The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD
KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA
NALGFMRKEPLPECPEVLKEKLDMYDVKAN
Sequence Info Allergen Name Length Opt Bits Score E Value
A0A0K1SC24 Aca f 1 150 1017 259.6 2.6e-71
AKV72167 Pro j 1.0101 150 897 229.8 2.5e-62
A0A0K1SC10 Ama r 1.0101 168 868 222.5 4.3e-60
A0A0K1SC44 Koc s 1.0101 167 865 221.8 7.1e-60
AAL07319 Che a 1 168 807 207.3 1.6e-55
ADK22842 Sal k 5.0101 151 730 188.3 7.8e-50
X76396 Ole e 1.0103 145 470 123.7 2.1e-30
CAA73037 Ole e 1.0106 146 459 120.9 1.4e-29
P19963 Ole e 1 145 456 120.2 2.3e-29
CAA73036 Ole e 1.0107 146 455 120.0 2.8e-29
X76395 Ole e 1.0102 145 449 118.5 7.7e-29
O82015 Lig v 1 145 449 118.5 7.7e-29
X76397 Ole e 1.0104 145 448 118.2 9.2e-29
CAA54819 Lig v 1.0102 145 446 117.7 1.3e-28
CAA73038 Ole e 1.0105 146 446 117.7 1.3e-28
AAQ83588 Fra e 1.0201 146 444 117.2 1.8e-28
AAQ08947 Fra e 1.0101 145 439 116.0 4.3e-28
AAV74343 Fra e 1.0102 145 438 115.7 5.1e-28
CAA33854 Lyc e LAT52 161 415 109.9 3.1e-26
AAN32987 Phl p 11.0101 143 408 108.3 8.9e-26
Q7M1X5 Lol p 11.0101 134 403 107.1 1.9e-25
AAB32652 Ole e 1.0101 130 359 96.2 3.6e-22
P82242 Pla l 1 131 273 74.8 9.8e-16
CAC41635 Pla l 1.0103 131 263 72.3 5.5e-15
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Aca f 1 Sequence ID: A0A0K1SC24

 Score = 259.6 bits 1017,  Expect = 3e-71
 Identities = 150/150 100%, Positives = 150/150 100%, Gaps = 0/150 0%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD
Sbjct  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
            KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA
Sbjct  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
Query  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150
            NALGFMRKEPLPECPEVLKEKLDMYDVKAN
Sbjct  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150

Sequence Alignment: 2. Allergen Name: Pro j 1.0101 Sequence ID: AKV72167

 Score = 229.8 bits 897,  Expect = 2e-62
 Identities = 133/150 88%, Positives = 139/150 92%, Gaps = 0/150 0%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            DDV KPPVSQFH+QGLVYCDTCR  F+T  S IMEGATVKLECRNITAGTQTFKAEAVTD
Sbjct  1    DDVAKPPVSQFHIQGLVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTD 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
            KVGQYSIPV+GD EDDICEIELVKSP++ CSEIPHDVYAKQSAKVSLTSNNGEASD+RSA
Sbjct  61   KVGQYSIPVNGDFEDDICEIELVKSPNSDCSEIPHDVYAKQSAKVSLTSNNGEASDIRSA 120
Query  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150
            NALGFMRKEPL ECPEV KE LDMYDVKAN
Sbjct  121  NALGFMRKEPLKECPEVSKEPLDMYDVKAN 150

Sequence Alignment: 3. Allergen Name: Ama r 1.0101 Sequence ID: A0A0K1SC10

 Score = 222.5 bits 868,  Expect = 4e-60
 Identities = 130/149 87%, Positives = 139/149 93%, Gaps = 1/149 0%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            DDV K PVSQFH+QGLVYCDTCR  F+T  S IMEGATVKLECRNITAGTQTFKAEAVTD
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTD 79
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
            KVGQYSIPV+GD EDDICEIELVKSP+++CSE+ HDVYAKQSAKVSLTSNNGEASD+RSA
Sbjct  80   KVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSA 139
Query  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150
            NALGFMRKEPL ECPEVLKE LD+YDVKAN
Sbjct  140  NALGFMRKEPLEECPEVLKE-LDLYDVKAN 168

