The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY
GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG
LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR
DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Sequence Info Allergen Name Length Opt Bits Score E Value
Q9SCG9 Cup a 1 346 2365 545.5 1.2e-156
CAC37790 Cup a 1 367 2300 530.7 3.6e-152
AAF72626 Cup s 1.0102 367 2286 527.5 3.3e-151
CAC48400 Jun o 1 367 2277 525.5 1.4e-150
AAF72625 Cup s 1.0101 367 2276 525.2 1.6e-150
AAF72627 Cup s 1.0103 367 2272 524.3 3e-150
AAF72628 Cup s 1.0104 367 2266 523.0 7.8e-150
P81294 Jun a 1.0101 367 2261 521.8 1.7e-149
AAD03609 Jun a 1.0102 367 2261 521.8 1.7e-149
Q9LLT1 Jun v 1.0101 367 2260 521.6 2e-149
AAF72629 Cup s 1.0105 367 2259 521.4 2.3e-149
AAF80164 Jun v 1.0102 367 2252 519.8 7.1e-149
Q96385 Cha o 1 375 2065 477.1 4.9e-136
P18632 Cry j 1.0101 374 1973 456.2 1e-129
BAB86287 Cry j 1.0103 374 1963 453.9 4.9e-129
BAA05543 Cry j 1.0102 374 1954 451.8 2e-128
AY904433 Art v 6.0101 396 1052 246.2 1.7e-66
P27761 Amb a 1 397 1045 244.6 5.2e-66
AAA32669 Amb a 1 397 1045 244.6 5.2e-66
A0A251RNJ1 Hel a 6.0101 394 1031 241.4 4.7e-65
P27762 Amb a 2 397 1030 241.2 5.5e-65
P27759 Amb a 1 396 1015 237.8 5.9e-64
P27760 Amb a 1 398 1011 236.9 1.1e-63
P28744 Amb a 1 392 936 219.8 1.5e-58
ABM60783 Pen c 32.0101 290 280 70.3 1.1e-13
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cup a 1 Sequence ID: Q9SCG9

 Score = 545.5 bits 2365,  Expect = 1e-156
 Identities = 346/346 100%, Positives = 346/346 100%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY
Sbjct  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG
Sbjct  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR
Sbjct  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Sbjct  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346

Sequence Alignment: 2. Allergen Name: Cup a 1 Sequence ID: CAC37790

 Score = 530.7 bits 2300,  Expect = 4e-152
 Identities = 336/345 97%, Positives = 340/345 98%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADCVVGFGS TMGGKGGEIYTVTSS+DNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCVVGFGSLTMGGKGGEIYTVTSSDDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGA VHLGNGGPCLFMR ASHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRTASHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYDDD SMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDISMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+TSACANWVWR TR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRFTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            DAFTNGAYFVSSGKAE+TNIYNSNEAFKVENGNAAPQLTQNAGVV
Sbjct  322  DAFTNGAYFVSSGKAEETNIYNSNEAFKVENGNAAPQLTQNAGVV 366

Sequence Alignment: 3. Allergen Name: Cup s 1.0102 Sequence ID: AAF72626

 Score = 527.5 bits 2286,  Expect = 3e-151
 Identities = 331/346 95%, Positives = 340/346 98%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+IYTVTS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLEMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  SSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGN APQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA 367

Sequence Alignment: 4. Allergen Name: Jun o 1 Sequence ID: CAC48400

 Score = 525.5 bits 2277,  Expect = 1e-150
 Identities = 331/345 95%, Positives = 339/345 98%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADCVVGFGSSTMGGKGGE YTVTS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWGQNRMKLADCVVGFGSSTMGGKGGEFYTVTSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYD+DKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITISNNHFFNHHKVMLLGHDDTYDNDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            DAFTNGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVV
Sbjct  322  DAFTNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366

Sequence Alignment: 5. Allergen Name: Cup s 1.0101 Sequence ID: AAF72625

 Score = 525.2 bits 2276,  Expect = 2e-150
 Identities = 329/346 95%, Positives = 338/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+IYT TS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTATSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  SSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSF APNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGN APQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA 367

Sequence Alignment: 6. Allergen Name: Cup s 1.0103 Sequence ID: AAF72627

 Score = 524.3 bits 2272,  Expect = 3e-150
 Identities = 329/346 95%, Positives = 338/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+IYTVTS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIH CNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSL DCSDGLIDVTL
Sbjct  142  LHIHSCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLPDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  SSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGN APQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA 367

