The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DIGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAA
NDYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQ
AYKYWTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL
YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM
PARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQMI
EGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRID
HIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKAS
IRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRFV
HKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENLL
LPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDRK
IHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH
Sequence Info Allergen Name Length Opt Bits Score E Value
AAB09632 Per a 3.0201 631 4409 1011.2 0
AAB62731 Per a 3.0202 470 3136 721.1 4.2e-209
Q25641 Per a 3.0101 685 3131 719.8 1.4e-208
D0VNY7 Bla g 3.0101 657 2780 639.8 1.7e-184
AAB63595 Per a 3.0203 393 2642 608.5 2.7e-175
G1AP69 Pen m 7.0101 683 1266 294.7 1.3e-80
AEB77775 Pen m 7.0102 683 1266 294.7 1.3e-80
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Per a 3.0201 Sequence ID: AAB09632

 Score = 1011.2 bits 4409,  Expect = 0
 Identities = 631/631 100%, Positives = 631/631 100%, Gaps = 0/631 0%
Query  1    DIGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAA 60
            DIGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAA
Sbjct  1    DIGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAA 60
Query  61   NDYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQ 120
            NDYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQ
Sbjct  61   NDYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQ 120
Query  121  AYKYWTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL 180
            AYKYWTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL
Sbjct  121  AYKYWTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL 180
Query  181  YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM 240
            YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM
Sbjct  181  YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM 240
Query  241  PARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQMI 300
            PARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQMI
Sbjct  241  PARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQMI 300
Query  301  EGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRID 360
            EGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRID
Sbjct  301  EGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRID 360
Query  361  HIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKAS 420
            HIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKAS
Sbjct  361  HIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKAS 420
Query  421  IRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRFV 480
            IRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRFV
Sbjct  421  IRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRFV 480
Query  481  HKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENLL 540
            HKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENLL
Sbjct  481  HKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENLL 540
Query  541  LPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDRK 600
            LPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDRK
Sbjct  541  LPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDRK 600
Query  601  IHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH 631
            IHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH
Sbjct  601  IHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH 631

Sequence Alignment: 2. Allergen Name: Per a 3.0202 Sequence ID: AAB62731

 Score = 721.1 bits 3136,  Expect = 4e-209
 Identities = 448/470 95%, Positives = 460/470 97%, Gaps = 1/470 0%
Query  161  LNAFNMYFRYIYPSWFNTTLYGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQY 220
            LNAFNMYFRYIYP+WFNTTLYGK+FDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQY
Sbjct  1    LNAFNMYFRYIYPTWFNTTLYGKTFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQY 60
Query  221  SKPLKTGYNPHLRYHNGEEMPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEH 280
            SKPLKTGYNPHLRY+NGEEMPARPSNMYPTN DLFYVSDIKNYE RVEKAIDF  AFDEH
Sbjct  61   SKPLKTGYNPHLRYQNGEEMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFD-AFDEH 119
Query  281  RTPYSLYHDQHGMDYLGQMIEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSAL 340
            RTPYSLYHDQHGMDYLGQMIEGT NSP+QYFYGS+FHFYRLLVGHVVDPYHKNGLAPSAL
Sbjct  120  RTPYSLYHDQHGMDYLGQMIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSAL 179
Query  341  EHPQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHF 400
            EH QTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHF
Sbjct  180  EHHQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHF 239
Query  401  EHSLGNAMYLGKLEDYMKASIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSL 460
            EHSLGNAMYLGKLED +KA+IRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSL
Sbjct  240  EHSLGNAMYLGKLEDVLKANIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSL 299
Query  461  GHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQE 520
            GHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDAL+ 
Sbjct  300  GHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALEG 359
Query  521  KDQYYIDKSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCG 580
            KDQYYID SHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHD+E YHYKAF+YCG
Sbjct  360  KDQYYIDNSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDLESYHYKAFTYCG 419
Query  581  VGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH 631
            VGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEVH+ T+
Sbjct  420  VGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEVHNETN 470