Sequence Alignment: 4. Allergen Name: Koc s 1.0101 Sequence ID: A0A0K1SC44

 Score = 221.8 bits 865,  Expect = 7e-60
 Identities = 131/148 88%, Positives = 138/148 93%, Gaps = 2/148 1%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            DDV K PVSQFH+QGLVYCDTC YP  +   P++EGATVKLECRNITAGTQTFKAEAVTD
Sbjct  20   DDVAKAPVSQFHIQGLVYCDTCPYPS-SYVLPMLEGATVKLECRNITAGTQTFKAEAVTD 78
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
            KVGQYSIPVDGD EDDICEIEL+KSPDNQCSE+ HDVYAKQSAKVSLTSNNGEASDVRSA
Sbjct  79   KVGQYSIPVDGDFEDDICEIELLKSPDNQCSEVSHDVYAKQSAKVSLTSNNGEASDVRSA 138
Query  121  NALGFMRKEPLPECPEVLKEKLDMYDVKAN 150
            NALGFMRKEPL ECPEVLKE LD+YDVKAN
Sbjct  139  NALGFMRKEPLEECPEVLKE-LDLYDVKAN 167

Sequence Alignment: 5. Allergen Name: Che a 1 Sequence ID: AAL07319

 Score = 207.3 bits 807,  Expect = 2e-55
 Identities = 121/141 85%, Positives = 132/141 93%, Gaps = 1/141 0%
Query  9    SQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 68
            ++F VQG+VYCDTCR  F+T  S IMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP
Sbjct  28   NHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIP 87
Query  69   VDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRK 128
            V+GD EDDICEIELVKSP+++CSE+ HDVYAKQSAKVSLTSNNGEASD+RSANALGFMRK
Sbjct  88   VNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRK 147
Query  129  EPLPECPEVLKEKLDMYDVKAN 150
            EPL ECPEVLKE LD+YDVKAN
Sbjct  148  EPLKECPEVLKE-LDLYDVKAN 168

Sequence Alignment: 6. Allergen Name: Sal k 5.0101 Sequence ID: ADK22842

 Score = 188.3 bits 730,  Expect = 8e-50
 Identities = 105/136 77%, Positives = 124/136 91%, Gaps = 1/136 0%
Query  11   FHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 70
            +HV+G+VYCDTCR  FIT  S +MEGATV L+CRN+TAGT+TFKAEAVTDK+G Y+I VD
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD 68
Query  71   GDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEP 130
            GDHEDDIC+I LVKSP  +CSEIP+DVY++Q+AKV+LTSNNGEASDVR+ANALGF++K P
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP 128
Query  131  LPECPEVLKEKLDMYDV 147
            LPECPEVLKE LDMYDV
Sbjct  129  LPECPEVLKE-LDMYDV 144

Sequence Alignment: 7. Allergen Name: Ole e 1.0103 Sequence ID: X76396

 Score = 123.7 bits 470,  Expect = 2e-30
 Identities = 70/141 49%, Positives = 94/141 66%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+C++   G+ TF     T 
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ ++ DH+D+ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+CP+V+  KL MY
Sbjct  118  NPLGFFKKEALPKCPQVFN-KLGMY 141

Sequence Alignment: 8. Allergen Name: Ole e 1.0106 Sequence ID: CAA73037

 Score = 120.9 bits 459,  Expect = 1e-29
 Identities = 70/141 49%, Positives = 94/141 66%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+C++   G  TF     T 
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C+EIP + +AK S K  L++ NG     R+ 
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGTT---RTV 118
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+C +V   KL MY
Sbjct  119  NPLGFYKKEALPKCAQVYN-KLGMY 142

Sequence Alignment: 9. Allergen Name: Ole e 1 Sequence ID: P19963

 Score = 120.2 bits 456,  Expect = 2e-29
 Identities = 68/141 48%, Positives = 93/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +D+P+PPVSQFH+QG VYCDTCR  FITE S  + GA+++L+C++   G  TF     T 
Sbjct  1    EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C+EIP + +AK S K  L + NG     R+ 
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGTT---RTV 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+C +V   KL MY
Sbjct  118  NPLGFFKKEALPKCAQVYN-KLGMY 141

Sequence Alignment: 10. Allergen Name: Ole e 1.0107 Sequence ID: CAA73036

 Score = 120.0 bits 455,  Expect = 3e-29
 Identities = 71/141 50%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+CR    G  TF     T 
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTR 61
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C EIP + +AK S K  L + NG     R+ 
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGTT---RTV 118
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+C +V   KL MY
Sbjct  119  NPLGFFKKEALPKCAQVYN-KLGMY 142

Sequence Alignment: 11. Allergen Name: Ole e 1.0102 Sequence ID: X76395

 Score = 118.5 bits 449,  Expect = 8e-29
 Identities = 68/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+++L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C+EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGTT---RTV 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+C +V   KL MY
Sbjct  118  NPLGFFKKEALPKCAQVYN-KLGMY 141

