA 70
Query  58   GVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQ 117
            GVAVVRRTIEPNGL LP Y NAPQL+YI RGRG+ G +FPGC ETFE+SQ Q   QQ Q 
Sbjct  71   GVAVVRRTIEPNGLLLPQYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQS--QQGQS 128
Query  118  QQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVS 177
            ++F                  QQDRHQKIRH REGDIIA+PAGVA+WSYN+G  P+VA+S
Sbjct  129  REF------------------QQDRHQKIRHFREGDIIAFPAGVAHWSYNDGSNPVVAIS 170
Query  178  LLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQ-----QQGRQQQQQQQ-----GQQ--GNG 225
            LLD NN+ NQLDQ PR FYLAGNP DEF PQ     +Q R+QQQ+QQ     GQQ  G G
Sbjct  171  LLDTNNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQRQQRPGEHGQQQRGLG 230
Query  226  NNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGRGDQ 284
            NN+FSGFD  +LA A+NV+ ETAR LQ ++D+R  IVRV+G QL  + P       R +Q
Sbjct  231  NNVFSGFDADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRP----RWSREEQ 286
Query  285  ERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGR 344
            ER+ E ++ +RERE +   ++ + GG  DNG+EET C+ RL +NIGDPSRAD Y  + GR
Sbjct  287  ERE-ERKERERERESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGR 345
Query  345  ISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDP 404
            IS VN + LP+LR+L+LSAE+G LY++A+Y PHW+ NA+++VYA+RG A VQVV+  G  
Sbjct  346  ISTVNSHTLPVLRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQT 405
Query  405  ILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVL 464
            ++DDE+REGQL+ IPQN AV+ +A NEGFE++SF+T+EN   + LAGRTS +RALP+EVL
Sbjct  406  VFDDELREGQLLTIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVL 465
Query  465  QNAFRISRQEARNLKYNRQESRLLSATSPPRGR 497
              AF+I R++AR LK+NRQES L+  + P R R
Sbjct  466  ATAFQIPREDARRLKFNRQESTLVR-SRPSRSR 497

Sequence Alignment: 4. Allergen Name: Car i 4.0101 Sequence ID: ABW86978

 Score = 163.5 bits 1401,  Expect = 2e-41
 Identities = 287/462 62%, Positives = 372/462 80%, Gaps = 51/462 11%
Query  1    CLLL--LFNGCLAS----RQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQF 54
            CL++  LFNGCLA     +QH FGQ    QLN+L+A EP N I++EAGV ESW+P+  Q+
Sbjct  12   CLIIVALFNGCLAQSGGRQQHKFGQC---QLNRLDALEPTNRIEAEAGVIESWDPNHQQL 68
Query  55   QLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQ 114
            Q AGVAVVRRTIEPNGL LP Y NAPQL+YI RGRG+ G +FPGC ETFE+SQ Q   QQ
Sbjct  69   QCAGVAVVRRTIEPNGLLLPHYSNAPQLVYIARGRGITGVLFPGCPETFEESQRQS--QQ 126
Query  115  QQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLV 174
             Q+++F                  QQDRHQKIRH REGDIIA+PAGVA+W YN+G  P+V
Sbjct  127  GQRREF------------------QQDRHQKIRHFREGDIIAFPAGVAHWCYNDGSSPVV 168
Query  175  AVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQ-----QQGRQQQQQQQ--GQQGN--- 224
            A+ LLD +N+ NQLDQ PR FYLAGNP DEF PQ     +Q R+QQQ+QQ  G++G    
Sbjct  169  AIFLLDTHNNANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRRGEHGEQQR 228
Query  225  --GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGR 281
              GNN+FSGFD ++LA A+NV+ ETAR LQ ++D+R  IVRV+G QL  + P       R
Sbjct  229  DLGNNVFSGFDAEFLADAFNVDTETARRLQSENDHRGSIVRVEGRQLQVIRP-------R 281
Query  282  GDQERQQEEQQSQREREEKQREQEQQG--GGGQDNGVEETFCSARLSQNIGDPSRADFYN 339
              +E Q+ E++ +RERE +   + +Q   GG  DNG+EET C+  L +NIGDPSRAD Y 
Sbjct  282  WSREEQEHEERKERERERESESERRQSRRGGRDDNGLEETICTLSLRENIGDPSRADIYT 341
Query  340  PQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVN 399
             + GRIS VN ++LPILR+L+LSAE+G LY++A+Y PHW+ NA+++VYA+RG A VQVV+
Sbjct  342  EEAGRISTVNSHNLPILRWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVD 401
Query  400  ENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRAL 459
              G  ++DDE+REGQL+ IPQN AV+ +A +EGFE++SF+T+EN   + LAGRTS +RAL
Sbjct  402  NFGQTVFDDELREGQLLTIPQNFAVVKRARDEGFEWVSFKTNENAMVSPLAGRTSAIRAL 461
Query  460  PDEVLQNAFRISRQEARNLKYNRQESRLLSATS 492
            P+EVL NAF+I R++AR LK+NRQES L+ + S
Sbjct  462  PEEVLVNAFQIPREDARRLKFNRQESTLVRSRS 494

Sequence Alignment: 5. Allergen Name: Pru du 6.0101 Sequence ID: ADN39440

 Score = 163.6 bits 1401,  Expect = 3e-41
 Identities = 331/485 68%, Positives = 409/485 84%, Gaps = 64/485 13%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            CLLL+FNGCLA+RQ  +    + QLNQL+AREPDN IQ+EAG  E+WN +   FQ AGVA
Sbjct  10   CLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQEDFQCAGVA 69
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQP-----------Q 109
              R TI+ NGLHLPSY NAPQLIYIV+GRGVLGAVF GC ETFE+SQ            Q
Sbjct  70   ASRITIQRNGLHLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQ 129
Query  110  QFQQQQQ-----------QQQFRPSRQEGGQ----GQQQFQGEDQQ------------DR 142
            + QQQQQ           QQQ R  RQ+G Q    G+QQ Q + QQ            DR
Sbjct  130  ERQQQQQGEQGRQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQFDR 189
Query  143  HQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQ 202
            HQK R IREGD++A+PAGVAYWSYN+G+Q LVAV+L+ +++D+NQLDQ PR+FYLAGNP+
Sbjct  190  HQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPE 249
Query  203  DEFN------PQQQGRQ----QQQQ------QQGQQGNGNNIFSGFDTQLLAQALNVNPE 246
            +EFN      P+QQG Q    Q+QQ      QQ QQG+GNN+FSGF+TQLLAQALNVN E
Sbjct  250  NEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGSGNNVFSGFNTQLLAQALNVNEE 309
Query  247  TARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQ 306
            TARNLQGQ+DNRN+I+RV+G LDFV P       RG QER++EE    R++E+ Q+E++Q
Sbjct  310  TARNLQGQNDNRNQIIRVRGNLDFVQP------PRGRQEREHEE----RQQEQLQQERQQ 359
Query  307  QGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKG 366
            QGG    NG+EETFCS RL +NIG+P RAD ++P+ GRIS +N ++LPILR+LRLSAE+G
Sbjct  360  QGGQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERG 419
Query  367  VLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVIT 426
             +Y N IY+PHW+ NA+++VY IRGNARVQVVNENGD ILD EV++GQLF++PQNH VI 
Sbjct  420  FFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQ 479
Query  427  QASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESR 486
            QA N+GFEY +F+T+EN F NTLAGRTS LRALPDEVL NA++ISR++AR LKYNRQE+ 
Sbjct  480  QAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETI 539
Query  487  LLSATSPPR 495
             LS++   R
Sbjct  540  ALSSSQQRR 548

Sequence Alignment: 6. Allergen Name: Pru du 6 Sequence ID: 3EHK_A

 Score = 161.9 bits 1385,  Expect = 8e-41
 Identities = 320/474 67%, Positives = 397/474 83%, Gaps = 64/474 13%
Query  12   SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGL 71
            +RQ  +    + QLNQL+AREPDN IQ+EAG  E+WN +   FQ AGVA  R TI+ NGL
Sbjct  1    ARQSQLSPQNQCQLNQLQAREPDNRIQAEAGQIETWNFNQGDFQCAGVAASRITIQRNGL 60
Query  72   HLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQP-----------QQFQQQQQ---- 116
            HLPSY NAPQLIYIV+GRGVLGAVF GC ETFE+SQ            Q+ QQQQQ    
Sbjct  61   HLPSYSNAPQLIYIVQGRGVLGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQG 120
Query  117  -------QQQFRPSRQEGGQ----GQQQFQGEDQQ------------DRHQKIRHIREGD 153
                   QQQ R  RQ+G Q    G+QQ Q + QQ            DRHQK R IREGD
Sbjct  121  RQQGQQEQQQERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD 180
Query  154  IIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFN------P 207
            ++A+PAGVAYWSYN+G+Q LVAV+L+ +++D+NQLDQ PR+FYLAGNP++EFN      P
Sbjct  181  VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPENEFNQQGQSQP 240
Query  208  QQQGRQ----QQQQ------QQGQQGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDN 257
            +QQG Q    Q+QQ      QQ QQGNGNN+FSGF+TQLLAQALNVN ETARNLQGQ+DN
Sbjct  241  RQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQALNVNEETARNLQGQNDN 300
Query  258  RNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVE 317
            RN+I++V+G LDFV P       RG QER++EE    R++E+ Q+E++QQG     NG+E
Sbjct  301  RNQIIQVRGNLDFVQP------PRGRQEREHEE----RQQEQLQQERQQQGEQLMANGLE 350
Query  318  ETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPH 377
            ETFCS RL +NIG+P RAD ++P+ GRIS +N ++LPILR+LRLSAE+G +Y N IY+PH
Sbjct  351  ETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPH 410
Query  378  WHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYIS 437
            W+ NA+++VY IRGNARVQVVNENGD ILD EV++GQLF++PQNH VI QA N+GFEY +
Sbjct  411  WNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFA 470
Query  438  FRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPR 495
            F+T+EN F NTLAGRTS LRALPDEVL NA++ISR++AR LKYNRQE+  LS++   R
Sbjct  471  FKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRR 528

Sequence Alignment: 7. Allergen Name: Cor a 9 Sequence ID: AAL73404

 Score = 160.9 bits 1376,  Expect = 2e-40
 Identities = 291/471 61%, Positives = 368/471 78%, Gaps = 49/471 10%
Query  1    CLLLLFNGCLA-------SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQ 53
            CLL+LFNGCL         +Q  FG   E  L++L A EP N I++EA   ESW+ +D Q
Sbjct  12   CLLVLFNGCLGINVGLRRQQQRYFG---ECNLDRLNALEPTNRIEAEACQIESWDHNDQQ 68
Query  54   FQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQ 113
            FQ AGVAV+RRTIEPNGL LP Y NAP+LIYI RGRG+ G +FPGC ETFED  PQQ Q 
Sbjct  69   FQCAGVAVIRRTIEPNGLLLPQYSNAPELIYIERGRGITGVLFPGCPETFED--PQQ-QS 125
Query  114  QQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPL 173
            QQ Q+Q        GQGQ Q     +QDRHQKIRH REGDIIALPAGVA+W YN+G+ P+
Sbjct  126  QQGQRQ--------GQGQSQ---RSEQDRHQKIRHFREGDIIALPAGVAHWCYNDGDSPV 174
Query  174  VAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQ------QQQ----QQG--- 220
            V VSLL  NN  NQLD+ PR FYLAGNP DE   Q+QG+QQ      QQQ    +QG   
Sbjct  175  VTVSLLHTNNYANQLDENPRHFYLAGNPDDEH--QRQGQQQFGQRRRQQQHSHGEQGEQE 232
Query  221  QQGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGG 280
            QQG GNN+FSGFD ++LA A+NV+ +TAR LQ   D R  IV+V+G+L  V P       
Sbjct  233  QQGEGNNVFSGFDAEFLADAFNVDVDTARRLQSNQDKRRNIVKVEGRLQVVRP------E 286
Query  281  RGDQERQQEEQQSQREREEKQREQEQQGGGGQD-NGVEETFCSARLSQNIGDPSRADFYN 339
            R  QE +++E+Q +RE E+++  Q +QGG G+D NG EET CS RL +NI   SRAD Y 
Sbjct  287  RSRQEWERQERQ-ERESEQERERQRRQGGRGRDVNGFEETICSLRLRENICTRSRADIYT 345
Query  340  PQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVN 399
             Q GRI+ VN N LP+LR+L+LSAE+G L    +Y PHW+ NA+++VYAIRG ARVQVV+
Sbjct  346  EQVGRINTVNSNTLPVLRWLQLSAERGDLQREGLYVPHWNLNAHSVVYAIRGRARVQVVD 405
Query  400  ENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRAL 459
            +NG+ ++DDE+R+GQ++ IPQN AV  +A +EGFE+++F+T++N   + LAGRTS +RAL
Sbjct  406  DNGNTVFDDELRQGQVLTIPQNFAVAKRAESEGFEWVAFKTNDNAQISPLAGRTSAIRAL 465
Query  460  PDEVLQNAFRISRQEARNLKYNRQESRLL--SATSPPRGR 497
            PD+VL NAF+ISR+EAR LKYNRQE+ L+  S +S  R R
Sbjct  466  PDDVLANAFQISREEARRLKYNRQETTLVRSSRSSSERKR 505