Sequence Alignment: 3. Allergen Name: Per a 3.0101 Sequence ID: Q25641

 Score = 719.8 bits 3131,  Expect = 1e-208
 Identities = 433/591 73%, Positives = 507/591 85%, Gaps = 2/591 0%
Query  34   PRGEPFSVYYEKHREQAIKLFELFFAANDYDTFYKTACWARDRVNEGMFMYALTVAAFHR 93
            PRGEPFSV YEKHREQAI L++L++ ANDYDTFYKTACWARDRVNEGMFMY++++A FHR
Sbjct  90   PRGEPFSVNYEKHREQAIMLYDLLYFANDYDTFYKTACWARDRVNEGMFMYSFSIAVFHR 149
Query  94   EDTKDLVLPPPYEVNPYLFVEDDVIQQAYKYWTKESGTDKHVEHVIPVNFTARSQEDLVA 153
            +D + ++LPPPYEV PYLFV+ DVI+ A KYW K +G+ +H  HVIPVNFT R+Q+ L+A
Sbjct  150  DDMQGVMLPPPYEVYPYLFVDHDVIHMAQKYWMKNAGSGEHHSHVIPVNFTLRTQDHLLA 209
Query  154  YFREDVDLNAFNMYFRYIYPSWFNTTLYGKSFDRRGEQFYYTYHQIYARYFLERLSNSLP 213
            YF  DV+LNAFN Y+RY YPSW+NTTLYG + DRRGEQFYYTY QIYARYFLERLSN LP
Sbjct  210  YFTSDVNLNAFNTYYRYYYPSWYNTTLYGHNIDRRGEQFYYTYKQIYARYFLERLSNDLP 269
Query  214  DVKPFQYSKPLKTGYNPHLRYHNGEEMPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDF 273
            DV PF YSKP+K+ YNP+LRYHNGEEMP RPSNMY TNFDL+Y++DIKNYE+RVE AIDF
Sbjct  270  DVYPFYYSKPVKSAYNPNLRYHNGEEMPVRPSNMYVTNFDLYYIADIKNYEKRVEDAIDF 329
Query  274  GYAFDEHRTPYSLYHDQHGMDYLGQMIEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKN 333
            GYAFDEH  P+SLYHD HGM+YL  MIEG  +SP+ YFYGS++H Y  ++GH+VDPYHK 
Sbjct  330  GYAFDEHMKPHSLYHDVHGMEYLADMIEGNMDSPNFYFYGSIYHMYHSMIGHIVDPYHKM 389
Query  334  GLAPSALEHPQTALRDPAFYQLWKRIDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKL 393
            GLAPS LEHP+T LRDP FYQLWKR+DH+ QKYKNRLPRYT+DEL+F GVK+ENVDVGKL
Sbjct  390  GLAPS-LEHPETVLRDPVFYQLWKRVDHLFQKYKNRLPRYTHDELAFEGVKVENVDVGKL 448
Query  394  YTYFEHFEHSLGNAMYLGKLEDYMKASIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFL 453
            YTYFE+++ SL  A+Y+  ++      ++    RLNHKPFTYNIEVSSDKAQDVYV +FL
Sbjct  449  YTYFEQYDMSLDMAVYVNNVDQISNVDVQLA-VRLNHKPFTYNIEVSSDKAQDVYVAVFL 507
Query  454  GPKYDSLGHECELDERRHYFVEMDRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKK 513
            GPKYD LG E +L++RRHYFVEMDRF + V AGKTVIER SHDS+II+   DSYR ++KK
Sbjct  508  GPKYDYLGREYDLNDRRHYFVEMDRFPYHVGAGKTVIERNSHDSNIIAPERDSYRTFYKK 567
Query  514  VSDALQEKDQYYIDKSHKYCGYPENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHY 573
            V +A + K QYY+DK H YCGYPENLL+PKGKKGGQ +TFYVIVTPYVKQDEHDFEPY+Y
Sbjct  568  VQEAYEGKSQYYVDKGHNYCGYPENLLIPKGKKGGQAYTFYVIVTPYVKQDEHDFEPYNY 627
Query  574  KAFSYCGVGHGRKYPDDKPLGFPFDRKIHDYDFYTPNMYFKDVVIFHKKYDEV 626
            KAFSYCGVG  RKYPD+KPLG+PFDRKI+  DFYTPNMYFKDV+IFHKKYDEV
Sbjct  628  KAFSYCGVGSERKYPDNKPLGYPFDRKIYSNDFYTPNMYFKDVIIFHKKYDEV 680