Sequence Alignment: 7. Allergen Name: Cup s 1.0104 Sequence ID: AAF72628

 Score = 523.0 bits 2266,  Expect = 8e-150
 Identities = 328/346 94%, Positives = 338/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+IYTVTS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  SSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSF APNE+YKKEVTKRIGC +TSACANWVWRSTR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCVSTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGN APQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKTEETNIYNSNEAFKVENGNLAPQLTKNAGVVA 367

Sequence Alignment: 8. Allergen Name: Jun a 1.0101 Sequence ID: P81294

 Score = 521.8 bits 2261,  Expect = 2e-149
 Identities = 327/345 94%, Positives = 336/345 97%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILH 
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHS 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+ SACANWVWRSTR
Sbjct  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            DAF NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVV
Sbjct  322  DAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366

Sequence Alignment: 9. Allergen Name: Jun a 1.0102 Sequence ID: AAD03609

 Score = 521.8 bits 2261,  Expect = 2e-149
 Identities = 327/345 94%, Positives = 336/345 97%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDFYTVTSTDDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILH 
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHS 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAP+ESYKKEVTKRIGCE+ SACANWVWRSTR
Sbjct  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPSESYKKEVTKRIGCESPSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            DAF NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVV
Sbjct  322  DAFINGAYFVSSGKTEETNIYNSNEAFKVENGNAAPQLTKNAGVV 366

Sequence Alignment: 10. Allergen Name: Jun v 1.0101 Sequence ID: Q9LLT1

 Score = 521.6 bits 2260,  Expect = 2e-149
 Identities = 327/346 94%, Positives = 337/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSADDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAPNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA 367

Sequence Alignment: 11. Allergen Name: Cup s 1.0105 Sequence ID: AAF72629

 Score = 521.4 bits 2259,  Expect = 2e-149
 Identities = 327/346 94%, Positives = 337/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNWDQNRMKLADC VGFGSSTMGGKGG+IYTVTS+EDNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWDQNRMKLADCAVGFGSSTMGGKGGDIYTVTSAEDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREKALWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKALWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLG+VLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGNVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  SSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYDQWNIYAIGGSSNPTILSEGNSF APNE+YKKEVTKRIGC +TSACANWVWRSTR
Sbjct  262  ANNNYDQWNIYAIGGSSNPTILSEGNSFAAPNENYKKEVTKRIGCVSTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIY SNEAFKVENGN APQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKTEETNIYTSNEAFKVENGNLAPQLTKNAGVVA 367

Sequence Alignment: 12. Allergen Name: Jun v 1.0102 Sequence ID: AAF80164

 Score = 519.8 bits 2252,  Expect = 7e-149
 Identities = 326/346 94%, Positives = 336/346 97%, Gaps = 0/346 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG+ YTVTS++DNPVNPTPGTLRY
Sbjct  22   DNPIDSCWRGDSNWGQNRMKLADCAVGFGSSTMGGKGGDFYTVTSADDNPVNPTPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATREK LWIIFSQNMNIKL+MPLYVAG+KTIDGRGA VHLGNGGPCLFMRK SHVILHG
Sbjct  82   GATREKTLWIIFSQNMNIKLKMPLYVAGHKTIDGRGADVHLGNGGPCLFMRKVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LHIHGCNTSVLGDVLVSESIGV PVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL
Sbjct  142  LHIHGCNTSVLGDVLVSESIGVVPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GSTGITI NNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV
Sbjct  202  GSTGITIFNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD WNIYAIGGSSNPTILSEGNSFTAPNE+YKKEVTKRIGCE+TSACANWVWRSTR
Sbjct  262  ANNNYDPWNIYAIGGSSNPTILSEGNSFTAPNENYKKEVTKRIGCESTSACANWVWRSTR 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            DAF+NGAYFVSSGK E+TNIYNSNEAFKVENGNAAPQLT+NAGVVA
Sbjct  322  DAFSNGAYFVSSGKIEETNIYNSNEAFKVENGNAAPQLTKNAGVVA 367