Sequence Alignment: 8. Allergen Name: Gos h 4 Sequence ID: P09800

 Score = 139.0 bits 1170,  Expect = 6e-34
 Identities = 237/469 50%, Positives = 336/469 71%, Gaps = 60/469 12%
Query  1    CLLLLFNGCLASRQHIFG--QNKEW--------------QLNQLEAREPDNHIQSEAGVT 44
            CLL+LF+GC A    +    Q+  W              QL  L A +P +  +SEAG T
Sbjct  12   CLLVLFHGCCAQIDLVTNHHQDPPWGQPQQPQPRHQSQCQLQNLNALQPKHRFRSEAGET 71
Query  45   ESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFE 104
            E W+ ++ QFQ AGVA +R  I+  GL LPS+ +AP L Y+ +G G+ GAVFPGC ET++
Sbjct  72   EFWDQNEDQFQCAGVAFLRHKIQRKGLLLPSFTSAPMLFYVEQGEGIHGAVFPGCPETYQ 131
Query  105  DSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYW 164
                    Q QQ  Q RP                Q+D+HQK+R ++EGD++ALPAGVA+W
Sbjct  132  S-------QSQQNIQDRP----------------QRDQHQKLRRLKEGDVVALPAGVAHW 168
Query  165  SYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEF--------NPQQQGRQQQ- 215
             +NNG   LV V+L+D+ ND NQLD+  R+F+LAG+PQ             Q+Q R Q+ 
Sbjct  169  IFNNGRSQLVLVALVDVGNDANQLDENFRKFFLAGSPQGGVVRGGQSRDRNQRQSRTQRG 228
Query  216  --QQQQGQQGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSP 273
              ++++ Q+  GNN++SGF   LLAQA+ ++   AR LQ + DNR  IVR++  +++   
Sbjct  229  EREEEESQESGGNNVLSGFRDNLLAQAFGIDTRLARKLQNERDNRGAIVRMEHGFEWPEE 288
Query  274  FSRSAGGR--GDQERQ---QEEQQSQRE-REEKQREQEQQGGGGQDNGVEETFCSARLSQ 327
              R  G    G++ER+   Q  Q+SQ E  EE++RE+  +G     NG+EETFCS RL +
Sbjct  289  GQRRQGREEEGEEEREPKWQRRQESQEEGSEEEEREERGRGRRRSGNGLEETFCSMRLKH 348
Query  328  NIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVY 387
                 S AD +NP+GGRI+ VN  +LPIL+YL+LSAE+GVLYNNAIY PHW+ NA+++VY
Sbjct  349  RT-PASSADVFNPRGGRITTVNSFNLPILQYLQLSAERGVLYNNAIYAPHWNMNAHSIVY 407
Query  388  AIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTN 447
              RGN R+Q+V+ENG+ I+D++V  GQ+  +PQNHAV+ +A   GFE+I+F+T+ N   +
Sbjct  408  ITRGNGRIQIVSENGEAIFDEQVERGQVITVPQNHAVVKKAGRRGFEWIAFKTNANAKIS 467
Query  448  TLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRG 496
             +AGR S++R LP +VL N+F ISR+EA  LK+NRQE   +S  SP +G
Sbjct  468  QIAGRVSIMRGLPVDVLANSFGISREEAMRLKHNRQE---VSVFSPRQG 513

Sequence Alignment: 9. Allergen Name: Gos h 3 Sequence ID: P09802

 Score = 133.8 bits 1121,  Expect = 2e-32
 Identities = 242/457 52%, Positives = 339/457 74%, Gaps = 74/457 16%
Query  2    LLLLFNGCLASRQHIFGQNK--EWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGV 59
            LL+LFNGCLA RQ    Q    E Q+N+L A  P   I+SEAG TE WNP+  Q++ AGV
Sbjct  12   LLFLFNGCLA-RQTFSSQQSQNECQINRLRASAPQTRIRSEAGTTEWWNPNCQQLRCAGV 70
Query  60   AVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQ 119
            +V+R+TIEPNGL LPS+ NAPQL+YIV+GRG+ G V PGCAETF+DSQ     Q Q+Q +
Sbjct  71   SVMRQTIEPNGLVLPSFTNAPQLLYIVQGRGIQGIVMPGCAETFQDSQ-----QWQHQSR 125
Query  120  FRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLL 179
             R            FQ     D+HQK+R  R+GDIIALP GV +WSYN+G + +V ++LL
Sbjct  126  GR------------FQ-----DQHQKVRRFRQGDIIALPQGVVHWSYNDGNERVVTINLL 168
Query  180  DLNNDQNQLDQVPRRFYLAGNPQDEF---------------------------------- 205
            D  N  NQLD +PRRF+LAGNP++E                                   
Sbjct  169  DTGNSANQLDNIPRRFHLAGNPEEEQRQLRRLAQQMQGRSERGEESEEEEGEGEEEEEED 228
Query  206  NPQQQGRQQQQQQQGQQGNG-NNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRV 264
            NP ++ R+Q++++QG++ +  NN++  FD  +LAQA+NV+ +  R +Q    NR  I+RV
Sbjct  229  NPSRRSRHQEEEEQGRESSSCNNLLCAFDRNFLAQAFNVDHDIIRKIQRVRGNRGTIIRV 288
Query  265  QGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSAR 324
            + +L  V+P       R ++E ++E QQ QR R  +        GG QDNG+EETFCS R
Sbjct  289  RDRLQVVTP------PRMEEEEREERQQEQRYRHTR--------GGSQDNGLEETFCSMR 334
Query  325  LSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANA 384
            + +N+ DP RAD +NPQ GRIS +NR +LPIL+ L LSAE+GVLYN A   P+W+ NA+ 
Sbjct  335  IKENLADPERADIFNPQAGRISTLNRFNLPILQRLELSAERGVLYNRAGLIPQWNVNAHK 394
Query  385  LVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENG 444
            ++Y +RG ARVQVVN NGD ++DD V +GQL+ +PQN A + QA NEG E+ISF T+   
Sbjct  395  ILYMLRGCARVQVVNHNGDAVFDDNVEQGQLLTVPQNFAFMKQAGNEGAEWISFFTNSEA 454
Query  445  FTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPR 495
                +AG  S +RALP+EV+  ++++SR++AR +K+N + + +++ +   R
Sbjct  455  TNTPMAGSVSFMRALPEEVVAASYQVSREDARRIKFNNKNTFFFTPSQSER 505

Sequence Alignment: 10. Allergen Name: Gly m 6.0201 Sequence ID: P04405

 Score = 125.1 bits 1039,  Expect = 9e-30
 Identities = 217/462 46%, Positives = 317/462 68%, Gaps = 40/462 8%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            C+LL F+GC+A R++   Q  E Q+ +L A +PDN I+SE G  E+WNP++  FQ AGVA
Sbjct  9    CFLL-FSGCFALREQ--AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVA 65
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            + R T+  N L  PSY N PQ IYI +G G++G +FPGC  T++  +PQ+ QQ+ + Q  
Sbjct  66   LSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQ--EPQESQQRGRSQ-- 121
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
            RP                 QDRHQK+   REGD+IA+P GVA+W YNN + P+VAVS++D
Sbjct  122  RP-----------------QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIID 164
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEF---NPQQQGRQQQQQ--QQGQQGNGNNIFSGFDTQ 235
             N+ +NQLDQ+PRRFYLAGN + EF     QQQG  Q Q+  QQ ++  G+NI+SGF  +
Sbjct  165  TNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPE 224
Query  236  LLAQALNVNPETARNLQGQDDNRNE--IVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQS 293
            +L +A+ VN +  RNLQG+++  +   IV V+G L   +P  R      D + ++E+ Q 
Sbjct  225  FLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQC 284
Query  294  QREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHL 353
                +  QR+ ++       NG++ET C+ RL QNIG  S  D YNPQ G I+      +
Sbjct  285  VETDKGCQRQSKRS-----RNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDF 339
Query  354  PILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREG 413
            P L  L+LSA+ G L  NA++ PH+  NAN+++YA+ G A VQVVN NG+ ++D E++EG
Sbjct  340  PALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEG 399
Query  414  QLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQ 473
             ++++PQN AV  ++ ++ FEY+SF+T++      LAG  S+L ALP+EV+Q+ F +  Q
Sbjct  400  GVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQ 459
Query  474  EARNLKYNRQESRLLSATSPPR 495
            +AR +K N   S L+    PP+
Sbjct  460  QARQVKNNNPFSFLV----PPQ 477

Sequence Alignment: 11. Allergen Name: Gly m glycinin G2 Sequence ID: CAA68460

 Score = 125.1 bits 1039,  Expect = 9e-30
 Identities = 217/462 46%, Positives = 317/462 68%, Gaps = 40/462 8%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            C+LL F+GC+A R++   Q  E Q+ +L A +PDN I+SE G  E+WNP++  FQ AGVA
Sbjct  9    CFLL-FSGCFALREQ--AQQNECQIQKLNALKPDNRIESEGGFIETWNPNNKPFQCAGVA 65
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            + R T+  N L  PSY N PQ IYI +G G++G +FPGC  T++  +PQ+ QQ+ + Q  
Sbjct  66   LSRCTLNRNALRRPSYTNGPQEIYIQQGNGIFGMIFPGCPSTYQ--EPQESQQRGRSQ-- 121
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
            RP                 QDRHQK+   REGD+IA+P GVA+W YNN + P+VAVS++D
Sbjct  122  RP-----------------QDRHQKVHRFREGDLIAVPTGVAWWMYNNEDTPVVAVSIID 164
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEF---NPQQQGRQQQQQ--QQGQQGNGNNIFSGFDTQ 235
             N+ +NQLDQ+PRRFYLAGN + EF     QQQG  Q Q+  QQ ++  G+NI+SGF  +
Sbjct  165  TNSLENQLDQMPRRFYLAGNQEQEFLKYQQQQQGGSQSQKGKQQEEENEGSNILSGFAPE 224
Query  236  LLAQALNVNPETARNLQGQDDNRNE--IVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQS 293
            +L +A+ VN +  RNLQG+++  +   IV V+G L   +P  R      D + ++E+ Q 
Sbjct  225  FLKEAFGVNMQIVRNLQGENEEEDSGAIVTVKGGLRVTAPAMRKPQQEEDDDDEEEQPQC 284
Query  294  QREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHL 353
                +  QR+ ++       NG++ET C+ RL QNIG  S  D YNPQ G I+      +
Sbjct  285  VETDKGCQRQSKRS-----RNGIDETICTMRLRQNIGQNSSPDIYNPQAGSITTATSLDF 339
Query  354  PILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREG 413
            P L  L+LSA+ G L  NA++ PH+  NAN+++YA+ G A VQVVN NG+ ++D E++EG
Sbjct  340  PALWLLKLSAQYGSLRKNAMFVPHYTLNANSIIYALNGRALVQVVNCNGERVFDGELQEG 399
Query  414  QLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQ 473
             ++++PQN AV  ++ ++ FEY+SF+T++      LAG  S+L ALP+EV+Q+ F +  Q
Sbjct  400  GVLIVPQNFAVAAKSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQHTFNLKSQ 459
Query  474  EARNLKYNRQESRLLSATSPPR 495
            +AR +K N   S L+    PP+
Sbjct  460  QARQVKNNNPFSFLV----PPQ 477

