The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI
ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES
L
Sequence Info Allergen Name Length Opt Bits Score E Value
P01071 Gly m TI 181 1219 284.9 9.5e-79
CAA45778 Gly m TI 217 1208 282.3 6.9e-78
AAB23464 Gly m TI 216 1178 275.4 7.8e-76
CAA45777 Gly m TI 217 1178 275.4 7.9e-76
AAB23482 Gly m TI 203 709 168.5 1.1e-43
AAB23483 Gly m TI 204 642 153.3 4.4e-39
CAA56343 Gly m TI 208 423 103.3 4.8e-24
CAA45723 Sola t 4 217 163 44.1 3.5e-06
P16348 Sola t 2 188 154 42.1 1.2e-05
O24383 Sola t 3.0101 186 141 39.1 9.2e-05
P30941 Sola t 4 221 129 36.3 0.00077
P20347 Sola t 3.0102 222 116 33.3 0.0061
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Gly m TI Sequence ID: P01071

 Score = 284.9 bits 1219,  Expect = 1e-78
 Identities = 181/181 100%, Positives = 181/181 100%, Gaps = 0/181 0%
Query  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
Sbjct  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
            PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI
Sbjct  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
Query  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
            ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES
Sbjct  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
Query  181  L 181
            L
Sbjct  181  L 181

Sequence Alignment: 2. Allergen Name: Gly m TI Sequence ID: CAA45778

 Score = 282.3 bits 1208,  Expect = 7e-78
 Identities = 179/181 98%, Positives = 180/181 99%, Gaps = 0/181 0%
Query  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            DFVLDNEGNPL +GGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
Sbjct  26   DFVLDNEGNPLDSGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 85
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
            PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI
Sbjct  86   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 145
Query  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
            ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES
Sbjct  146  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 205
Query  181  L 181
            L
Sbjct  206  L 206

Sequence Alignment: 3. Allergen Name: Gly m TI Sequence ID: AAB23464

 Score = 275.4 bits 1178,  Expect = 8e-76
 Identities = 173/181 95%, Positives = 178/181 98%, Gaps = 0/181 0%
Query  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            DFVLDNEGNPL NGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
Sbjct  25   DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 84
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
            P+RIRFIAEG+PL LKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDA+DGWFR+
Sbjct  85   PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL 144
Query  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
            ERVSDDEFNNYKLVFC QQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQK+DKES
Sbjct  145  ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES 204
Query  181  L 181
            L
Sbjct  205  L 205

Sequence Alignment: 4. Allergen Name: Gly m TI Sequence ID: CAA45777

 Score = 275.4 bits 1178,  Expect = 8e-76
 Identities = 173/181 95%, Positives = 178/181 98%, Gaps = 0/181 0%
Query  1    DFVLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            DFVLDNEGNPL NGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
Sbjct  26   DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 85
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDGWFRI 120
            P+RIRFIAEG+PL LKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDA+DGWFR+
Sbjct  86   PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL 145
Query  121  ERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKVDKES 180
            ERVSDDEFNNYKLVFC QQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQK+DKES
Sbjct  146  ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES 205
Query  181  L 181
            L
Sbjct  206  L 206

Sequence Alignment: 5. Allergen Name: Gly m TI Sequence ID: AAB23482

 Score = 168.5 bits 709,  Expect = 1e-43
 Identities = 115/169 68%, Positives = 132/169 78%, Gaps = 7/169 4%
Query  2    FVLDNEGNPLSNGGTYYILSDITAFGG-IRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            FVLD + +PL NGGTYY+L  +   GG I    TG E CPLTVVQS NELDKGIG + +S
Sbjct  27   FVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDSTGKEICPLTVVQSPNELDKGIGLVFTS 86
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEG-PAVKIGENKDAVDGWFR 119
            P+   FIAE  PL +KF SFAVI LC G+PTEW++VE   EG  AVK+   +D VDGWF 
Sbjct  87   PLHALFIAERYPLSIKFGSFAVITLCAGMPTEWAIVER--EGLQAVKLAA-RDTVDGWFN 143
Query  120  IERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQK 175
            IERVS  E+N+YKLVFC QQAED+KC DIGI ID DDG RRLV+SKNKPLVVQFQK
Sbjct  144  IERVSR-EYNDYKLVFCPQQAEDNKCEDIGIQID-DDGIRRLVLSKNKPLVVQFQK 197