Sequence Alignment: 13. Allergen Name: Cha o 1 Sequence ID: Q96385

 Score = 477.1 bits 2065,  Expect = 5e-136
 Identities = 291/345 84%, Positives = 319/345 92%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGD+NWDQNRMKLADC VGFGSS MGGKGG  YTVTSS+D+PVNP PGTLRY
Sbjct  22   DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATRE++LWIIFS+N+NIKL MPLY+AG KTIDGRGA VH+GNGGPCLFMR  SHVILHG
Sbjct  82   GATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            L+IHGCNTSV G+VL+SE+ GV PVHAQDGDAITMRNVT+ WIDHNSLSD SDGL+DVTL
Sbjct  142  LNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STG+TISNNHFFNHHKVMLLGH D Y DDKSMKVTVAFNQFGPNAGQRMPRARYGL+HV
Sbjct  202  ASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD W+IYAIGGSSNPTILSEGNSFTAPN+S KKEVT+R+GCE+ S CANWVWRST+
Sbjct  262  ANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQ 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D+F NGAYFVSSGK E TNIYN+NEAFKVENG+AAPQLT+NAGV+
Sbjct  322  DSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVL 366

Sequence Alignment: 14. Allergen Name: Cry j 1.0101 Sequence ID: P18632

 Score = 456.2 bits 1973,  Expect = 1e-129
 Identities = 274/345 79%, Positives = 313/345 90%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG++YTVT+S+D+PVNP PGTLRY
Sbjct  22   DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V++GNGGPC+F+++ S+VI+HG
Sbjct  82   GATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            LH++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  TN WIDHNS+S+ SDGL+DVTL
Sbjct  142  LHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAFNQFGPN GQRMPRARYGLVHV
Sbjct  202  SSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD W IYAIGGSSNPTILSEGNSFTAPNESYKK+VT RIGC+T+S+C+NWVW+ST+
Sbjct  262  ANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQ 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT+NAGV+
Sbjct  322  DVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVL 366

Sequence Alignment: 15. Allergen Name: Cry j 1.0103 Sequence ID: BAB86287

 Score = 453.9 bits 1963,  Expect = 5e-129
 Identities = 273/345 79%, Positives = 313/345 90%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG++YTVT+S+D+PVNP PGTLRY
Sbjct  22   DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V++GNGGPC+F+++ S+VI+HG
Sbjct  82   GATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  TN WIDHNS+S+ SDGL+DVTL
Sbjct  142  LYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STG+TISNN FFNHHKVMLLGHDD Y DDKSMKVTVAFNQFGPN GQRMPRARYGLVHV
Sbjct  202  TSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD W IYAIGGSSNPTILSEGNSFTAPNESYKK+VT RIGC+T+S+C+NWVW+ST+
Sbjct  262  ANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQ 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D F NGAYFVSSGK E  NIY   EAF VENGNA PQLT+NAGV+
Sbjct  322  DVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVL 366

Sequence Alignment: 16. Allergen Name: Cry j 1.0102 Sequence ID: BAA05543

 Score = 451.8 bits 1954,  Expect = 2e-128
 Identities = 272/345 78%, Positives = 312/345 90%, Gaps = 0/345 0%
Query  1    DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRY 60
            DNPIDSCWRGDSNW QNRMKLADC VGFGSSTMGGKGG++YTVT+S+D+PVNP PGTLRY
Sbjct  22   DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRY 81
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GATR++ LWIIFS NMNIKL+MP+Y+AGYKT DGRGA V++GNGGPC+F+++ S+VI+HG
Sbjct  82   GATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHG 141
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            L+++GC+TSVLG+VL++ES GVEPVH QDGDA+T+R  TN WIDHNS+S+ SDGL+DVTL
Sbjct  142  LYLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTL 201
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
             STG+TISNN FFNHHKVM LGHDD Y DDKSMKVTVAFNQFGPN GQRMPRARYGLVHV
Sbjct  202  TSTGVTISNNLFFNHHKVMSLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHV 261
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
            ANNNYD W IYAIGGSSNPTILSEGNSFTAPNESYKK+VT RIGC+T+S+C+NWVW+ST+
Sbjct  262  ANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQ 321
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D F NGAYFVSSGK E  NIY   EAF VENGNA P+LTQNAGV+
Sbjct  322  DVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPHLTQNAGVL 366