Sequence Alignment: 12. Allergen Name: Lig v 1 Sequence ID: O82015

 Score = 118.5 bits 449,  Expect = 8e-29
 Identities = 67/141 47%, Positives = 93/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQF++QG VYCDTCR  FITE S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTK 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G Y++ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYNMLIERDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF++KE LP+CP+V+  KL MY
Sbjct  118  NPLGFLKKEVLPKCPQVFN-KLGMY 141

Sequence Alignment: 13. Allergen Name: Ole e 1.0104 Sequence ID: X76397

 Score = 118.2 bits 448,  Expect = 9e-29
 Identities = 68/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PP+SQF+VQG VYCDTCR  FITE S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPISQFYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+CP+V+  KL MY
Sbjct  118  NPLGFFKKEALPKCPQVFN-KLGMY 141

Sequence Alignment: 14. Allergen Name: Lig v 1.0102 Sequence ID: CAA54819

 Score = 117.7 bits 446,  Expect = 1e-28
 Identities = 68/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQF++QG VYCDTCR  FITE S  + GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+CP+V+  KL MY
Sbjct  118  NPLGFFKKEALPKCPQVFN-KLGMY 141

Sequence Alignment: 15. Allergen Name: Ole e 1.0105 Sequence ID: CAA73038

 Score = 117.7 bits 446,  Expect = 1e-28
 Identities = 69/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FITE S  + GA+V+L+C++   G  TF     T 
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTR 61
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C+EIP + +AK S K  L + NG     R+ 
Sbjct  62   AEGLYSMLVERDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGTT---RTV 118
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N L F +KE LP+C +V   KL MY
Sbjct  119  NPLRFYKKEALPKCAQVYN-KLGMY 142

Sequence Alignment: 16. Allergen Name: Fra e 1.0201 Sequence ID: AAQ83588

 Score = 117.2 bits 444,  Expect = 2e-28
 Identities = 69/141 48%, Positives = 92/141 65%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVSQFH+QG VYCDTCR  FIT+ S  + GA+V+L+CR+   G  TF     T 
Sbjct  2    EDVPQPPVSQFHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTR 61
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ V+ DH+++ CEI L+ S    C+EIP + + K S K  L + NG     R+ 
Sbjct  62   GEGLYSMFVERDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNGTT---RTI 118
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+C +V   KL MY
Sbjct  119  NPLGFFKKEALPQCAQVYN-KLGMY 142

Sequence Alignment: 17. Allergen Name: Fra e 1.0101 Sequence ID: AAQ08947

 Score = 116.0 bits 439,  Expect = 4e-28
 Identities = 68/141 48%, Positives = 91/141 64%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVS F+VQG VYCDTCR  FITE S  ++GA V+L+C++   G  TF     T 
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+CP+V   KL MY
Sbjct  118  NPLGFFKKEVLPKCPQVYN-KLGMY 141

Sequence Alignment: 18. Allergen Name: Fra e 1.0102 Sequence ID: AAV74343

 Score = 115.7 bits 438,  Expect = 5e-28
 Identities = 68/141 48%, Positives = 90/141 63%, Gaps = 4/141 2%
Query  1    DDVPKPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTD 60
            +DVP+PPVS F+VQG VYCDTCR  FITE S  ++GA V+L+C+    G  TF     T 
Sbjct  1    EDVPQPPVSLFYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTR 60
Query  61   KVGQYSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSA 120
              G YS+ ++ DH+++ CEI L+ S    C EIP + + K S K  L + NG     R+ 
Sbjct  61   AEGLYSMVIERDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGTT---RTI 117
Query  121  NALGFMRKEPLPECPEVLKEKLDMY 145
            N LGF +KE LP+CP+V   KL MY
Sbjct  118  NPLGFFKKEALPKCPQVYN-KLGMY 141

Sequence Alignment: 19. Allergen Name: Lyc e LAT52 Sequence ID: CAA33854

 Score = 109.9 bits 415,  Expect = 3e-26
 Identities = 66/131 50%, Positives = 86/131 65%, Gaps = 5/131 3%
Query  5    KPPVSQFHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQ 64
            +P V  F V+G VYCDTCR  F T+ S  +EGATVKL+CRNI+   +TF  E VTDK G+
Sbjct  23   RPEV--FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGK 80
Query  65   YSIPVDGDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALG 124
            Y + V+GDHE+DICE+ +VKSP   C E    V   + A++  + N G  + VR AN L 
Sbjct  81   YKLTVNGDHENDICEVTVVKSPREDCKE---SVSGYEKARIECSDNVGIHNAVRFANPLF 137
Query  125  FMRKEPLPECPEVLKE 140
            FM+ E +  C E L E
Sbjct  138  FMKAESVQGCKEALDE 153