Sequence Alignment: 6. Allergen Name: Gly m TI Sequence ID: AAB23483

 Score = 153.3 bits 642,  Expect = 4e-39
 Identities = 105/170 61%, Positives = 127/170 74%, Gaps = 6/170 3%
Query  2    FVLDNEGNPLSNGGTYYILSDITA-FGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS 60
            FVLD + +PL NGGTYY+L  +    GGI    TG E CPLTVVQS N+ +KGIG +  S
Sbjct  27   FVLDTDDDPLQNGGTYYMLPVMRGKSGGIEGNSTGKEICPLTVVQSPNKHNKGIGLVFKS 86
Query  61   PFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEG-PAVKIGENKDAVDGWFR 119
            P+   FIAE  PL +KFDSFAVI LC  +PT+W++VE   EG  AV +   +D VDGWF 
Sbjct  87   PLHALFIAERYPLSIKFDSFAVIPLCGVMPTKWAIVER--EGLQAVTLAA-RDTVDGWFN 143
Query  120  IERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQK 175
            IERVS +  + YKLVFC Q+AED+KC DIGI ID +DG RRLV+SKNKPLVV+FQK
Sbjct  144  IERVSREYNDYYKLVFCPQEAEDNKCEDIGIQID-NDGIRRLVLSKNKPLVVEFQK 198

Sequence Alignment: 7. Allergen Name: Gly m TI Sequence ID: CAA56343

 Score = 103.3 bits 423,  Expect = 5e-24
 Identities = 86/168 51%, Positives = 105/168 62%, Gaps = 17/168 10%
Query  1    DFVLDNEGNPLSNGGTYYILSDITAFGG-IRAAPTGNERCPLTVVQSRNE-LDKGIGTII 58
            D V+D EGNP+ NGGTYY+L  I   GG I  A T  E CPLTVVQS  E L +G+  II
Sbjct  26   DIVFDTEGNPIRNGGTYYVLPVIRGKGGGIEFAKTETETCPLTVVQSPFEGLQRGLPLII 85
Query  59   SSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDG-- 116
            SSPF+I  I EG  L LKF       LC  +      V+   +G A +       +    
Sbjct  86   SSPFKILDITEGLILSLKFH------LCTPLSLNSFSVDRYSQGSARRTPCQTHWLQKHN 139
Query  117  --WFRIERVSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVS--KNKPLVVQ 172
              WFRI+R S  E N YKLVFCT   +D  CGDI   ID + G R L+V+  +N PL+VQ
Sbjct  140  RCWFRIQRASS-ESNYYKLVFCTSN-DDSSCGDIVAPIDRE-GNRPLIVTHDQNHPLLVQ 196
Query  173  FQKVD 177
            FQKV+
Sbjct  197  FQKVE 201

Sequence Alignment: 8. Allergen Name: Sola t 4 Sequence ID: CAA45723

 Score = 44.1 bits 163,  Expect = 4e-06
 Identities = 52/166 31%, Positives = 86/166 51%, Gaps = 23/166 13%
Query  3    VLDNEGNPLSNGGTYYILSDI-TAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 58
            VLD  G  L +  +Y I+S    A+GG   +  +P  +  C   + +  +++    GT +
Sbjct  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPS-GTPV 94
Query  59   SSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVE-DLPEGPAV-KIGENKDAVDG 116
                  + I E   L ++F + +   LCV   T W V + D   G  + + G      D 
Sbjct  95   RFSHFGQGIFENELLNIQF-AISTSKLCVSY-TIWKVGDYDASLGTMLLETGGTIGQADS 152
Query  117  -WFRIERVSDDEFNNYKLVFCTQQAE-------DDK-CGDIGISIDHDDGTRRLVVSKNK 167
             WF+I  V   +F  Y L++C   +        DD+ C  +G+   H +G RRL + K+ 
Sbjct  153  SWFKI--VKSSQFG-YNLLYCPVTSTMSCPFSSDDQFCLKVGVV--HQNGKRRLALVKDN 207
Query  168  PLVVQFQKV 176
            PL V F++V
Sbjct  208  PLDVSFKQV 216

Sequence Alignment: 9. Allergen Name: Sola t 2 Sequence ID: P16348

 Score = 42.1 bits 154,  Expect = 1e-05
 Identities = 55/160 34%, Positives = 85/160 53%, Gaps = 35/160 21%
Query  3    VLDNEGNPLSNGGTYYILS-DITAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 58
            VLD  G  L+   +Y I+S    A+GG   +  +P  +  CP  V   R   D G     
Sbjct  8    VLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVF--RYNSDVGPS--- 62
Query  59   SSPFRIRFIA------EGNPLRLKFDSFAVIMLCVGIPTEWSV--VEDLPEGPAVKIGEN 110
             +P  +RFI       E   L ++F+  A + LCV   T W V  +        ++ G  
Sbjct  63   GTP--VRFIPLSGGIFEDQLLNIQFN-IATVKLCVSY-TIWKVGNLNAYFRTMLLETGGT 118
Query  111  KDAVDG-WFRIERVSDDEFNNYKLVFCTQQA--------EDDKCGDIGISIDHDDGTRRL 161
                D  +F+I ++S+  F  Y L++C            +D+ C  +G+ I   +G RRL
Sbjct  119  IGQADSSYFKIVKLSN--FG-YNLLYCPITPPFLCPFCRDDNFCAKVGVVI--QNGKRRL 173
Query  162  VVSKNKPLVVQFQKV 176
             +    PL V FQ+V
Sbjct  174  ALVNENPLDVLFQEV 188