Sequence Alignment: 12. Allergen Name: Sin a 2.0101 Sequence ID: Q2TLW0

 Score = 119.0 bits 982,  Expect = 6e-28
 Identities = 238/467 50%, Positives = 320/467 68%, Gaps = 55/467 11%
Query  2    LLLLFNGCLASRQH--IFGQNKEW-QLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAG 58
            +LL++NGCLA RQ   +  Q K+   L+ L+  +P   I+SEAG  E W+ + PQ + AG
Sbjct  14   VLLVLNGCLA-RQSLGVPPQVKDACNLDNLDVLQPTEVIKSEAGQVEYWDHNHPQIRCAG 72
Query  59   VAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQ 118
            V++ R  I+  GL+LP++ ++P + Y+V+G G+ G V PGCAETF DSQP Q QQ QQQ 
Sbjct  73   VSIARLVIQKGGLYLPTFFSSPFISYVVQGMGISGRVIPGCAETFMDSQPMQGQQGQQQG 132
Query  119  QFRPSRQEGGQGQQQFQGEDQQ---------------------DRHQKIRHIREGDIIAL 157
            Q     Q+G QGQQ  QG+  Q                     D HQK+ H+R GD IA+
Sbjct  133  QQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQQGQGFRDMHQKVEHVRHGDAIAM 192
Query  158  PAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQ 217
              G A W YN G+QPL+ VSL+D+ N QNQLD+ PR F LAGN        QQG  QQQQ
Sbjct  193  TPGSAQWIYNTGDQPLIIVSLIDIANYQNQLDRNPRTFRLAGN-------NQQGSSQQQQ 245
Query  218  QQGQQGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRS 277
            QQ Q     NI+SGFD Q+LAQAL ++   A+ LQ Q D R  IVRV+G +  V P  R 
Sbjct  246  QQQQ-----NILSGFDPQVLAQALKIDVRLAQELQNQQDKRGNIVRVKGPFQVVRPPLRQ 300
Query  278  AGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADF 337
            A          E +Q +  R   Q  Q        DNG+EET CS R  +NI DP+RAD 
Sbjct  301  A---------YESEQWRHPRGPPQSPQ--------DNGLEETICSMRTHENIDDPARADI 343
Query  338  YNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQV 397
            Y P  GR++ VN   LPIL+Y+RLSA +G+L  +A+  P ++ NAN ++Y  +G AR+QV
Sbjct  344  YKPNLGRVTSVNSYTLPILQYIRLSATRGILQGSAMVLPKYNMNANEILYCTQGQARIQV 403
Query  398  VNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLR 457
            VN+NG  +LD +V++GQL +IPQ  A + Q+ N  FE+ISF+T+ N   +TLAGRTS LR
Sbjct  404  VNDNGQNVLDQQVQKGQLVVIPQGFAYVVQSQNN-FEWISFKTNANAMISTLAGRTSALR 462
Query  458  ALPDEVLQNAFRISRQEARNLKYNRQESRLLSATSPPRGRLM 499
            ALP EV+ NA++IS +EAR +K+N  E+ L  A    + +L+
Sbjct  463  ALPLEVITNAYQISLEEARKIKFNTLETTLTRARGGQQPQLI 504

Sequence Alignment: 13. Allergen Name: Gly m 6.0301 Sequence ID: P11828

 Score = 114.5 bits 940,  Expect = 1e-26
 Identities = 222/454 48%, Positives = 314/454 69%, Gaps = 52/454 11%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            C+LL+   C+A       Q  E Q+ +L A +PDN I+SE G  E+WNP++  FQ AGVA
Sbjct  9    CFLLFSGCCFAFSFREQPQQNECQIQRLNALKPDNRIESEGGFIETWNPNNKPFQCAGVA 68
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            + R T+  N L  PSY NAPQ IYI +G G++G +FPGC  TFE  +PQ     Q+ Q  
Sbjct  69   LSRCTLNRNALRRPSYTNAPQEIYIQQGSGIFGMIFPGCPSTFE--EPQ-----QKGQSS 121
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
            RP                 QDRHQKI H REGD+IA+P G AYW YNN + P+VAVSL+D
Sbjct  122  RP-----------------QDRHQKIYHFREGDLIAVPTGFAYWMYNNEDTPVVAVSLID 164
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEF---NPQ-QQGRQQQQQ---QQGQQGNGNNIFSGFD 233
             N+ QNQLDQ+PRRFYLAGN + EF    PQ QQG  Q Q+   QQ ++  G +I+SGF 
Sbjct  165  TNSFQNQLDQMPRRFYLAGNQEQEFLQYQPQKQQGGTQSQKGKRQQEEENEGGSILSGFA 224
Query  234  TQLLAQALNVNPETARNLQGQDDN--RNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQ 291
             ++L +A+ V+ +  R LQG+++   +  IV V+G L  +SP +             EEQ
Sbjct  225  PEFLEHAFVVDRQIVRKLQGENEEEEKGAIVTVKGGLSVISPPT-------------EEQ 271
Query  292  QSQREREEKQR--EQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVN 349
            Q + E EEK    E++++      NG++ET C+ RL +NIG  S  D +NPQ G I+   
Sbjct  272  QQRPEEEEKPDCDEKDKHCQSQSRNGIDETICTMRLRHNIGQTSSPDIFNPQAGSITTAT 331
Query  350  RNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDE 409
               +P L +L+LSA+ G L  NA++ PH++ NAN+++YA+ G A VQVVN NG+ ++D E
Sbjct  332  SLDFPALSWLKLSAQFGSLRKNAMFVPHYNLNANSIIYALNGRALVQVVNCNGERVFDGE 391
Query  410  VREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFR 469
            ++EGQ++++PQN AV  ++ ++ FEY+SF+T++      LAG  S+L ALP+EV+Q  F 
Sbjct  392  LQEGQVLIVPQNFAVAARSQSDNFEYVSFKTNDRPSIGNLAGANSLLNALPEEVIQQTFN 451
Query  470  ISRQEARNLKYNRQESRLLSATSPPR 495
            + RQ+AR +K N   S L+    PP+
Sbjct  452  LRRQQARQVKNNNPFSFLV----PPK 473

Sequence Alignment: 14. Allergen Name: Gly m glycinin G1 Sequence ID: AAA33966

 Score = 94.4 bits 750,  Expect = 2e-20
 Identities = 215/467 46%, Positives = 328/467 70%, Gaps = 40/467 8%
Query  1    CLLLLFNGC---LASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLA 57
            C+LL F+GC   ++SR++   Q  E Q+ +L A +PDN I+SE G+ E+WNP++  FQ A
Sbjct  9    CFLL-FSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCA 65
Query  58   GVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQ 117
            GVA+ R T+  N L  PSY N PQ IYI +G+G++G ++PGC  TFE  +PQQ   QQ+ 
Sbjct  66   GVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE--EPQQ--PQQRG 121
Query  118  QQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVS 177
            Q  RP                 QDRHQKI + REGD+IA+P GVA+W YNN + P+VAVS
Sbjct  122  QSSRP-----------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
Query  178  LLDLNNDQNQLDQVPRRFYLAGNPQDEF--NPQQQGRQQQQQ---QQGQQGNGNNIFSGF 232
            ++D N+ +NQLDQ+PRRFYLAGN + EF    Q+QG +Q Q+   QQ ++  G +I+SGF
Sbjct  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGF 224
Query  233  DTQLLAQALNVNPETARNLQGQDD--NRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEE 290
              ++L +A++V+ + A+NLQG+++  ++  IV V+G L  + P +     R  +E ++EE
Sbjct  225  TLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEE 284
Query  291  QQSQREREEKQREQEQQGGGGQD--NGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV 348
             +  + + + +  Q  +G   +   NG++ET C+ RL +NIG  S  D YNPQ G ++  
Sbjct  285  DEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTA 344
Query  349  NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDD 408
                +P L +LRLSAE G L  NA++ PH++ NAN+++YA+ G A +QVVN NG+ ++D 
Sbjct  345  TSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDG 404
Query  409  EVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF 468
            E++EG+++++PQN  V  ++ ++ FEY+SF+T++     TLAG  S+L ALP+EV+Q+ F
Sbjct  405  ELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTF 464
Query  469  RISRQEARNLKYNRQESRLLSATSPPR 495
             +  Q+AR +K N     L+    PP+
Sbjct  465  NLKSQQARQIKNNNPFKFLV----PPQ 487

Sequence Alignment: 15. Allergen Name: Gly m 6.0101 Sequence ID: P04776

 Score = 94.4 bits 750,  Expect = 2e-20
 Identities = 215/467 46%, Positives = 328/467 70%, Gaps = 40/467 8%
Query  1    CLLLLFNGC---LASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLA 57
            C+LL F+GC   ++SR++   Q  E Q+ +L A +PDN I+SE G+ E+WNP++  FQ A
Sbjct  9    CFLL-FSGCCFAFSSREQ--PQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCA 65
Query  58   GVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQ 117
            GVA+ R T+  N L  PSY N PQ IYI +G+G++G ++PGC  TFE  +PQQ   QQ+ 
Sbjct  66   GVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFE--EPQQ--PQQRG 121
Query  118  QQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVS 177
            Q  RP                 QDRHQKI + REGD+IA+P GVA+W YNN + P+VAVS
Sbjct  122  QSSRP-----------------QDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVS 164
Query  178  LLDLNNDQNQLDQVPRRFYLAGNPQDEF--NPQQQGRQQQQQ---QQGQQGNGNNIFSGF 232
            ++D N+ +NQLDQ+PRRFYLAGN + EF    Q+QG +Q Q+   QQ ++  G +I+SGF
Sbjct  165  IIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGF 224
Query  233  DTQLLAQALNVNPETARNLQGQDD--NRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEE 290
              ++L +A++V+ + A+NLQG+++  ++  IV V+G L  + P +     R  +E ++EE
Sbjct  225  TLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEE 284
Query  291  QQSQREREEKQREQEQQGGGGQD--NGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV 348
             +  + + + +  Q  +G   +   NG++ET C+ RL +NIG  S  D YNPQ G ++  
Sbjct  285  DEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTA 344
Query  349  NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDD 408
                +P L +LRLSAE G L  NA++ PH++ NAN+++YA+ G A +QVVN NG+ ++D 
Sbjct  345  TSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDG 404
Query  409  EVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF 468
            E++EG+++++PQN  V  ++ ++ FEY+SF+T++     TLAG  S+L ALP+EV+Q+ F
Sbjct  405  ELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTF 464
Query  469  RISRQEARNLKYNRQESRLLSATSPPR 495
             +  Q+AR +K N     L+    PP+
Sbjct  465  NLKSQQARQIKNNNPFKFLV----PPQ 487

Sequence Alignment: 16. Allergen Name: Pis v 2.0101 Sequence ID: DQ631676

 Score = 93.5 bits 742,  Expect = 3e-20
 Identities = 242/457 52%, Positives = 340/457 74%, Gaps = 55/457 12%
Query  2    LLLLFNGCLAS-RQHIFGQNKEWQ--------LNQLEAREPDNHIQSEAGVTESWNPSDP 52
            +LLLF+  +A   Q +  Q ++ Q        +  L A EP   I+SEAGVTE W+ ++ 
Sbjct  13   FLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEE 72
Query  53   QFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQ 112
            Q+Q A VAV R TI+  GL +PSY NAP+L+Y+V+G G+ GAVFPGC ETF         
Sbjct  73   QLQCANVAVFRHTIQSRGLLVPSYDNAPELVYVVQGSGIHGAVFPGCPETF--------- 123
Query  113  QQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQP 172
              Q++ Q R SR E  + QQ   GE    +HQK+R I+EGD+IALPAGVA+W YNNG+  
Sbjct  124  --QEESQSR-SRSE--RSQQS--GE----QHQKVRPIQEGDVIALPAGVAHWIYNNGQSK 172
Query  173  LVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQ---QGQQGN-GNNI 228
            LV V+L D+ N +NQLDQ  R+F L G+PQ E     Q R + Q Q   +GQQG   NNI
Sbjct  173  LVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQGSGQSRSRSQSQSSRRGQQGQQSNNI 232
Query  229  FSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQ 288
            +S FD ++LAQ++N++ + AR LQ +   R  IVRVQ  L+ +SP            RQ+
Sbjct  233  LSAFDEEILAQSFNIDTQLARRLQKEKRQRGIIVRVQEDLEVLSP-----------HRQE 281
Query  289  EEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV 348
            +EQ+ + ERE +QR           NG+EETFC+  L  NI DPSRAD YNP+GGR+S V
Sbjct  282  QEQEYEEERERRQR-----------NGLEETFCTMTLKYNINDPSRADVYNPRGGRVSSV 330
Query  349  NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDD 408
            N  +LPILR+L+LSA+KGVL+ +AI  PHW+ NA+++VY  RGN R+Q+V+ENG+ ++D+
Sbjct  331  NALNLPILRFLQLSAKKGVLHRDAILAPHWNVNAHSIVYITRGNGRIQIVSENGESVFDE 390
Query  409  EVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF 468
            E+REGQL ++PQN AV+ +AS++ FE++SF+T+    T+ LAGR SV+RALP +V++N+F
Sbjct  391  EIREGQLVVVPQNFAVVKRASSDKFEWVSFKTNGLSQTSQLAGRVSVFRALPLDVIKNSF 450
Query  469  RISRQEARNLKYNRQESRLLSATSPPRGRLMS 500
             ISR++AR LK +R E+ +++  S  + +  S
Sbjct  451  DISREDARRLKESRSETTIFAPGSSSQRKSQS 482