Sequence Alignment: 4. Allergen Name: Bla g 3.0101 Sequence ID: D0VNY7

 Score = 639.8 bits 2780,  Expect = 2e-184
 Identities = 392/620 63%, Positives = 492/620 79%, Gaps = 7/620 1%
Query  2    IGDHYDIEANIGHYKYPHVVKNFISYYKKGLLPRGEPFSVYYEKHREQAIKLFELFFAAN 61
            +GD YDIEANI +YK P VVKNF++ YKK  + RGEPFS YY KHREQAI LFELF+ AN
Sbjct  33   VGDSYDIEANINNYKNPRVVKNFMALYKKDPVKRGEPFSTYYIKHREQAIMLFELFYYAN 92
Query  62   DYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQA 121
            DYDTFYKTACWARDRVNEGMF+Y++ +A  HRED +D+V+P  YE+ P+LFVE+DVIQ+A
Sbjct  93   DYDTFYKTACWARDRVNEGMFLYSFNIAIMHREDMQDIVVPAFYEIYPFLFVENDVIQKA 152
Query  122  YKYWTKESG--TDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTT 179
            Y Y  KESG   + H  HVIPVNFT R+QE L++YF EDV LNAFN YFRY+YP+WFN T
Sbjct  153  YDYKMKESGHLNEPHT-HVIPVNFTLRNQEQLLSYFTEDVFLNAFNTYFRYMYPTWFNYT 211
Query  180  LYGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEE 239
             Y     R GEQFYY  +Q++ARY LER SN +P+++PF Y+KP+KT YNP+LRY NG+E
Sbjct  212  KYEYDVPRHGEQFYYFNQQMFARYMLERYSNDMPEIQPFTYTKPFKTPYNPQLRYPNGQE 271
Query  240  MPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQM 299
            +PARP+ M P +FDL YVSDIKNYE+RV  A+DFGY F +    +SLY+++ G+++LGQ+
Sbjct  272  VPARPAYMMPQDFDLMYVSDIKNYEKRVADAVDFGYVFCDKMISHSLYNNEKGLEWLGQI 331
Query  300  IEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRI 359
            +EG  NS H  FYG +FH YR L+GH+ DP+HK+G+APSALEHP+T+LRDPAFYQ+WKR+
Sbjct  332  VEG--NSMHPDFYGHIFHMYRSLLGHITDPFHKHGVAPSALEHPETSLRDPAFYQIWKRV 389
Query  360  DHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMKA 419
             H   K++ + P YT +EL+F GVKI+NVDVGKLYTYFE +E  L NA+ +GKLED    
Sbjct  390  QHYFNKFQMKQPYYTREELAFDGVKIDNVDVGKLYTYFEPYEMGLSNAVKVGKLEDVPNV 449
Query  420  SIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDRF 479
             IRAR+YRLNHKPFTYN+EV+S+K   VYVR+FLGPKY+  GHE +L+ERR+YFVE+DRF
Sbjct  450  DIRARNYRLNHKPFTYNVEVTSEKDTPVYVRVFLGPKYNYYGHEYDLNERRNYFVEIDRF 509
Query  480  VHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPENL 539
             +++  GK  I+R SHDSS+++  +D+Y+ L+KKV++A + K  Y  +K  KYCG PE+L
Sbjct  510  PYQLHTGKNTIQRNSHDSSVVAQEQDTYKVLYKKVNEAYEGKTTYTYEKQDKYCGLPEHL 569
Query  540  LLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFDR 599
            L+PKGKKGGQ FT YVIVTPY K  E   E +H+KA+SYCGVG      D KPLGFPFDR
Sbjct  570  LIPKGKKGGQAFTVYVIVTPYDKAVEK--EEHHFKAYSYCGVGPHDSVYDKKPLGFPFDR 627
Query  600  KIHDYDFYTPNMYFKDVVIFHKKYDEV 626
             IH YDF TPNM+ KDV IFHKKY+EV
Sbjct  628  PIHSYDFVTPNMFMKDVFIFHKKYEEV 654

Sequence Alignment: 5. Allergen Name: Per a 3.0203 Sequence ID: AAB63595

 Score = 608.5 bits 2642,  Expect = 3e-175
 Identities = 375/393 95%, Positives = 386/393 98%, Gaps = 0/393 0%
Query  239  EMPARPSNMYPTNFDLFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 298
            EMPARPSNMYPTN DLFYVSDIKNYE RVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ
Sbjct  1    EMPARPSNMYPTNIDLFYVSDIKNYESRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQ 60
Query  299  MIEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKR 358
            MIEGT NSP+QYFYGS+FHFYRLLVGHVVDPYHKNGLAPSALEH QTALRDPAFYQLWKR
Sbjct  61   MIEGTSNSPYQYFYGSIFHFYRLLVGHVVDPYHKNGLAPSALEHHQTALRDPAFYQLWKR 120
Query  359  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYLGKLEDYMK 418
            IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMY+GKLED +K
Sbjct  121  IDHIVQKYKNRLPRYTYDELSFPGVKIENVDVGKLYTYFEHFEHSLGNAMYIGKLEDLLK 180
Query  419  ASIRARHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 478
            A+IRA HYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR
Sbjct  181  ANIRASHYRLNHKPFTYNIEVSSDKAQDVYVRIFLGPKYDSLGHECELDERRHYFVEMDR 240
Query  479  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYPEN 538
            FVHKVEAGKTVIERKSHDSSIISDSHDSYRNL+KKV+DAL+EKDQYYIDKSHKYC YPEN
Sbjct  241  FVHKVEAGKTVIERKSHDSSIISDSHDSYRNLYKKVADALEEKDQYYIDKSHKYCNYPEN 300
Query  539  LLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 598
            LLLPKGKKGGQTFTFYVIVTPYVKQ++HDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD
Sbjct  301  LLLPKGKKGGQTFTFYVIVTPYVKQEQHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFPFD 360
Query  599  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHDVTH 631
            RKIHDYDFYTPNMYFKDVVIFHKKYDEVH+VTH
Sbjct  361  RKIHDYDFYTPNMYFKDVVIFHKKYDEVHEVTH 393