Sequence Alignment: 17. Allergen Name: Art v 6.0101 Sequence ID: AY904433

 Score = 246.2 bits 1052,  Expect = 2e-66
 Identities = 165/340 48%, Positives = 211/340 62%, Gaps = 5/340 1%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTS-SEDNPVNPTPGTLRY 60
            N ID CWR  ++W++NR  LA C  GF   T GG GGEIY VT  S+DN  NP PGTLR 
Sbjct  48   NIIDKCWRCKADWEKNRQALAKCAQGFAKGTTGGLGGEIYVVTDCSDDNAANPKPGTLRC 107
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            G T++K LWIIF ++M IKL+  L +   KTIDGRGA V +  GG  L +    +VI+H 
Sbjct  108  GVTQDKPLWIIFKKDMVIKLKHELVINKDKTIDGRGANVEITCGG--LTIHNVCNVIIHN 165
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            +HIH    +  G ++ +        H  DGD I +   +  WIDH +LS   DGLIDVTL
Sbjct  166  IHIHDIKVTE-GGIIKATDAKPGHRHKSDGDGICVAGSSKIWIDHCTLSHGPDGLIDVTL 224
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GST +TISN  F +H+K++LLG D+++ DDK M VTVAFN+F     QRMPR R+G+ +V
Sbjct  225  GSTAVTISNCKFSHHQKILLLGADNSHVDDKKMHVTVAFNRFAEACDQRMPRCRFGFFQV 284
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
             NN+Y  W  YAIGGS+NPTILS+GN F APN+  KK V  R     T +   W WRS +
Sbjct  285  VNNDYTSWGTYAIGGSANPTILSQGNRFHAPNDPMKKNVLVRADAPHTES-MKWNWRSEK 343
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D + NGA FV+SG          +     E G+A  QLT  AG +
Sbjct  344  DLLENGAIFVASGCDPHLTPEQKSHLIPAEPGSAVLQLTSCAGTL 388

Sequence Alignment: 18. Allergen Name: Amb a 1 Sequence ID: P27761

 Score = 244.6 bits 1045,  Expect = 5e-66
 Identities = 167/337 49%, Positives = 211/337 62%, Gaps = 9/337 2%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWRG ++W+ NR  LADC  GF   T GGK G++YTVTS+ D+ V NP  GTLR+
Sbjct  49   NIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKEGTLRF 108
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
             A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +    ++I+H 
Sbjct  109  AAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKNIIIHN 166
Query  121  LHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDV 178
            ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   DGL+DV
Sbjct  167  INIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFDGLVDV 223
Query  179  TLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLV 238
            TLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR R+G+ 
Sbjct  224  TLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFF 283
Query  239  HVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRS 298
            +V NNNYD+W  YAIGGSS PTIL +GN F AP++  KK V  R G     + A W WRS
Sbjct  284  QVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WNWRS 342
Query  299  TRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGV 344
             +D + NGA FV+SG         S      E G AA +LT +AGV
Sbjct  343  DKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGV 388

Sequence Alignment: 19. Allergen Name: Amb a 1 Sequence ID: AAA32669

 Score = 244.6 bits 1045,  Expect = 5e-66
 Identities = 167/337 49%, Positives = 211/337 62%, Gaps = 9/337 2%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWRG ++W+ NR  LADC  GF   T GGK G++YTVTS+ D+ V NP  GTLR+
Sbjct  49   NIIDKCWRGKADWENNRQALADCAQGFAKGTYGGKWGDVYTVTSNLDDDVANPKEGTLRF 108
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
             A + + LWIIF  +M I L   L V   KTIDGRG  V + NGG  L +    ++I+H 
Sbjct  109  AAAQNRPLWIIFKNDMVINLNQELVVNSDKTIDGRGVKVEIINGG--LTLMNVKNIIIHN 166
Query  121  LHIHGCNTSVLGDVLVSESIGVEPV--HAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDV 178
            ++IH  +  VL   ++  + G  P+  +A DGD I +   +  WIDH SLS   DGL+DV
Sbjct  167  INIH--DVKVLPGGMIKSNDG-PPILRQASDGDTINVAGSSQIWIDHCSLSKSFDGLVDV 223
Query  179  TLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLV 238
            TLGST +TISN  F  + K +LLG DDT+  DK M  TVAFN F  N  QRMPR R+G+ 
Sbjct  224  TLGSTHVTISNCKFTQQSKAILLGADDTHVQDKGMLATVAFNMFTDNVDQRMPRCRFGFF 283
Query  239  HVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRS 298
            +V NNNYD+W  YAIGGSS PTIL +GN F AP++  KK V  R G     + A W WRS
Sbjct  284  QVVNNNYDRWGTYAIGGSSAPTILCQGNRFLAPDDQIKKNVLARTGTGAAESMA-WNWRS 342
Query  299  TRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGV 344
             +D + NGA FV+SG         S      E G AA +LT +AGV
Sbjct  343  DKDLLENGAIFVTSGSDPVLTPVQSAGMIPAEPGEAAIKLTSSAGV 388