Sequence Alignment: 20. Allergen Name: Phl p 11.0101 Sequence ID: AAN32987

 Score = 108.3 bits 408,  Expect = 9e-26
 Identities = 65/132 49%, Positives = 84/132 63%, Gaps = 5/132 3%
Query  11   FHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 70
            F V G VYCD CR  F T  S  ++GATV ++CR    G   +KAEA TD +G Y I +D
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEID 65
Query  71   GDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNG-EASDVRSANALGFMRKE 129
             DH+++ICE+ L KSPD  CSEI      +  A+V LTSNNG +   +R AN + F RKE
Sbjct  66   QDHQEEICEVVLAKSPDTTCSEIEE---FRDRARVPLTSNNGIKQQGIRYANPIAFFRKE 122
Query  130  PLPECPEVLKEKLDMYD 146
            PL EC  +L+   D+ D
Sbjct  123  PLKECGGILQA-YDLRD 138

Sequence Alignment: 21. Allergen Name: Lol p 11.0101 Sequence ID: Q7M1X5

 Score = 107.1 bits 403,  Expect = 2e-25
 Identities = 64/126 50%, Positives = 80/126 63%, Gaps = 4/126 3%
Query  11   FHVQGLVYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVD 70
            F V G VYCD CR  F T  S  +EGATV ++CR    G   +KAEA TDK G Y I +D
Sbjct  6    FVVTGRVYCDPCRAGFETNVSHNVEGATVAVDCRPFDGGESKLKAEATTDKDGWYKIEID 65
Query  71   GDHEDDICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNG-EASDVRSANALGFMRKE 129
             DH+++ICE+ L KSPD  CSEI      +  A+V LTSN G +   +R AN + F RKE
Sbjct  66   QDHQEEICEVVLAKSPDKSCSEIEE---FRDRARVPLTSNXGIKQQGIRYANPIAFFRKE 122
Query  130  PLPECPEVLK 139
            PL EC  +L+
Sbjct  123  PLKECGGILQ 132

Sequence Alignment: 22. Allergen Name: Ole e 1.0101 Sequence ID: AAB32652

 Score = 96.2 bits 359,  Expect = 4e-22
 Identities = 58/125 46%, Positives = 77/125 61%, Gaps = 4/125 3%
Query  17   VYCDTCRYPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVDGDHEDD 76
            VYCDTCR  FITE S  + GA+V+L+C+    G  TF     T   G YS+ V+ DH+++
Sbjct  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE 61
Query  77   ICEIELVKSPDNQCSEIPHDVYAKQSAKVSLTSNNGEASDVRSANALGFMRKEPLPECPE 136
             CEI L+ S    C+EIP + +AK S K  L + NG     R+ N LGF +KE LP+C +
Sbjct  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQ 118
Query  137  VLKEKLDMY 145
            V   KL MY
Sbjct  119  VYN-KLGMY 126

Sequence Alignment: 23. Allergen Name: Pla l 1 Sequence ID: P82242

 Score = 74.8 bits 273,  Expect = 1e-15
 Identities = 50/123 40%, Positives = 67/123 54%, Gaps = 5/123 4%
Query  9    SQFHVQGLVYCDTCR-YPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 67
            ++FHV+G VYC+ C    +I E S  M GA V+L+C++ +     +     TD+ G Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETDQDGVYRL 65
Query  68   PVDGDHEDDICEIELVKSPDNQCSEIPHDVYAK-QSAKVSLTSNNGEASDVRSANALGFM 126
            PV G HED  CEI+LVKS    CSEIP       Q++KV L+ N       R    L F 
Sbjct  66   PVVGYHED--CEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  127  RKEPLPEC 134
             K   P C
Sbjct  124  AKTDAPGC 131

Sequence Alignment: 24. Allergen Name: Pla l 1.0103 Sequence ID: CAC41635

 Score = 72.3 bits 263,  Expect = 6e-15
 Identities = 49/123 39%, Positives = 66/123 53%, Gaps = 5/123 4%
Query  9    SQFHVQGLVYCDTCR-YPFITEASPIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSI 67
            ++FHV+G VYC+ C    +I E S  M GA V+L+C++ +     +     T + G Y +
Sbjct  7    AKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKV-IYSIGGETGQDGVYRL 65
Query  68   PVDGDHEDDICEIELVKSPDNQCSEIPHDVYAK-QSAKVSLTSNNGEASDVRSANALGFM 126
            PV G HED  CEI+LVKS    CSEIP       Q++KV L+ N       R    L F 
Sbjct  66   PVVGYHED--CEIKLVKSGRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFR 123
Query  127  RKEPLPEC 134
             K   P C
Sbjct  124  AKTDAPGC 131

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.