Sequence Alignment: 6. Allergen Name: Pen m 7.0101 Sequence ID: G1AP69

 Score = 294.7 bits 1266,  Expect = 1e-80
 Identities = 229/611 37%, Positives = 354/611 57%, Gaps = 24/611 3%
Query  4    DHYDIEANIGHYKYP-HVVKNFISYYKKG-LLPRGEPFSVYYEKHREQAIKLFELFFAAN 61
            D +D EAN+ HY      V+ ++   K   LL +   FS++  ++RE+A+ LF+++    
Sbjct  63   DSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQRHWFSLFNPRQREEALMLFDVLIHCK 122
Query  62   DYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQA 121
            D+DTF   A + R  +NEG F+YAL VA  H   ++ +VLPP YEV P+LF   +VI+ A
Sbjct  123  DWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPLSEHVVLPPLYEVTPHLFTNSEVIEAA 182
Query  122  YKY-WTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL 180
            Y+   T++ G  K          T ++ E  VAYF ED+ +N  ++ +   +P W++   
Sbjct  183  YRAKQTQKPGKFKS-----SFTGTKKNPEQRVAYFGEDIGMNTHHVTWHMEFPFWWDDK- 236
Query  181  YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM 240
            Y   +DR+GE F++ +HQ+  R+  ERLSN L  V  +++ KP+  G+ PH  Y  G + 
Sbjct  237  YSHHLDRKGENFFWVHHQLTVRFDAERLSNYLDPVDELHWEKPIVQGFAPHTTYKYGGQF 296
Query  241  PARPSNMYPTNFD-LFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQM 299
            P+RP N+   + D +  + D+   E R+  AI  GY  D       + +++ G+D LG +
Sbjct  297  PSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGNHIDIMNER-GIDVLGDV 355
Query  300  IEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRI 359
            IE +  SP+  +YG++ +   +++G   DP+ K  L P  LEH +TA RDP+F++L K +
Sbjct  356  IESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHKYM 415
Query  360  DHIVQKYKNRLPRYTYDELSFPGVKIENVDV-GKLYTYFEHFEHSLGNAMYLGKLEDYMK 418
            D+I +++K+ LP YT +EL+F GV ++NV + G+L T+FE FE++L NA  +   E    
Sbjct  416  DNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQIPD 473
Query  419  ASIRARHYRLNHKPFTYNIEVSSDKAQDVY--VRIFLGPKYDSLGHECELDERRHYFVEM 476
              I     RLNHK F   I+VS++K Q+V   VRIF  P  D+ G E  +DE R   +E+
Sbjct  474  VEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAIEL 533
Query  477  DRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYP 536
            D+F  K+ AG    ERKS +S++      S+  LF+K  +AL   D    D      G P
Sbjct  534  DKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTD-FESATGIP 592
Query  537  ENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFP 596
              +LLPKG + G  F + V VT        D   +    F++ G  HG KYPD++P G+P
Sbjct  593  NRFLLPKGNEQGLEFDLVVAVTDGAADAAVD-GLHENTEFNHYG-SHG-KYPDNRPHGYP 649
Query  597  FDRKIHDYDFYT--PNMYFKDVVIF-HKKYDEVHD 628
            +DRK+ D   +   PN     V +F H +Y + HD
Sbjct  650  LDRKVPDERVFEDLPNFGHIQVKVFNHGEYIQ-HD 683