Sequence Alignment: 17. Allergen Name: Ber e 2 Sequence ID: AAO38859

 Score = 91.5 bits 723,  Expect = 1e-19
 Identities = 227/448 50%, Positives = 320/448 71%, Gaps = 52/448 11%
Query  2    LLLLFNGCLASRQHIFGQNK--EWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGV 59
            ++LLF+ CLA     + Q +  E ++ +L A+EP   +++EAGV+E W+ +D QF+ AGV
Sbjct  11   IFLLFHCCLAIE---YEQEELYECRIQRLTAQEPQYRLEAEAGVSEVWDYTDQQFRCAGV 67
Query  60   AVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQ 119
            A +R TI P GL LP Y NAP+L Y+ +GRG+LG + PGC ETF           Q   Q
Sbjct  68   AALRNTIRPQGLLLPVYTNAPKLYYVTQGRGILGVLMPGCPETF-----------QSMSQ 116
Query  120  FRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLL 179
            F+ SR+     Q++ +G   QD+HQK+ H+++GDIIA+PAGVA W YN+G++ LV V + 
Sbjct  117  FQGSRE-----QEEERGR-FQDQHQKVHHLKKGDIIAIPAGVALWCYNDGDEDLVTVLVQ 170
Query  180  DLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQ 239
               +D NQLDQ PR F+LAGN Q     Q+Q  ++   + GQQ   +N+F GF+ + LA 
Sbjct  171  HTASDLNQLDQNPRHFFLAGNIQ---RSQKQRGERYGLRGGQQILADNVFKGFNMEALAD 227
Query  240  ALN--VNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQRER 297
             L   ++ ETAR ++G+DD R  IVRV+  L  + P                     R R
Sbjct  228  VLGFGMDTETARKVRGEDDQRGHIVRVEQGLKVIRP--------------------PRIR 267
Query  298  EEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILR 357
            EE     EQQ GGG  NG+EET CSA + QNI +P+ ADFYNP+ GR++ VN   +PIL 
Sbjct  268  EE----LEQQEGGGY-NGLEETICSATFIQNIDNPAEADFYNPRAGRLTTVNSLKVPILT 322
Query  358  YLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFL 417
            +L+LSA KGVLY NA+  P W  NAN++VYA+RG ARVQ+V+  G+ ++DD +REGQ+ +
Sbjct  323  FLQLSAMKGVLYENAMMAPLWRLNANSVVYAVRGEARVQIVDHRGETVFDDNLREGQMVV 382
Query  418  IPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARN 477
            +PQN  V+ QA + GFE++ F T++N + +T AGRTS LR +P  VL NA+R+S++EAR 
Sbjct  383  VPQNFVVVKQAGSRGFEWVVFNTNDNALFSTAAGRTSPLRGIPVGVLANAYRLSQEEARR 442
Query  478  LKYNRQESRLLSATSPPRGR 497
            +K NR E+ L+   S  RGR
Sbjct  443  IKLNRDEAVLFQPGSRSRGR 462

Sequence Alignment: 18. Allergen Name: Pis v 2.0201 Sequence ID: DQ631677

 Score = 91.3 bits 721,  Expect = 1e-19
 Identities = 231/443 52%, Positives = 323/443 72%, Gaps = 58/443 13%
Query  2    LLLLFNGCLAS-RQHIFGQNKEWQ--------LNQLEAREPDNHIQSEAGVTESWNPSDP 52
            +LLLF+  +A   Q +  Q ++ Q        +  L A EP   I+SEAGVTE W+ ++ 
Sbjct  13   FLLLFHCSFAQIEQVVNSQQRQQQQRFQTQCQIQNLNALEPKRRIESEAGVTEFWDQNEE 72
Query  53   QFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQ 112
            Q+Q A VAV R TI+  GL +PSY NAP+L+Y+V+G G+ GAVFPGC ETF         
Sbjct  73   QLQCANVAVFRHTIQSRGLLVPSYNNAPELVYVVQGSGIHGAVFPGCPETF--------- 123
Query  113  QQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQP 172
            Q++ Q Q R       + QQ   GE    +HQK+RHIREGDIIALPAGVA+W YNNG+  
Sbjct  124  QEESQSQSRSQHSRSERSQQS--GE----QHQKVRHIREGDIIALPAGVAHWIYNNGQSK 177
Query  173  LVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQG-RQQQQQQQGQQGNGNNIFSG 231
            LV V+L D+ N +NQLDQ  R+F L G+PQ E     Q   Q +  ++GQQ N  NI+S 
Sbjct  178  LVLVALADVGNSENQLDQYLRKFVLGGSPQQEIQGGGQSWSQSRSSRKGQQSN--NILSA 235
Query  232  FDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQ 291
            FD ++LAQ++N++ +  + LQ ++  R  IVRV+  L  +SP           +RQ++E 
Sbjct  236  FDEEILAQSFNIDTQLVKKLQREEKQRGIIVRVKEDLQVLSP-----------QRQEKEY 284
Query  292  QSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRN 351
                                 DNG+EETFC+  L  NI DPSRAD YNP+GGR++ +N  
Sbjct  285  S--------------------DNGLEETFCTMTLKLNINDPSRADVYNPRGGRVTSINAL 324
Query  352  HLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVR 411
            +LPILR+L+LS EKGVLY NAI  PHW+ NA+++VY  RGN R+Q+V+ENG+ ++D+E+R
Sbjct  325  NLPILRFLQLSVEKGVLYQNAIMAPHWNMNAHSIVYITRGNGRMQIVSENGESVFDEEIR 384
Query  412  EGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRIS 471
            EGQL ++PQN AV+ +AS++GFE++SF+T+     + LAGR SV+R LP +V+QN+F IS
Sbjct  385  EGQLVVVPQNFAVVKRASSDGFEWVSFKTNGLAKISQLAGRISVMRGLPLDVIQNSFDIS 444
Query  472  RQEARNLKYNRQESRLLSATS 492
            R++A NLK +R E  +++  S
Sbjct  445  REDAWNLKESRSEMTIFAPGS 465

Sequence Alignment: 19. Allergen Name: Pis v 5.0101 Sequence ID: EU410073

 Score = 91.0 bits 718,  Expect = 2e-19
 Identities = 246/459 53%, Positives = 342/459 74%, Gaps = 38/459 8%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            CLL+LF+GCLASRQ+   QN E Q++QL+A EPDN ++ EAG+ E+W+P+  QF+ AGVA
Sbjct  12   CLLILFHGCLASRQQGQQQN-ECQIDQLDALEPDNRVEYEAGMVETWDPNHEQFRCAGVA 70
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            V R TI+PNGL LP Y NAP L+YIV G G+ G + PGC ET++   PQQ QQ+ Q  +F
Sbjct  71   VARHTIQPNGLRLPEYSNAPTLMYIVEGEGMTGTLIPGCPETYQ--APQQGQQHGQSSRF 128
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
                               QD+HQKI+  R+GDIIALPAGVA W YN G  P+V V+LLD
Sbjct  129  -------------------QDKHQKIQRFRKGDIIALPAGVANWCYNEGNSPVVTVTLLD 169
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
            ++N QNQLD  PR+F LAGNP+DEF  QQQ +Q + ++Q QQ + NNIF GFDT++LA+ 
Sbjct  170  VSNSQNQLDMYPRKFNLAGNPEDEFQQQQQ-QQSRGRRQSQQKSCNNIFCGFDTKILAEV 228
Query  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
            + V     + LQ + DNR  IV+V+G L  + P  R               QS+R  E +
Sbjct  229  FQVEQSLVKQLQNEKDNRGAIVKVKGDLQVIRPPRR---------------QSERGFESE 273
Query  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
            +  + ++G  G+DNG+EET C+ +L +NI DPSR+D Y P+ GRI+ +N  +LPIL++L+
Sbjct  274  EESEYERGRRGRDNGLEETICTMKLKENIHDPSRSDIYTPEVGRITSLNSLNLPILKWLQ 333
Query  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
            LSAE+GVL NNA+  PHW+ NA+++VY  +GNA+VQVV+  G+ ++D EV EGQ+F++PQ
Sbjct  334  LSAERGVLQNNALMVPHWNFNAHSIVYGCKGNAQVQVVDNFGNTVFDGEVSEGQIFVVPQ 393
Query  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
            N AV+ +A  + FE+ISF+T++    + LAG TSVLRA+P+EVL NAF+ISR++AR +K+
Sbjct  394  NFAVVKRARGQRFEWISFKTNDRAMISPLAGSTSVLRAMPEEVLANAFQISREDARKIKF 453
Query  481  NRQESRLLSATSPPRGR 497
            N ++  L S  S  + R
Sbjct  454  NNEQPTLSSGQSSQQMR 470

Sequence Alignment: 20. Allergen Name: Ana o 2 Sequence ID: AAN76862

 Score = 90.8 bits 717,  Expect = 2e-19
 Identities = 244/450 54%, Positives = 343/450 76%, Gaps = 48/450 10%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            C+L+LF+GCLASRQ  + Q  E Q+++L+A EPDN ++ EAG  E+W+P+  QF+ AGVA
Sbjct  4    CFLILFHGCLASRQE-WQQQDECQIDRLDALEPDNRVEYEAGTVEAWDPNHEQFRCAGVA 62
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            +VR TI+PNGL LP Y NAPQLIY+V+G G+ G  +PGC ET++   PQQ +QQ Q  +F
Sbjct  63   LVRHTIQPNGLLLPQYSNAPQLIYVVQGEGMTGISYPGCPETYQ--APQQGRQQGQSGRF 120
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
                               QDRHQKIR  R GDIIA+PAGVA+W YN G  P+V V+LLD
Sbjct  121  -------------------QDRHQKIRRFRRGDIIAIPAGVAHWCYNEGNSPVVTVTLLD 161
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
            ++N QNQLD+ PR+F+LAGNP+D F       QQQQQ+Q +   G N+FSGFDT+LLA+A
Sbjct  162  VSNSQNQLDRTPRKFHLAGNPKDVF-------QQQQQHQSR---GRNLFSGFDTELLAEA 211
Query  241  LNVNPETARNLQGQDDNRNEIVRVQG-QLDFVSPFSRSAGGRGDQERQQEEQQSQREREE 299
            + V+    + L+ +D NR  IV+V+  +L  + P SRS   RG +        S+ E E+
Sbjct  212  FQVDERLIKQLKSED-NRGGIVKVKDDELRVIRP-SRSQSERGSE--------SEEESED 261
Query  300  KQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYL 359
            ++R       G +DNG+EET C+ RL +NI DP+RAD Y P+ GR++ +N  +LPIL++L
Sbjct  262  EKRRW-----GQRDNGIEETICTMRLKENINDPARADIYTPEVGRLTTLNSLNLPILKWL 316
Query  360  RLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIP 419
            +LS EKGVLY NA+  PHW+ N+++++Y  +G  +VQVV+  G+ ++D EVREGQ++++P
Sbjct  317  QLSVEKGVLYKNALVLPHWNLNSHSIIYGCKGKGQVQVVDNFGNRVFDGEVREGQMLVVP 376
Query  420  QNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLK 479
            QN AV+ +A  E FE+ISF+T++   T+ LAGRTSVL  +P+EVL NAF+ISR++AR +K
Sbjct  377  QNFAVVKRAREERFEWISFKTNDRAMTSPLAGRTSVLGGMPEEVLANAFQISREDARKIK 436
Query  480  YNRQESRLLSATSPPRGR 497
            +N Q++ L S  S    R
Sbjct  437  FNNQQTTLTSGESSHHMR 454

Sequence Alignment: 21. Allergen Name: Ses i 7.0101 Sequence ID: Q9AUD2

 Score = 90.8 bits 716,  Expect = 2e-19
 Identities = 235/440 53%, Positives = 328/440 74%, Gaps = 58/440 13%
Query  11   ASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNG 70
            + +QH +    + ++ +L A+EP    +SEAG+TE W+ ++ QF+ AGVA VR  I+P G
Sbjct  37   SQQQHKLQARTDCRVERLTAQEPTIRFESEAGLTEFWDRNNQQFECAGVAAVRNVIQPRG 96
Query  71   LHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFE-DSQPQQFQQQQQQQQFRPSRQEGGQ 129
            L LP Y NAPQL+Y+VRGRG+ G V PGCAETFE D+QP    +Q ++++F         
Sbjct  97   LLLPHYNNAPQLLYVVRGRGIQGTVIPGCAETFERDTQP----RQDRRRRF--------- 143
Query  130  GQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLD 189
                       DRHQK+R+ R+GDI+ALPAG+  W YNNG +PL+ V+LLD  N  NQLD
Sbjct  144  ----------MDRHQKVRQFRQGDILALPAGLTLWFYNNGGEPLITVALLDTGNAANQLD 193
Query  190  QVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQALNVNPETAR 249
            Q  R F+LAGNPQ        GR Q ++QQG+     NIF+GFD ++LA A+ V+ +TAR
Sbjct  194  QTFRHFFLAGNPQGG-RQSYFGRPQTEKQQGET---KNIFNGFDDEILADAFGVDVQTAR 249
Query  250  NLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGG 309
             L+GQDD R  IVR + +LD V P        G             E EE++ E++   G
Sbjct  250  RLKGQDDLRGRIVRAE-RLDIVLP--------G-------------EEEEERWERDPYSG 287
Query  310  GGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLY 369
                NG+EET+C+A+L +N+ +P+RAD YNP+GGRIS +N   LP+L +LRLSAEKGVLY
Sbjct  288  A---NGLEETLCTAKLRENLDEPARADVYNPHGGRISSLNSLTLPVLSWLRLSAEKGVLY 344
Query  370  NNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQAS 429
             N +  PHW+ NA++++Y  RG+ R QVV   G  ++D  VREGQL ++PQN+ V  +AS
Sbjct  345  RNGLVAPHWNLNAHSIIYITRGSGRFQVVGHTGRSVFDGVVREGQLIIVPQNYVVAKRAS 404
Query  430  -NEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLL 488
             +EG+E+ISF+T++N  T+ LAGR S +RA+P+EV+  A+++SR EAR LKYNR+ESR++
Sbjct  405  QDEGLEWISFKTNDNAMTSQLAGRLSAIRAMPEEVVMTAYQVSRDEARRLKYNREESRVF 464
Query  489  SATS----PPRGRLMSIL 502
            S+TS    P   R MS +
Sbjct  465  SSTSRYSWPRSSRPMSYM 482