Sequence Alignment: 20. Allergen Name: Hel a 6.0101 Sequence ID: A0A251RNJ1

 Score = 241.4 bits 1031,  Expect = 5e-65
 Identities = 160/340 47%, Positives = 209/340 61%, Gaps = 5/340 1%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTS-SEDNPVNPTPGTLRY 60
            N +D CWR  ++W  NR  +ADC  GF   T GGKGG++Y VTS ++D+P NP  GTLR+
Sbjct  46   NIMDQCWRCKADWADNRQAMADCAQGFAKGTTGGKGGDVYVVTSEADDDPANPKEGTLRF 105
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            G T+ + LWI F ++M I L   L VA  KTIDGRGA V + NGG  L +    ++I+  
Sbjct  106  GVTQGRPLWITFEKDMVISLTQELVVASDKTIDGRGAKVEITNGG--LTLMDVKNIIISN 163
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            +++H     + G ++ S        +  DGD IT+      WIDH S+S   DGL+DVTL
Sbjct  164  INVHDV-VELPGGMIKSGDGPATQRQKSDGDCITVAGGKQIWIDHCSFSKAFDGLVDVTL 222
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GS+ +T+SN  F  H KVMLLG DD +  DK+M VTVAFN F  N  QRMPR R+G+ +V
Sbjct  223  GSSHVTVSNCKFTQHSKVMLLGADDGHHQDKNMVVTVAFNLFTDNCDQRMPRCRFGFFQV 282
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
             NNNYD+W  YAIGGSS PTILS+GN F AP+++ KK V  R      S    W WR+ +
Sbjct  283  VNNNYDRWGTYAIGGSSAPTILSQGNRFLAPDDAAKKNVCVRADAPE-SESMTWNWRTEK 341
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
            D + NGA FV SG              + E G  AP+LT +AGV+
Sbjct  342  DVLENGAVFVPSGSDPALTGEQQGGMIQAEPGENAPKLTASAGVL 386

Sequence Alignment: 21. Allergen Name: Amb a 2 Sequence ID: P27762

 Score = 241.2 bits 1030,  Expect = 6e-65
 Identities = 165/339 48%, Positives = 212/339 62%, Gaps = 7/339 2%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWR   +W +NR  L +C  GFG +T GGK G+IY VTS +D+ V NP  GTLR+
Sbjct  49   NIIDKCWRCKPDWAENRQALGNCAQGFGKATHGGKWGDIYMVTSDQDDDVVNPKEGTLRF 108
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GAT+++ LWIIF ++M I LQ  + V   KTIDGRGA V L  GG  L   K  +VI+H 
Sbjct  109  GATQDRPLWIIFQRDMIIYLQQEMVVTSDKTIDGRGAKVELVYGGITLMNVK--NVIIHN 166
Query  121  LHIHGCNTSVL-GDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVT 179
            + IH  +  VL G  + S      P H  DGDAI +   ++ WIDH +LS   DGL+DV 
Sbjct  167  IDIH--DVRVLPGGRIKSNGGPAIPRHQSDGDAIHVTGSSDIWIDHCTLSKSFDGLVDVN 224
Query  180  LGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVH 239
             GSTG+TISN  F +H K +LLG  DT+  D  M VT+A+N F     +RMPR R+G+ +
Sbjct  225  WGSTGVTISNCKFTHHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHERMPRCRFGFFQ 284
Query  240  VANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRST 299
            + NN YD+W+ YAIGGSSNPTILS+GN F AP+  YKK V  R G +       W WR+ 
Sbjct  285  IVNNFYDRWDKYAIGGSSNPTILSQGNKFVAPDFIYKKNVCLRTGAQEPEW-MTWNWRTQ 343
Query  300  RDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVV 345
             D + NGA FV+SG         +    + E G+  PQLT NAGV+
Sbjct  344  NDVLENGAIFVASGSDPVLTAEQNAGMMQAEPGDMVPQLTMNAGVL 389