Sequence Alignment: 7. Allergen Name: Pen m 7.0102 Sequence ID: AEB77775

 Score = 294.7 bits 1266,  Expect = 1e-80
 Identities = 229/611 37%, Positives = 354/611 57%, Gaps = 24/611 3%
Query  4    DHYDIEANIGHYKYP-HVVKNFISYYKKG-LLPRGEPFSVYYEKHREQAIKLFELFFAAN 61
            D +D EAN+ HY      V+ ++   K   LL +   FS++  ++RE+A+ LF+++    
Sbjct  63   DSFDPEANLSHYSDGGKAVQKLMRDLKDNRLLQQRHWFSLFNPRQREEALMLFDVLIHCK 122
Query  62   DYDTFYKTACWARDRVNEGMFMYALTVAAFHREDTKDLVLPPPYEVNPYLFVEDDVIQQA 121
            D+DTF   A + R  +NEG F+YAL VA  H   ++ +VLPP YEV P+LF   +VI+ A
Sbjct  123  DWDTFVSNAAYFRQIMNEGEFVYALYVAVIHSPLSEHVVLPPLYEVTPHLFTNSEVIEAA 182
Query  122  YKY-WTKESGTDKHVEHVIPVNFTARSQEDLVAYFREDVDLNAFNMYFRYIYPSWFNTTL 180
            Y+   T++ G  K          T ++ E  VAYF ED+ +N  ++ +   +P W++   
Sbjct  183  YRAKQTQKPGKFKS-----SFTGTKKNPEQRVAYFGEDIGMNTHHVTWHMEFPFWWDDK- 236
Query  181  YGKSFDRRGEQFYYTYHQIYARYFLERLSNSLPDVKPFQYSKPLKTGYNPHLRYHNGEEM 240
            Y   +DR+GE F++ +HQ+  R+  ERLSN L  V  +++ KP+  G+ PH  Y  G + 
Sbjct  237  YSHHLDRKGENFFWVHHQLTVRFDAERLSNYLDPVDELHWEKPIVQGFAPHTTYKYGGQF 296
Query  241  PARPSNMYPTNFD-LFYVSDIKNYERRVEKAIDFGYAFDEHRTPYSLYHDQHGMDYLGQM 299
            P+RP N+   + D +  + D+   E R+  AI  GY  D       + +++ G+D LG +
Sbjct  297  PSRPDNVDFEDVDGVARIRDLLIVESRIRDAIAHGYIVDRAGNHIDIMNER-GIDVLGDV 355
Query  300  IEGTRNSPHQYFYGSVFHFYRLLVGHVVDPYHKNGLAPSALEHPQTALRDPAFYQLWKRI 359
            IE +  SP+  +YG++ +   +++G   DP+ K  L P  LEH +TA RDP+F++L K +
Sbjct  356  IESSLYSPNVQYYGALHNTAHIVLGRQSDPHGKYDLPPGVLEHFETATRDPSFFRLHKYM 415
Query  360  DHIVQKYKNRLPRYTYDELSFPGVKIENVDV-GKLYTYFEHFEHSLGNAMYLGKLEDYMK 418
            D+I +++K+ LP YT +EL+F GV ++NV + G+L T+FE FE++L NA  +   E    
Sbjct  416  DNIFKEHKDSLPPYTVEELTFAGVSVDNVAIEGELETFFEDFEYNLINA--VDDTEQIPD 473
Query  419  ASIRARHYRLNHKPFTYNIEVSSDKAQDVY--VRIFLGPKYDSLGHECELDERRHYFVEM 476
              I     RLNHK F   I+VS++K Q+V   VRIF  P  D+ G E  +DE R   +E+
Sbjct  474  VEISTYVPRLNHKDFKIKIDVSNNKGQEVLATVRIFAWPHLDNNGIEFTFDEGRWNAIEL 533
Query  477  DRFVHKVEAGKTVIERKSHDSSIISDSHDSYRNLFKKVSDALQEKDQYYIDKSHKYCGYP 536
            D+F  K+ AG    ERKS +S++      S+  LF+K  +AL   D    D      G P
Sbjct  534  DKFWVKLPAGTHHFERKSSESAVTVPDVPSFATLFEKTKEALAGADSGLTD-FESATGIP 592
Query  537  ENLLLPKGKKGGQTFTFYVIVTPYVKQDEHDFEPYHYKAFSYCGVGHGRKYPDDKPLGFP 596
              +LLPKG + G  F + V VT        D   +    F++ G  HG KYPD++P G+P
Sbjct  593  NRFLLPKGNEQGLEFDLVVAVTDGAADAAVD-GLHENTEFNHYG-SHG-KYPDNRPHGYP 649
Query  597  FDRKIHDYDFYT--PNMYFKDVVIF-HKKYDEVHD 628
            +DRK+ D   +   PN     V +F H +Y + HD
Sbjct  650  LDRKVPDERVFEDLPNFGHIQVKVFNHGEYIQ-HD 683

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.