Sequence Alignment: 22. Allergen Name: Cuc ma 4.0101 Sequence ID: P13744

 Score = 90.2 bits 711,  Expect = 3e-19
 Identities = 212/445 47%, Positives = 307/445 68%, Gaps = 60/445 13%
Query  1    CLLLLFNGCLAS---------------RQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTE 45
            CL ++ NGCL+                +QH +   +  +L  L A++P    ++EA  TE
Sbjct  11   CLAVFINGCLSQIEQQSPWEFQGSEVWQQHRYQSPRACRLENLRAQDPVRRAEAEAIFTE 70
Query  46   SWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFED 105
             W+  + +FQ AGV ++R TI P GL LP + NAP+LI++ +G G+ G   PGCAET+  
Sbjct  71   VWDQDNDEFQCAGVNMIRHTIRPKGLLLPGFSNAPKLIFVAQGFGIRGIAIPGCAETY-- 128
Query  106  SQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWS 165
                       Q  +R S+  G      F+     D+HQKIR  REGD++ +PAGV++W 
Sbjct  129  -----------QTDLRRSQSAGSA----FK-----DQHQKIRPFREGDLLVVPAGVSHWM 168
Query  166  YNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNP-QDEFNPQQQGRQQQQQQQGQQGN 224
            YN G+  LV + + D  N  NQ+D   R+FYLAG P Q E   ++  R  ++   G++  
Sbjct  169  YNRGQSDLVLIVFADTRNVANQIDPYLRKFYLAGRPEQVERGVEEWERSSRKGSSGEKSG 228
Query  225  GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQ 284
              NIFSGF  ++L +A+ ++    R L+G+DD R+ IV+V   ++ + P           
Sbjct  229  --NIFSGFADEFLEEAFQIDGGLVRKLKGEDDERDRIVQVDEDFEVLLP----------- 275
Query  285  ERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGR 344
              + EE++S+    E + E E        NG+EET C+ RL QNIG   RAD +NP+GGR
Sbjct  276  -EKDEEERSRGRYIESESESE--------NGLEETICTLRLKQNIGRSVRADVFNPRGGR 326
Query  345  ISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDP 404
            IS  N + LPILR +RLSAE+GVLY+NA+  PH+  N+++++YA RGNARVQVV+  G  
Sbjct  327  ISTANYHTLPILRQVRLSAERGVLYSNAMVAPHYTVNSHSVMYATRGNARVQVVDNFGQS 386
Query  405  ILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVL 464
            ++D EVREGQ+++IPQN  VI +AS+ GFE+I+F+T++N  TN LAGR S +R LP  VL
Sbjct  387  VFDGEVREGQVLMIPQNFVVIKRASDRGFEWIAFKTNDNAITNLLAGRVSQMRMLPLGVL 446
Query  465  QNAFRISRQEARNLKYNRQESRLLS 489
             N +RISR+EA+ LKY +QE R+LS
Sbjct  447  SNMYRISREEAQRLKYGQQEMRVLS 471

Sequence Alignment: 23. Allergen Name: Fag e 1 Sequence ID: BAA21758

 Score = 90.3 bits 711,  Expect = 3e-19
 Identities = 203/454 44%, Positives = 308/454 67%, Gaps = 82/454 18%
Query  12   SRQHIFGQNKEWQ--LNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPN 69
            SR H   Q    Q  + +L A EP   ++SEAGVTE W+   P+F+ AG   VR  I+P 
Sbjct  31   SRPHRGHQQFHHQCDVQRLTASEPSRRVRSEAGVTEIWDNDTPEFRCAGFVAVRVVIQPG 90
Query  70   GLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQE--- 126
            GL LPSY NAP + ++ +GRGV G V PGC ETF+     ++ Q Q+ Q+ R S  E   
Sbjct  91   GLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSESEFEYPQSQRDQRSRQSESEESS 150
Query  127  -GGQGQQQFQGE-----DQQ---------------------------------------- 140
             G Q  +Q + E     DQ+                                        
Sbjct  151  RGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFSRGDQRTRQSESEEFS 210
Query  141  --DRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLA 198
              D+HQKI  IR+GD+I  PAGV  W++N+G+  L++++L D N+ QNQLD   R F+LA
Sbjct  211  RGDQHQKIFRIRDGDVIPSPAGVVQWTHNDGDNDLISITLYDANSFQNQLDGNVRNFFLA 270
Query  199  GNPQ---DEFNPQQQGRQQQQQQQGQQGNGN------NIFSGFDTQLLAQAL-NVNPETA 248
            G  +   ++   Q+Q R++   +Q ++ + +      NI++GF  ++L + + NV+ ET 
Sbjct  271  GQSKQSREDRRSQRQTREEGSDRQSRESDDDEALLEANILTGFQDEILQEIFRNVDQETI 330
Query  249  RNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQG 308
              L+G +D R  IV+ +  L +  P             ++ E++ QRER +++R     G
Sbjct  331  SKLRGDNDQRGFIVQAR-DLKLRVP-------------EEYEEELQRERGDRKR-----G 371
Query  309  GGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVL 368
            G G+ NG+E+ FC+ ++ QN+  PSRAD +NP+ GRI+ VN N+LPIL +++LSA+  VL
Sbjct  372  GSGRSNGLEQAFCNLKFKQNVNRPSRADVFNPRAGRINTVNSNNLPILEFIQLSAQHVVL 431
Query  369  YNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQA 428
            Y NAI  P W+ NA++ +Y  RG  RVQVV + G  ++DD V+ GQ++++PQ  AV+ +A
Sbjct  432  YKNAILGPRWNLNAHSALYVTRGEGRVQVVGDEGRSVFDDNVQRGQILVVPQGFAVVLKA 491
Query  429  SNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQE 484
              EG+E++ ++ D+N  T+ +AG+TSVLRA+P EVL N++ IS +EA  LK  RQE
Sbjct  492  GREGLEWVELKNDDNAITSPIAGKTSVLRAIPVEVLANSYDISTKEAFRLKNGRQE 547

Sequence Alignment: 24. Allergen Name: Ara h 3 Sequence ID: O82580

 Score = 89.9 bits 708,  Expect = 4e-19
 Identities = 201/444 45%, Positives = 303/444 68%, Gaps = 50/444 11%
Query  24   QLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLI 83
            Q+ +L A+ PDN I+SE G  E+WNP++ +F+ AGVA+ R  +  N L  P Y NAPQ I
Sbjct  10   QFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEI 69
Query  84   YIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRH 143
            +I +GRG +G +FPGC   +E+ + Q  + Q Q    RP R+  G+ Q Q     Q+D H
Sbjct  70   FIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQ----RPPRRLQGEDQSQ----QQRDSH 121
Query  144  QKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQD 203
            QK+    EGD+IA+P GVA+W YN+ +  +VAVSL D NN+ NQLDQ PRRF LAGN + 
Sbjct  122  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 181
Query  204  EF--------------------NPQQQGRQQQQQ--QQGQ-----------QGNGNNIFS 230
            EF                    +PQ Q RQ++++   +GQ           +  G NIFS
Sbjct  182  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 241
Query  231  GFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVRVQGQLDFVSPFSRSAGGRGDQERQ 287
            GF  ++L QA+ V+  +  +NL+G+ ++  E  IV V+G L  +SP  +    R D+E +
Sbjct  242  GFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKR---RADEEEE 298
Query  288  QEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISV 347
             +E + + + E+++R    +G  G+ NG+EET C+A   +NIG     D YNPQ G +  
Sbjct  299  YDEDEYEYDEEDRRR---GRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 355
Query  348  VNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILD 407
             N  +L ILR+L  SAE G LY NA++  H++TNA++++Y +RG A VQVV+ NG+ + D
Sbjct  356  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYD 415
Query  408  DEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNA 467
            +E++EG+++++PQN AV  ++ +E FEY++F+TD       LAG  SV+  LP+EV+ N+
Sbjct  416  EELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANS 475
Query  468  FRISRQEARNLKYN 481
            + + R++AR LK N
Sbjct  476  YGLQREQARQLKNN 489

Sequence Alignment: 25. Allergen Name: Ara h 3 Sequence ID: AAC63045

 Score = 89.9 bits 708,  Expect = 4e-19
 Identities = 201/444 45%, Positives = 303/444 68%, Gaps = 50/444 11%
Query  24   QLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLI 83
            Q+ +L A+ PDN I+SE G  E+WNP++ +F+ AGVA+ R  +  N L  P Y NAPQ I
Sbjct  13   QFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEI 72
Query  84   YIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRH 143
            +I +GRG +G +FPGC   +E+ + Q  + Q Q    RP R+  G+ Q Q     Q+D H
Sbjct  73   FIQQGRGYFGLIFPGCPRHYEEPHTQGRRSQSQ----RPPRRLQGEDQSQ----QQRDSH 124
Query  144  QKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQD 203
            QK+    EGD+IA+P GVA+W YN+ +  +VAVSL D NN+ NQLDQ PRRF LAGN + 
Sbjct  125  QKVHRFDEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNTEQ 184
Query  204  EF--------------------NPQQQGRQQQQQ--QQGQ-----------QGNGNNIFS 230
            EF                    +PQ Q RQ++++   +GQ           +  G NIFS
Sbjct  185  EFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFS 244
Query  231  GFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVRVQGQLDFVSPFSRSAGGRGDQERQ 287
            GF  ++L QA+ V+  +  +NL+G+ ++  E  IV V+G L  +SP  +    R D+E +
Sbjct  245  GFTPEFLEQAFQVDDRQIVQNLRGETESEEEGAIVTVRGGLRILSPDRKR---RADEEEE 301
Query  288  QEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISV 347
             +E + + + E+++R    +G  G+ NG+EET C+A   +NIG     D YNPQ G +  
Sbjct  302  YDEDEYEYDEEDRRR---GRGSRGRGNGIEETICTASAKKNIGRNRSPDIYNPQAGSLKT 358
Query  348  VNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILD 407
             N  +L ILR+L  SAE G LY NA++  H++TNA++++Y +RG A VQVV+ NG+ + D
Sbjct  359  ANDLNLLILRWLGPSAEYGNLYRNALFVAHYNTNAHSIIYRLRGRAHVQVVDSNGNRVYD 418
Query  408  DEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNA 467
            +E++EG+++++PQN AV  ++ +E FEY++F+TD       LAG  SV+  LP+EV+ N+
Sbjct  419  EELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSRPSIANLAGENSVIDNLPEEVVANS 478
Query  468  FRISRQEARNLKYN 481
            + + R++AR LK N
Sbjct  479  YGLQREQARQLKNN 492

