The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DFVDAHNAARAQVGVGPVHWTVDAYARQYANDRNLVHSATR
Sequence Info Allergen Name Length Opt Bits Score E Value
P83834 Cuc m 3.0101 41 280 100.1 2e-24
XP_007199020 Pru p 9.0101 161 103 39.9 1.1e-05
AVD29827 Art si 2.0101 163 86 34.2 0.00057
AVD29822 Art an 2.0101 163 85 33.8 0.00072
AVD29825 Art gm 2.0101 163 85 33.8 0.00072
AVD29826 Art la 2.0101 163 84 33.5 0.00091
AVD29824 Art ca 2.0101 163 84 33.5 0.00091
A0A2L1DGQ3 Art ar 2.0101 163 84 33.5 0.00091
AAU15051 Cyn d 24.0101 153 74 30.1 0.0087
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cuc m 3.0101 Sequence ID: P83834

 Score = 100.1 bits 280,  Expect = 2e-24
 Identities = 41/41 100%, Positives = 41/41 100%, Gaps = 0/41 0%
Query  1    DFVDAHNAARAQVGVGPVHWTVDAYARQYANDRNLVHSATR 41
            DFVDAHNAARAQVGVGPVHWTVDAYARQYANDRNLVHSATR
Sbjct  1    DFVDAHNAARAQVGVGPVHWTVDAYARQYANDRNLVHSATR 41

Sequence Alignment: 2. Allergen Name: Pru p 9.0101 Sequence ID: XP_007199020

 Score = 39.9 bits 103,  Expect = 1e-05
 Identities = 16/32 50%, Positives = 23/32 71%, Gaps = 2/32 6%
Query  2    FVDAHNAARAQVGVGPVHW--TVDAYARQYANDR 33
            FV+ HN AR +VG  P+ W  T+  YA++YA+ R
Sbjct  33   FVEEHNKARKEVGNKPLKWNTTLAQYAQEYADKR 66

Sequence Alignment: 3. Allergen Name: Art si 2.0101 Sequence ID: AVD29827

 Score = 34.2 bits 86,  Expect = 0.0006
 Identities = 16/38 42%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +LVHS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAEARTADCSLVHS 79

Sequence Alignment: 4. Allergen Name: Art an 2.0101 Sequence ID: AVD29822

 Score = 33.8 bits 85,  Expect = 0.0007
 Identities = 16/38 42%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +LVHS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHS 79

Sequence Alignment: 5. Allergen Name: Art gm 2.0101 Sequence ID: AVD29825

 Score = 33.8 bits 85,  Expect = 0.0007
 Identities = 16/38 42%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +LVHS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLVHS 79

Sequence Alignment: 6. Allergen Name: Art la 2.0101 Sequence ID: AVD29826

 Score = 33.5 bits 84,  Expect = 0.0009
 Identities = 15/38 39%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +L+HS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHS 79

Sequence Alignment: 7. Allergen Name: Art ca 2.0101 Sequence ID: AVD29824

 Score = 33.5 bits 84,  Expect = 0.0009
 Identities = 15/38 39%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +L+HS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHS 79

Sequence Alignment: 8. Allergen Name: Art ar 2.0101 Sequence ID: A0A2L1DGQ3

 Score = 33.5 bits 84,  Expect = 0.0009
 Identities = 15/38 39%, Positives = 22/38 57%, Gaps = 6/38 15%
Query  1    DFVDAHNAARAQVGVGPVHW------TVDAYARQYANDRNLVHS 38
            D+V AHN  R  +G+ P+ W         A+A     D +L+HS
Sbjct  36   DYVHAHNCIRRVLGMKPLCWDDELAKVAQAWAETRTPDCSLIHS 79

Sequence Alignment: 9. Allergen Name: Cyn d 24.0101 Sequence ID: AAU15051

 Score = 30.1 bits 74,  Expect = 0.009
 Identities = 15/38 39%, Positives = 24/38 63%, Gaps = 7/38 18%
Query  1    DFVDAHNAARAQVGVGPVHW--TVDAYARQYAN-----DRNLVHS 38
            D ++ HN  RA+  V P+ W  T+  +++ YA      D  +VHS
Sbjct  20   DILNEHNMFRAKEHVPPLTWNTTLAKFSQDYAESKLKKDCKMVHS 64

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.