Sequence Alignment: 10. Allergen Name: Sola t 3.0101 Sequence ID: O24383

 Score = 39.1 bits 141,  Expect = 9e-05
 Identities = 50/158 31%, Positives = 74/158 46%, Gaps = 24/158 15%
Query  3    VLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRN---ELDKGIGTIIS 59
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  +    L KG   +  
Sbjct  13   VYDQDGNPLRIGERYIIKNPLLGAGAVYLDNIGNLQCPNAVLQHMSIPQFLGKGTPVVF- 71
Query  60   SPFRIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAV 114
               R      G+ +RL    +  F V    LCV   T W V  +        +G   D  
Sbjct  72   --IRKSESDYGDVVRLMTAVYIKFFVKTTKLCVD-ETVWKVNNEQLVVTGGNVGNENDI- 127
Query  115  DGWFRIER---VSDDEFNNYKLVFCTQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVV 171
               F+I++   V     N YKL+ C  + E   C +IG   +  +G  RLV   ++   +
Sbjct  128  ---FKIKKTDLVIRGMKNVYKLLHCPSHLE---CKNIG--SNFKNGYPRLVTVNDEKDFI 179
Query  172  QF 173
             F
Sbjct  180  PF 181

Sequence Alignment: 11. Allergen Name: Sola t 4 Sequence ID: P30941

 Score = 36.3 bits 129,  Expect = 0.0008
 Identities = 54/166 32%, Positives = 88/166 53%, Gaps = 27/166 16%
Query  3    VLDNEGNPLSNGGTYYILSDI-TAFGG---IRAAPTGNERCPLTVVQSRNELDKGIGTII 58
            VLD  G  L +  +Y I+S    A+GG   +  +P  +  C   + +  +++    GT +
Sbjct  36   VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPS-GTPV 94
Query  59   ----SSPFRIRFIAEGNPLRLKFDSFAVIMLCVGIPTEWSVVE-DLPEGPAV-KIGENKD 112
                SS    + I E   L ++F + +   LCV   T W V + D   G  + + G    
Sbjct  95   RFIGSSSHFGQGIFENELLNIQF-AISTSKLCVSY-TIWKVGDYDASLGTMLLETGGTIG 152
Query  113  AVDG-WFRIERVSDDEFNNYKLVFCTQQAE-------DDK-CGDIGISIDHDDGTRRLVV 163
              D  WF+I  V   +F  Y L++C   +        DD+ C  +G+   H +G RRL +
Sbjct  153  QADSSWFKI--VKSSQFG-YNLLYCPVTSTMSCPFSSDDQFCLKVGVV--HQNGKRRLAL 207
Query  164  SKNKPLVVQFQKV 176
             K+ PL V F++V
Sbjct  208  VKDNPLDVSFKQV 220

Sequence Alignment: 12. Allergen Name: Sola t 3.0102 Sequence ID: P20347

 Score = 33.3 bits 116,  Expect = 0.006
 Identities = 46/160 28%, Positives = 75/160 46%, Gaps = 16/160 10%
Query  3    VLDNEGNPLSNGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPF 62
            V D +GNPL  G  Y I + +   G +     GN +CP  V+Q  + + + +G      F
Sbjct  48   VYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAVLQHMS-IPQFLGEGTPVVF 106
Query  63   -RIRFIAEGNPLRLK---FDSFAV--IMLCVGIPTEWSVVEDLPEGPAVKIGENKDAVDG 116
             R      G+ +R+    +  F V    LCV   T W V ++       K+G   D +  
Sbjct  107  VRKSESDYGDVVRVMTVVYIKFFVKTTKLCVD-QTVWKVNDEQLVVTGGKVGNEND-IFK 164
Query  117  WFRIERVSDDEFNN-YKLVFCTQQAEDDKCGDIGISIDHDDGTRRLV-VSKNKPLV 170
              + + V+       YKL+ C  +     C +IG   +  +G  RLV V  +K ++
Sbjct  165  IMKTDLVTPGGSKYVYKLLHCPSHL---GCKNIG--GNFKNGYPRLVTVDDDKDFI 215

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.