Sequence Alignment: 26. Allergen Name: Fag e 1 Sequence ID: Q9XFM4

 Score = 88.5 bits 694,  Expect = 1e-18
 Identities = 203/454 44%, Positives = 312/454 68%, Gaps = 52/454 11%
Query  12   SRQHIFGQNKEWQ--LNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPN 69
            SR H   Q  + Q  + +L A EP   ++SEAGVTE W+   P+F+ AG   VR  I+P 
Sbjct  31   SRPHHGHQQFQHQCDIQRLTASEPSRRVRSEAGVTEIWDHDTPEFRCAGFVAVRVVIQPG 90
Query  70   GLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPS------ 123
            GL LPSY NAP + ++ +GRGV G V PGC ETF+     ++ + Q+ Q+ R S      
Sbjct  91   GLLLPSYSNAPYITFVEQGRGVQGVVVPGCPETFQSGSEFEYPRSQRDQRSRQSESGESS 150
Query  124  ------RQ----EGGQGQQQF-QGEDQQ----DRHQKIRHIREGDIIALPAGVAYWSYNN 168
                  RQ    E  +G Q+  Q E ++    D+HQKI  IR+GD+I  PAGV  W++NN
Sbjct  151  RGDQRSRQSESEESSRGDQRSRQSESEEFSRGDQHQKIFRIRDGDVIPSPAGVVQWTHNN 210
Query  169  GEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQ---DEFNPQQQGRQQQQQQQGQQGNG 225
            G+  L++++L D N+ QNQLD+  R F+LAG  +   ++   Q+Q R++   +Q ++   
Sbjct  211  GDNDLISITLYDANSFQNQLDENVRNFFLAGQSKQSREDRRSQRQTREEGSDRQSRESQD 270
Query  226  N------NIFSGFDTQLLAQAL-NVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSA 278
            +      NI+SGF+ ++L + + NV+ ET   L+G++D R  IV+ +  L +  P     
Sbjct  271  DEALLEANILSGFEDEILQEIFRNVDQETISKLRGENDQRGFIVQAR-DLKLRVP----- 324
Query  279  GGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFY 338
                    ++ E++ QRER +++R     GG G+ NG+E+ FC+ ++ QN+  PSRAD +
Sbjct  325  --------EEYEEELQRERGDRKR-----GGSGRSNGLEQAFCNLKFRQNVNRPSRADVF 371
Query  339  NPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVV 398
            NP+ GRI+ V+ N+LPIL +++LSA+  VLY NAI  P W+ NA++ +Y  RG  RVQVV
Sbjct  372  NPRAGRINTVDSNNLPILEFIQLSAQHVVLYKNAILGPRWNLNAHSALYVTRGEGRVQVV 431
Query  399  NENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRA 458
             + G  ++DD V+ GQ++++PQ  AV+ +A  EG+E++ ++ D+N  T+ +AG+TSVLRA
Sbjct  432  GDEGRSVFDDNVQRGQILVVPQGFAVVLKAGREGLEWVELKNDDNAITSPIAGKTSVLRA 491
Query  459  LPDEVLQNAFRISRQEARNLKYNRQE 484
            +P EVL N++ IS +EA  LK  RQE
Sbjct  492  IPVEVLANSYDISTKEAFRLKNGRQE 517

Sequence Alignment: 27. Allergen Name: Zan b 2.0101 Sequence ID: QYU76045

 Score = 87.9 bits 690,  Expect = 1e-18
 Identities = 209/383 54%, Positives = 291/383 75%, Gaps = 50/383 13%
Query  40   EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGC 99
            EAGVTE W+ ++ Q+Q A VAV R  I+  GL +PSY N  +L Y+V+GRG+ GAVFPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  100  AETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPA 159
             ET++D      QQQQQ +Q   SR               QD+HQK+R++REGDI+A+P 
Sbjct  61   PETYQD------QQQQQSHQSEGSRS--------------QDQHQKVRQLREGDIVAVPT 100
Query  160  GVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFN--PQQQGRQQQQQ 217
            G A+W YNNG+  LV V+L+D+ N  NQLDQ  R+FY+ GNPQ E+    Q QG +  Q 
Sbjct  101  GSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQG 160
Query  218  QQGQ----QGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSP 273
             QG+    + +G NIF+GFD +LLA A+NVNPE  R LQ     R  IVRV+ +L+ + P
Sbjct  161  SQGEGSSRRSSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRP 220
Query  274  FSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPS 333
                       +R QE++Q Q  R             G+DNG+EET+C+ +L +NI +PS
Sbjct  221  -----------QRGQEQEQEQEFR-------------GRDNGLEETYCTIKLKHNINNPS 256
Query  334  RADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNA 393
             AD YNP+GGRIS VN  +LP+LR+++LSAEKG LY NA   PHW+ N++++VY  RG+ 
Sbjct  257  DADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSG 316
Query  394  RVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRT 453
            RVQ+V+ENG+ + D +++EGQL ++PQ +AV+ +ASN+G+E+ISF+T++N  T+ LAGR 
Sbjct  317  RVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKRASNQGLEWISFKTNDNAETSQLAGRN 376
Query  454  SVLRALPDEVLQN 466
            SV+RALP +V+QN
Sbjct  377  SVIRALPLDVIQN 389

Sequence Alignment: 28. Allergen Name: Zan b 2.0102 Sequence ID: QYU76046

 Score = 87.0 bits 682,  Expect = 2e-18
 Identities = 210/382 54%, Positives = 292/382 76%, Gaps = 51/382 13%
Query  40   EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGC 99
            EAGVTE W+ ++ Q+Q A VAV R  I+  GL +PSY N  +L Y+V+GRG+ GAVFPGC
Sbjct  1    EAGVTEFWDQNNEQLQCANVAVFRHRIQQRGLLVPSYTNTAELFYVVQGRGIHGAVFPGC 60
Query  100  AETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPA 159
             ET++D      QQQQQ +Q   SR               QD+HQK+R++REGDI+A+P 
Sbjct  61   PETYQD------QQQQQSHQSEGSRS--------------QDQHQKVRQLREGDIVAMPT 100
Query  160  GVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFN--PQQQGRQQQQQ 217
            G A+W YNNG+  LV V+L+D+ N  NQLDQ  R+FY+ GNPQ E+    Q QG +  Q 
Sbjct  101  GSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYLRKFYIGGNPQQELQGYSQSQGSRSYQG 160
Query  218  QQGQQGN----GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSP 273
             QG+ G+    G NIF+GFD +LLA A+NVNPE  R LQ     R  IVRV+ +L+ + P
Sbjct  161  SQGEGGSRRSSGGNIFNGFDERLLADAFNVNPEIIRRLQKPQLPRGIIVRVEEELEVLRP 220
Query  274  FSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPS 333
                   RG+QE++QE +                   G+DNG+EET+C+ +L +NI +PS
Sbjct  221  ------QRGEQEQEQEFR-------------------GRDNGLEETYCTIKLKHNINNPS 255
Query  334  RADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNA 393
             AD YNP+GGRIS VN  +LP+LR+++LSAEKG LY NA   PHW+ N++++VY  RG+ 
Sbjct  256  DADVYNPRGGRISTVNSFNLPVLRWIQLSAEKGNLYQNAQLAPHWNLNSHSVVYVTRGSG 315
Query  394  RVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRT 453
            RVQ+V+ENG+ + D +++EGQL ++PQ +AV+ +ASN+G+E+ISF+T++N  T+ LAGR 
Sbjct  316  RVQIVSENGNNVYDGQIKEGQLIVVPQGYAVLKKASNQGLEWISFKTNDNAETSQLAGRN 375
Query  454  SVLRALPDEVLQN 466
            SV+RALP +V+QN
Sbjct  376  SVIRALPLDVIQN 388

Sequence Alignment: 29. Allergen Name: Zan b 2.03 Sequence ID: QYS16039

 Score = 86.9 bits 681,  Expect = 2e-18
 Identities = 218/380 57%, Positives = 290/380 76%, Gaps = 56/380 14%
Query  40   EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGC 99
            EAGVTE W+ ++ Q+Q A VAV R  I+ NGL +P+Y N P+L Y+V+GRG+ GAV PGC
Sbjct  1    EAGVTEFWDQNNQQLQCANVAVFRHRIQQNGLLVPAYTNTPELFYVVQGRGIHGAVIPGC 60
Query  100  AETFEDSQPQQFQQQQQQQQFR-PSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALP 158
             ET++D       +QQQQQ F  PS           +G   QD+HQK+R+IREGDIIALP
Sbjct  61   PETYQD-------EQQQQQSFSYPS-----------EGSRSQDQHQKVRQIREGDIIALP 102
Query  159  AGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQ 218
             G A+W YNNG+  LV V+L+D+ N  NQLDQ  R+FYL GNPQ    PQ QG  Q Q  
Sbjct  103  TGSAHWIYNNGQSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQ----PQLQGTSQSQGG 158
Query  219  QGQQ--GNGN------NIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDF 270
            + Q+  G G+      NIF+GFD +LLA+A+NVNPE  R LQ     R  I+RV+ ++  
Sbjct  159  RYQERLGGGDSSRRSANIFNGFDERLLAEAFNVNPELIRRLQRPQMQRGIIIRVEEEFRV 218
Query  271  VSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIG 330
            ++P           +R QE  +S                 G+ NGVEET+C+ RL +NI 
Sbjct  219  LTP-----------QRGQESYESDPY--------------GRYNGVEETLCTMRLRHNIN 253
Query  331  DPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIR 390
            DPSRAD YNP+ GR++ VNR +LP+LR+L+LSAEKG LY NA+  PHW+ NA+++VY  R
Sbjct  254  DPSRADVYNPRAGRVTTVNRLNLPVLRWLQLSAEKGNLYKNALTAPHWNLNAHSIVYITR 313
Query  391  GNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLA 450
            GN RVQ+V+ENG+ ++D E+REGQL ++PQ  AV+ +ASN G+E+ISF+T++   TN LA
Sbjct  314  GNGRVQIVSENGNNVFDGEIREGQLIVVPQGFAVVKRASNRGLEWISFKTNDYAMTNQLA 373
Query  451  GRTSVLRALPDEVLQN 466
            GR SVLRALP +V+QN
Sbjct  374  GRVSVLRALPLDVIQN 389

Sequence Alignment: 30. Allergen Name: Zan b 2.02 Sequence ID: QYU76044

 Score = 86.7 bits 679,  Expect = 2e-18
 Identities = 219/378 57%, Positives = 289/378 76%, Gaps = 51/378 13%
Query  40   EAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGC 99
            EAGVTE W+ ++PQ+Q A VAV R  I+ NGL +P+Y N  +L Y+V+GRG+ GAVFPGC
Sbjct  1    EAGVTEFWDQNNPQLQCANVAVFRHRIQKNGLLVPAYTNTAELFYVVQGRGIHGAVFPGC 60
Query  100  AETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPA 159
             ET++D        QQQQQ +            Q QG   QD+HQK+R+IREGDIIALP 
Sbjct  61   PETYQD--------QQQQQSY------------QSQGSRSQDQHQKVRQIREGDIIALPT 100
Query  160  GVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQ 219
            G A+W YNNG   LV V+L+D+ N  NQLDQ  R+FYL GNPQ E+    Q RQQ    Q
Sbjct  101  GAAHWIYNNGGSQLVLVALVDVGNSDNQLDQYFRKFYLGGNPQPELQGTSQ-RQQGGGYQ 159
Query  220  GQQGNGN-----NIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPF 274
            G QG G      N+F+GFD +LLA A+NVNPE  R LQ     R  IVRV+ ++  +SP 
Sbjct  160  GSQGGGGGSRRGNMFNGFDERLLADAFNVNPELIRRLQRPQMQRGIIVRVEEEFRVLSP- 218
Query  275  SRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSARLSQNIGDPSR 334
                      +R QE++Q          EQEQ      DNGVEETFC+ +L +NI DPSR
Sbjct  219  ----------QRGQEQEQ----------EQEQDC----DNGVEETFCTMKLRHNINDPSR 254
Query  335  ADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNAR 394
            AD YNP+GGR++ VNR +LP+LR+L+LSAEKG LY NA+ +PHW+ N +++VY  RG+ R
Sbjct  255  ADVYNPRGGRVTTVNRFNLPVLRWLQLSAEKGNLYQNALTSPHWNLNCHSIVYITRGSGR 314
Query  395  VQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTS 454
            +Q+V+ENG+ +++ E+REGQL +IPQ  AV+ +ASN G+E+I+F+T++N  TN LAGR S
Sbjct  315  MQIVSENGNDVFNGEIREGQLIVIPQGFAVVKKASNRGLEWIAFKTNDNAMTNQLAGRVS 374
Query  455  VLRALPDEV 463
            V+RALP +V
Sbjct  375  VMRALPLDV 383

Sequence Alignment: 31. Allergen Name: Ara h 4 Sequence ID: AAD47382

 Score = 87.1 bits 681,  Expect = 3e-18
 Identities = 209/464 45%, Positives = 316/464 68%, Gaps = 54/464 11%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            C+L+L    ++ RQ+   +    Q+ +L A+ PDN I+SE G  E+WNP++ +F+ AGVA
Sbjct  12   CFLVLGASSISFRQQ--PEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVA 69
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            + R  +  N L  P Y NAPQ I+I +GRG +G +FPGC  T+E+  P Q Q ++ Q Q 
Sbjct  70   LSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEE--PAQ-QGRRYQSQ- 125
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
            RP R+     Q++ Q + QQD HQK+    EGD+IA+P GVA+W YN+ +  +VAVSL D
Sbjct  126  RPPRRL----QEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTD 181
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEF-NPQQQGRQQQQQQ--------------------- 218
             NN+ NQLDQ PRRF LAGN + EF   QQQ RQ +++                      
Sbjct  182  TNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPHSRPRREEREFRP 241
Query  219  QGQQG-----------NGNNIFSGFDTQLLAQALNVNP-ETARNLQGQDDNRNE--IVRV 264
            +GQ+             G NIFSGF  ++L QA+ V+  +  +NL G++++  E  IV V
Sbjct  242  RGQHSRRERAGQEEEDEGGNIFSGFTPEFLEQAFQVDDRQIVQNLWGENESEEEGAIVTV 301
Query  265  QGQLDFVSPFSRSAGGRG-DQERQQEEQQSQREREEKQREQEQQGGGGQDNGVEETFCSA 323
            +G L  +SP     G RG D+E + +E Q +   ++ +R +  +GGG   NG+EET C+A
Sbjct  302  RGGLRILSP----DGTRGADEEEEYDEDQYEYHEQDGRRGRGSRGGG---NGIEETICTA 354
Query  324  RLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNAN 383
             + +NIG       Y+PQ       +  +L ILR+L LSAE G LY NA++ PH++TNA+
Sbjct  355  CVKKNIGGNRSPHIYDPQRWFTQNCHDLNLLILRWLGLSAEYGNLYRNALFVPHYNTNAH 414
Query  384  ALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTDEN 443
            +++YA+RG A VQVV+ NG+ + D+E++EG+++++PQN AV  ++ +E FEY++F+TD  
Sbjct  415  SIIYALRGRAHVQVVDSNGNRVYDEELQEGHVLVVPQNFAVAGKSQSENFEYVAFKTDSR 474
Query  444  GFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYN 481
                 +AG  S +  LP+EV+ N++ + R++AR LK N
Sbjct  475  PSIANFAGENSFIDNLPEEVVANSYGLPREQARQLKNN 512

Sequence Alignment: 32. Allergen Name: Fag e 1 Sequence ID: BAA21760

 Score = 80.8 bits 622,  Expect = 2e-16
 Identities = 195/445 43%, Positives = 291/445 65%, Gaps = 28/445 6%
Query  13   RQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLH 72
            +QH F +  + Q  +L A EP   ++SEAGVTE W+   P+F+  G   VR  I+P GL 
Sbjct  38   QQHQFQHQCDIQ--RLTASEPSRRVRSEAGVTEIWDHDTPEFRCTGFVAVRVVIQPGGLL 95
Query  73   LPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQ 132
            LPSY NAP + ++ +GRGV G V PGC ETF+     ++ Q Q+ ++ R S  E    ++
Sbjct  96   LPSYSNAPYITFVEQGRGVQGVVIPGCPETFQSDSEFEYPQSQRGRHSRQSESE----EE 151
Query  133  QFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVP 192
              +G    D+HQKI  IREGD+I  PAGV  W++N+G   L++V+LLD N+ + QLD+  
Sbjct  152  SSRG----DQHQKIFRIREGDVIPSPAGVVQWTHNDGNDDLISVTLLDANSYHKQLDENV 207
Query  193  RRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQAL-NVNPETARNL 251
            R F+LAG  Q E   +   RQ ++    +   G NI+SGF  ++L + + +V+ ET   L
Sbjct  208  RSFFLAGQSQRETREEGSDRQSRESDDDEALLGANILSGFQDEILHELFRDVDRETISKL 267
Query  252  QGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQEQQGGGG 311
            +G++D R  IV+ Q  L +  P             Q  E++ +RER +++R    QGG G
Sbjct  268  RGENDQRGFIVQAQ-DLKLRVP-------------QDFEEEYERERGDRRR---GQGGSG 310
Query  312  QDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNN 371
            + NGVE+ FC+ ++ +N   P+    +NP+ GRI+ VN N LPIL +L+LSA+  VLY N
Sbjct  311  RSNGVEQGFCNLKFRRNFNTPTNTYVFNPRAGRINTVNSNSLPILEFLQLSAQHVVLYKN 370
Query  372  AIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNE 431
            AI  P W+ NA++ +Y  RG  RVQVV + G  ++DD+V+ GQ++++PQ  AV+ +A  E
Sbjct  371  AIIGPRWNLNAHSALYVTRGEGRVQVVGDEGKSVFDDKVQRGQILVVPQGFAVVLKAGRE 430
Query  432  GFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQE 484
            G+E++ ++   N  T+ + GRTSVLRA+P EVL N++ IS +EA  LK  RQE
Sbjct  431  GLEWVELKNSGNAITSPIGGRTSVLRAIPVEVLANSYDISTKEAYKLKNGRQE 483

Sequence Alignment: 33. Allergen Name: Gly m 6.0501 Sequence ID: Q7GC77

 Score = 80.2 bits 616,  Expect = 3e-16
 Identities = 230/455 50%, Positives = 315/455 69%, Gaps = 64/455 14%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            CLLLL + C+A     F    E QLN L A EPD+ ++SE G+ E+WN   P++Q AGV 
Sbjct  14   CLLLLSSACFAITSSKFN---ECQLNNLNALEPDHRVESEGGLIETWNSQHPELQCAGVT 70
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            V +RT+  NGLHLPSY   PQ+I +V+G+G +G  FPGC ETFE  +PQQ          
Sbjct  71   VSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFE--KPQQ---------- 118
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
              S + G + QQQ+Q     D HQKIRH  EGD++ +P GV YW+YN G++P+VA+SLLD
Sbjct  119  -QSSRRGSRSQQQLQ-----DSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLD 172
Query  181  LNNDQNQLDQVPRRFYLAGNP---QDEFNPQQQ------GRQQQQQQQGQQGNGNNIFSG 231
             +N  NQLDQ PR FYLAGNP   + E   QQQ      GR+Q Q+QQ Q+  G +++SG
Sbjct  173  TSNFNNQLDQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQ-QEEEGGSVLSG 231
Query  232  FDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSP---------------FSR 276
            F  ++LAQ++N N +TA  L+  DD R +IV V+G L  +SP               + +
Sbjct  232  FSKHFLAQSFNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQ 291
Query  277  ---------SAGGRGDQERQQEEQQSQREREEKQR-----EQEQQGGGGQD-NGVEETFC 321
                     S G   D E + EE+   R     QR     +QE +G G Q  NGVEE  C
Sbjct  292  TPSYPPRRPSHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENIC 351
Query  322  SARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTN 381
            + +L +NI  PSRADFYNP+ GRIS +N   LP LR + LSA+  VLY N IY+PHW+ N
Sbjct  352  TMKLHENIARPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLN 411
Query  382  ANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEGFEYISFRTD 441
            AN+++Y  RG  RV+VVN  G+ ++D E+R GQL+++PQN  V  Q   +G+EY+ F+T 
Sbjct  412  ANSVIYVTRGKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTH 471
Query  442  ENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
             N  ++ +     V+RA+P EVL N++ + + + R LKY
Sbjct  472  HNAVSSYIK---DVFRAIPSEVLSNSYNLGQSQVRQLKY 507

Sequence Alignment: 34. Allergen Name: Gly m 6.0401 Sequence ID: Q9SB11

 Score = 79.4 bits 608,  Expect = 6e-16
 Identities = 223/469 47%, Positives = 316/469 67%, Gaps = 95/469 20%
Query  1    CLLLLFNGCLASRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            CLLLL + C+A       +  E QLN L A EPD+ ++SE G+ ++WN   P+++ AGV 
Sbjct  13   CLLLLSSACFAISS---SKLNECQLNNLNALEPDHRVESEGGLIQTWNSQHPELKCAGVT 69
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
            V + T+  NGLHLPSY   P++I I +G+G LG   PGC ETFE+ Q Q           
Sbjct  70   VSKLTLNRNGLHLPSYSPYPRMIIIAQGKGALGVAIPGCPETFEEPQEQ----------- 118
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
              S + G + Q+Q      QD HQKIRH  EGD++ +P GV YW+YN G++P+VA+SLLD
Sbjct  119  --SNRRGSRSQKQ----QLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLD 172
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEF----NPQQQ-----GRQQQQQQQGQQGNGNNIFSG 231
             +N  NQLDQ PR FYLAGNP  E+      QQQ     GR+Q Q+QQ ++  G +++SG
Sbjct  173  TSNFNNQLDQTPRVFYLAGNPDIEYPETMQQQQQQKSHGGRKQGQHQQEEEEEGGSVLSG 232
Query  232  FDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPF----------------- 274
            F  ++LAQ++N N + A  LQ  DD R +IV V+G L  +SP                  
Sbjct  233  FSKHFLAQSFNTNEDIAEKLQSPDDERKQIVTVEGGLSVISPKWQEQQDEDEDEDEDDED 292
Query  275  --------SRSAGGRGDQERQQEEQ----------QSQREREEKQREQEQQG-------- 308
                     R + G+ +Q+  ++E           Q +RE+++ Q E E +         
Sbjct  293  EQIPSHPPRRPSHGKREQDEDEDEDEDKPRPSRPSQGKREQDQDQDEDEDEDEDQPRKSR 352
Query  309  --------------------GGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVV 348
                                G    NGVEE  C+ +L +NI  PSRADFYNP+ GRIS +
Sbjct  353  EWRSKKTQPRRPRQEEPRERGCETRNGVEENICTLKLHENIARPSRADFYNPKAGRISTL 412
Query  349  NRNHLPILRYLRLSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDD 408
            N   LP LR ++LSA+  VLY N IY+PHW+ NAN+++Y  RG  +V+VVN  G+ ++D 
Sbjct  413  NSLTLPALRQFQLSAQYVVLYKNGIYSPHWNLNANSVIYVTRGQGKVRVVNCQGNAVFDG 472
Query  409  EVREGQLFLIPQNHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAF 468
            E+R GQL+++PQN  V  QA  +GFEYI F+T  N  T+ L     V+RA+P EVL +++
Sbjct  473  ELRRGQLLVVPQNFVVAEQAGEQGFEYIVFKTHHNAVTSYLK---DVFRAIPSEVLAHSY 529
Query  469  RISRQEARNLKYNRQESRLLSATS 492
             + + +   LKY      L++  S
Sbjct  530  NLRQSQVSELKYEGNWGPLVNPES 553

Sequence Alignment: 35. Allergen Name: Ses i 6.0101 Sequence ID: Q9XHP0

 Score = 77.1 bits 588,  Expect = 2e-15
 Identities = 199/444 44%, Positives = 307/444 69%, Gaps = 54/444 12%
Query  2    LLLLFNGCLA-SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVA 60
            L LL +  +A +R+  + Q ++ ++ ++   +P   IQSE G TE W+    QFQ AG+ 
Sbjct  12   LSLLVSAAIAQTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIV 71
Query  61   VVRRTIEPNGLHLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQF 120
             +R TI PNGL LP+Y  +P+L+YI RG+G++  + PGCAET+      Q ++ Q+  + 
Sbjct  72   AMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETY------QVHRSQRTME- 124
Query  121  RPSRQEGGQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLD 180
               R E    +QQ +G   +D HQK+  +R+GDI+A+P+G A+W YN+G + LVAVS+ D
Sbjct  125  ---RTEAS--EQQDRG-SVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSIND 178
Query  181  LNNDQNQLDQVPRRFYLAGNPQDEFNPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQA 240
            +N+  NQLDQ  R FYLAG       P+  G Q+QQ +Q      +NIF  FD +LL++A
Sbjct  179  VNHLSNQLDQKFRAFYLAGGV-----PRS-GEQEQQARQ----TFHNIFRAFDAELLSEA 228
Query  241  LNVNPETARNLQGQDDNRNEIVRVQGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEK 300
            +NV  ET R +Q +++ R  IV  + ++ FV P                        +E+
Sbjct  229  FNVPQETIRRMQSEEEERGLIVMARERMTFVRP------------------------DEE 264
Query  301  QREQEQQGGGGQDNGVEETFCSARLSQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLR 360
            + EQE++G    DNG+EETFC+ ++  N+     AD ++ Q GR+ VV+RN LPIL+Y+ 
Sbjct  265  EGEQEHRGRQ-LDNGLEETFCTMKFRTNVESRREADIFSRQAGRVHVVDRNKLPILKYMD 323
Query  361  LSAEKGVLYNNAIYTPHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQ 420
            LSAEKG LY+NA+ +P W    + +VY  RG+A+VQVV+ NG  +++D V +G++F++PQ
Sbjct  324  LSAEKGNLYSNALVSPDWSMTGHTIVYVTRGDAQVQVVDHNGQALMNDRVNQGEMFVVPQ 383
Query  421  NHAVITQASNEGFEYISFRTDENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKY 480
             +    +A N GFE+++F+T  +   + LAG TSV+RA+P +V+ N+++IS  +A+ LK 
Sbjct  384  YYTSTARAGNNGFEWVAFKTTGSPMRSPLAGYTSVIRAMPLQVITNSYQISPNQAQALKM 443
Query  481  NR-QESRLLSATSPPRGR 497
            NR  +S LLS    P GR
Sbjct  444  NRGSQSFLLS----PGGR 457

Sequence Alignment: 36. Allergen Name: Coc n 1.0101 Sequence ID: A0A0S3B0K0

 Score = 39.9 bits 237,  Expect = 0.0004
 Identities = 80/322 24%, Positives = 154/322 47%, Gaps = 41/322 12%
Query  147  RHIREGDIIALPAGVAYWSYNNGEQP-LVAVSLLDLNNDQNQLDQVPRRFYLAGNPQDEF 205
            + ++ G + A+PAG +++  N+ +   L  +  +D           P+ FY+ G      
Sbjct  131  KRLKSGYVDAIPAGSSFYIVNSDKSERLHIICSIDTLESMEYYGAYPQSFYVGGG----V 186
Query  206  NPQQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRNEIVRVQ 265
             P+                  +++SGFD   L+ A+NV+ +    +         I+R+ 
Sbjct  187  LPR------------------SVLSGFDASTLSAAFNVSSDQLEMILNSQRG-GPIIRLN 227
Query  266  GQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQREQE--------QQGGGGQDNGVE 317
            G+      +  S     ++  Q++E  S  + E +Q E +        +   G  D  V+
Sbjct  228  GEAAEQRDYLSSIMQLKERMVQEKEMDSDDDDEAEQEEDDVWTWRCLLKSLLGKGDCRVQ 287
Query  318  ETFCSARL--SQNIGDPSRADFYNPQGGRISVVNRNHLPILRYLRLSAEKGVLYNNAIYT 375
                 A    S N+ D +   + N  G  I++   ++   L++  L      L   A+ +
Sbjct  288  RKHKLAHSPGSYNLYD-TEPSYQNDYGYSIAIDGHDY-SALKHSNLGVYLVNLKAGAMLS 345
Query  376  PHWHTNANALVYAIRGNARVQVVNENGDPILDDEVREGQLFLIPQNHAVITQASNEG--F 433
            PH +  A      +RG+  +QVV  NG   ++ +V EG +F IP+      Q +++G  +
Sbjct  346  PHVNPTATEYGIILRGSGTIQVVFPNGTAAMNAKVSEGDVFWIPRYFP-FCQIASDGAPL 404
Query  434  EYISFRTD-ENGFTNTLAGRTSVLRALPDEVLQNAFRISRQEARNLKYNRQESRLLSATS 492
            E+  F T         L G++S+L ++    L  AF +S ++   +   ++E+ +L  TS
Sbjct  405  EFFGFTTSARKNRPQFLVGKSSLLHSMRGPELAAAFGVSEEQLERIVKAQREAVILP-TS 463
Query  493  PPR 495
            P R
Sbjct  464  PHR 466

Sequence Alignment: 37. Allergen Name: Tri a glutenin Sequence ID: CAA31395

 Score = 39.5 bits 231,  Expect = 0.0009
 Identities = 82/261 31%, Positives = 116/261 44%, Gaps = 36/261 13%
Query  32   EPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPN-----GLHLPSYV-NAPQLIYI 85
            +P  +  S    T+S  P   Q Q   V   ++  +P      G   P Y   +PQ    
Sbjct  373  QPGYYPTSSQQPTQSQQPGQGQ-QGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQ--- 428
Query  86   VRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQK 145
              G+G  G  +    ++ +  QP Q+QQ  Q Q+     Q+ GQGQQ  QG+  Q   Q 
Sbjct  429  -SGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQK----GQQPGQGQQPGQGQQGQQPGQG 483
Query  146  IRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQ--- 202
             +  + G         +      G+QP            Q Q    P      G  Q   
Sbjct  484  QQGQQPGQGQPGYYPTSPQQSGQGQQPGQW-----QQPGQGQPGYYPTSPLQPGQGQPGY 538
Query  203  DEFNPQQQGRQQQ--QQQQGQQGN-GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRN 259
            D  +PQQ G+ QQ  Q QQ  QG  G  +  G   Q  AQ +    + A+  QGQ   + 
Sbjct  539  DPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQ-VQQGQQPAQGQQGQQLGQG 597
Query  260  EIVRVQGQLDFVSPFSRSAGGRGDQERQ-QEEQQSQREREEKQREQEQQGGGGQDNG 315
            +    QGQ     P     G +  Q +Q Q+  Q Q  ++  Q +Q QQ G GQ  G
Sbjct  598  Q----QGQ----QPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPG 646

Sequence Alignment: 38. Allergen Name: Tri a 26.0101 Sequence ID: P10388

 Score = 39.5 bits 231,  Expect = 0.0009
 Identities = 82/261 31%, Positives = 116/261 44%, Gaps = 36/261 13%
Query  32   EPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPN-----GLHLPSYV-NAPQLIYI 85
            +P  +  S    T+S  P   Q Q   V   ++  +P      G   P Y   +PQ    
Sbjct  373  QPGYYPTSSQQPTQSQQPGQGQ-QGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQ--- 428
Query  86   VRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEGGQGQQQFQGEDQQDRHQK 145
              G+G  G  +    ++ +  QP Q+QQ  Q Q+     Q+ GQGQQ  QG+  Q   Q 
Sbjct  429  -SGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQK----GQQPGQGQQPGQGQQGQQPGQG 483
Query  146  IRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRRFYLAGNPQ--- 202
             +  + G         +      G+QP            Q Q    P      G  Q   
Sbjct  484  QQGQQPGQGQPGYYPTSPQQSGQGQQPGQW-----QQPGQGQPGYYPTSPLQPGQGQPGY 538
Query  203  DEFNPQQQGRQQQ--QQQQGQQGN-GNNIFSGFDTQLLAQALNVNPETARNLQGQDDNRN 259
            D  +PQQ G+ QQ  Q QQ  QG  G  +  G   Q  AQ +    + A+  QGQ   + 
Sbjct  539  DPTSPQQPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQ-VQQGQQPAQGQQGQQLGQG 597
Query  260  EIVRVQGQLDFVSPFSRSAGGRGDQERQ-QEEQQSQREREEKQREQEQQGGGGQDNG 315
            +    QGQ     P     G +  Q +Q Q+  Q Q  ++  Q +Q QQ G GQ  G
Sbjct  598  Q----QGQ----QPGQGQQGQQPAQGQQGQQPGQGQHGQQPGQGQQGQQPGQGQQPG 646

Sequence Alignment: 39. Allergen Name: Tri a glutenin Sequence ID: CAA43331

 Score = 38.4 bits 221,  Expect = 0.002
 Identities = 86/272 31%, Positives = 127/272 46%, Gaps = 31/272 11%
Query  18   GQ-NKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSY 76
            GQ  +  Q  QL   + D   QS  G     +    Q Q +G     +  +P G   P Y
Sbjct  330  GQLQQSTQEQQLGQEQQDQ--QSGQGRQGQQSGQRQQDQQSG-----QGQQP-GQRQPGY 381
Query  77   VN-APQLIYIVRGRGVLGAVFPGCAETF-EDSQPQQFQQQQQQQQFRPSRQEGGQGQQQF 134
             + +PQ +    G+G     +P   +   ++ QP+Q+QQ +Q QQ +   Q G QGQQ  
Sbjct  382  YSTSPQQL----GQG-QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQ-GQQGQQPG 435
Query  135  QGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGE-QPLVAVSLLDLNNDQNQLDQVPR 193
            QGE  Q   Q  +  + G     P         +G+ QP         +  Q+   Q P 
Sbjct  436  QGEQGQQPGQGQQGQQPGQ--GQPGYYPTSPQQSGQGQP----GYYPTSPQQSGQLQQPA 489
Query  194  RFYLAGNPQDEFNPQQQGRQQQQQQQGQQ-GNGNNIFSGFDTQLLAQALNVNPETARNLQ 252
            +    G  Q    P Q G+Q QQ  QGQQ G G   +     Q   Q   +  +  ++ Q
Sbjct  490  QGQQPGQEQQGQQPGQ-GQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLE-QWQQSGQ 547
Query  253  GQDDNR--NEIVRVQGQLDFVSPFSRSAGGRGDQERQ-QEEQQSQREREEKQREQEQQGG 309
            GQ  +   + +   QGQ  +  P S    G+G Q  Q Q+  Q Q+ ++  Q +Q QQ G
Sbjct  548  GQPGHYPTSPLQPGQGQPGYY-PTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQPG 606
Query  310  GGQ 312
             GQ
Sbjct  607  QGQ 609

Sequence Alignment: 40. Allergen Name: Tri a glutenin Sequence ID: AAB02788

 Score = 37.4 bits 211,  Expect = 0.004
 Identities = 87/262 33%, Positives = 126/262 48%, Gaps = 42/262 16%
Query  18   GQ-NKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGLHLPSY 76
            GQ  +  Q  QL   + D   QS  G     +    Q Q +G     +  +P G   P Y
Sbjct  324  GQLQQSTQEQQLGQEQQDQ--QSGQGRQGQQSGQRQQDQQSG-----QGQQP-GQRQPGY 375
Query  77   VN-APQLIYIVRGRGVLGAVFPGCAETF-EDSQPQQFQQQQQQQQFRPSRQEGGQGQQQF 134
             + +PQ +    G+G     +P   +   ++ QP+Q+QQ +Q QQ +   Q G QGQQQ 
Sbjct  376  YSTSPQQL----GQG-QPRYYPTSPQQPGQEQQPRQLQQPEQGQQGQQPEQ-GQQGQQQR 429
Query  135  QGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQLDQVPRR 194
            QGE  Q   Q  +  + G     P       Y    Q           + Q Q    P  
Sbjct  430  QGEQGQQPGQGQQGQQPGQ--GQPG-----YYPTSPQ----------QSGQGQPGYYPTS 472
Query  195  FYLAGNPQDEFNPQQQGRQQQQQQ--QGQQ-GNGNNIFSGFDTQLLAQALNVNPETARNL 251
               +G  Q     QQ G++QQ QQ  QGQQ G G   +     Q   Q   +  +  ++ 
Sbjct  473  PQQSGQLQQPAQGQQPGQEQQGQQPGQGQQPGQGQPGYYPTSPQQSGQEQQLE-QWQQSG 531
Query  252  QGQDDNR--NEIVRVQGQLDFVSPFSRSAGGRGDQERQ-QEEQQSQREREEKQREQEQQG 308
            QGQ  +   + +   QGQ  +  P S    G+G Q  Q Q+  Q Q+ ++  Q +Q QQ 
Sbjct  532  QGQPGHYPTSPLQPGQGQPGYY-PTSPQQIGQGQQPGQLQQPTQGQQGQQPGQGQQGQQP 590
Query  309  GGGQ 312
            G GQ
Sbjct  591  GEGQ 594

Sequence Alignment: 41. Allergen Name: Tri a glutenin Sequence ID: CAA31396

 Score = 36.2 bits 201,  Expect = 0.007
 Identities = 79/275 28%, Positives = 118/275 42%, Gaps = 30/275 10%
Query  12   SRQHIFGQNKEWQLNQLEAREPDNHIQSEAGVTESWNPSDPQFQLAGVAVVRRTIEPNGL 71
            S QH  GQ ++     ++ ++P+   Q      + + P+ PQ QL G     R  + +G 
Sbjct  208  SLQHT-GQRQQ----PVQGQQPEQG-QQPGQWQQGYYPTSPQ-QL-GQGQQPRQWQQSGQ 259
Query  72   ----HLPSYVNAPQLIYIVRGRGVLGAVFPGCAETFEDSQPQQFQQQQQQQQFRPSRQEG 127
                H P+ +  P      +G  +     PG  +       QQ   Q QQ ++  S+Q+ 
Sbjct  260  GQQGHYPTSLQQPGQGQ--QGHYLASQQQPGQGQQGHYPASQQQPGQGQQGHYPASQQQP 317
Query  128  GQGQQQFQGEDQQDRHQKIRHIREGDIIALPAGVAYWSYNNGEQPLVAVSLLDLNNDQNQ 187
            GQGQQ      QQ+  Q     ++G I   PA  +      G+Q     SL      Q Q
Sbjct  318  GQGQQGHYPASQQEPGQG----QQGQI---PA--SQQQPGQGQQGHYPASLQ--QPGQGQ 366
Query  188  LDQVPRRFYLAGNPQDEFNP--QQQGRQQQQQQQGQQGNGNNIFSGFDTQLLAQALNVNP 245
              + P  +   G  Q    P  +QQ  Q QQ  QGQQ                 +L    
Sbjct  367  QGHYPTSLQQLGQGQQTGQPGQKQQPGQGQQTGQGQQPEQEQQPGQGQQGYYPTSLQQPG 426
Query  246  ETARNLQGQDDNRNEIVRV--QGQLDFVSPFSRSAGGRGDQERQQEEQQSQREREEKQRE 303
            +  +  QGQ       ++   QGQ     P S    G+G   ++Q+  Q Q   + KQ  
Sbjct  427  QGQQQGQGQQGYYPTSLQQPGQGQQGHY-PASLQQPGQGQPGQRQQPGQGQHPEQGKQPG 485
Query  304  QEQQG 308
            Q QQG
Sbjct  486  QGQQG 490

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.