Sequence Alignment: 22. Allergen Name: Amb a 1 Sequence ID: P27759

 Score = 237.8 bits 1015,  Expect = 6e-64
 Identities = 159/341 46%, Positives = 213/341 62%, Gaps = 5/341 1%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWRG ++W +NR  LADC  GFG  T+GGK G+IYTVTS  D+ V NP  GTLR+
Sbjct  48   NIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRF 107
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GA + + LWIIF ++M I+L   + V   KTIDGRGA V + N G  + +    +VI+H 
Sbjct  108  GAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAG--FTLNGVKNVIIHN 165
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            +++H    +  G ++ S      P    DGDAI++   +  WIDH SLS   DGL+D  L
Sbjct  166  INMHDVKVNP-GGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKL 224
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            G+T +T+SN+ F  H+ V+L+G  D   +D+ M  TVAFN F  N  QRMPR R+G+ +V
Sbjct  225  GTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHGFFQV 284
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
             NNNYD+W  YAIGGS++PTILS+GN F AP+E  KK V  R G E  +    W WR+ +
Sbjct  285  VNNNYDKWGSYAIGGSASPTILSQGNRFCAPDERSKKNVLGRHG-EAAAESMKWNWRTNK 343
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            D + NGA FV+SG         S      E G +A  LT +AGV++
Sbjct  344  DVLENGAIFVASGVDPVLTPEQSAGMIPAEPGESALSLTSSAGVLS 389

Sequence Alignment: 23. Allergen Name: Amb a 1 Sequence ID: P27760

 Score = 236.9 bits 1011,  Expect = 1e-63
 Identities = 161/339 47%, Positives = 211/339 62%, Gaps = 9/339 2%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWR  ++W  NR  LADC  GF   T GGK G++YTVTS +D+ V NP  GTLR+
Sbjct  50   NIIDKCWRCKADWANNRQALADCAQGFAKGTYGGKHGDVYTVTSDKDDDVANPKEGTLRF 109
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
             A + + LWIIF +NM I L   L V   KTIDGRG  V++ N G  L +    ++I+H 
Sbjct  110  AAAQNRPLWIIFKRNMVIHLNQELVVNSDKTIDGRGVKVNIVNAG--LTLMNVKNIIIHN 167
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQ--DGDAITMRNVTNAWIDHNSLSDCSDGLIDV 178
            ++IH  +  V    ++  + G  P+  Q  DGDAI +   +  WIDH SLS  SDGL+D+
Sbjct  168  INIH--DIKVCPGGMIKSNDG-PPILRQQSDGDAINVAGSSQIWIDHCSLSKASDGLLDI 224
Query  179  TLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLV 238
            TLGS+ +T+SN  F  H+ V+LLG DDT+  DK M  TVAFN F  +  QRMPR R+G+ 
Sbjct  225  TLGSSHVTVSNCKFTQHQFVLLLGADDTHYQDKGMLATVAFNMFTDHVDQRMPRCRFGFF 284
Query  239  HVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRS 298
            +V NNNYD+W  YAIGGSS PTILS+GN F AP++  KK V  R G    +   +W WR+
Sbjct  285  QVVNNNYDRWGTYAIGGSSAPTILSQGNRFFAPDDIIKKNVLARTGT-GNAESMSWNWRT 343
Query  299  TRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
             RD + NGA F+ SG                E G A  +LT +AGV++
Sbjct  344  DRDLLENGAIFLPSGSDPVLTPEQKAGMIPAEPGEAVLRLTSSAGVLS 391

Sequence Alignment: 24. Allergen Name: Amb a 1 Sequence ID: P28744

 Score = 219.8 bits 936,  Expect = 2e-58
 Identities = 157/336 46%, Positives = 206/336 61%, Gaps = 10/336 2%
Query  2    NPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV-NPTPGTLRY 60
            N ID CWRG ++W +NR  LADC  GF   T+GGK G+IYTVTS  D+ V NP  GTLR+
Sbjct  49   NIIDGCWRGKADWAENRKALADCAQGFAKGTIGGKDGDIYTVTSELDDDVANPKEGTLRF 108
Query  61   GATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHG 120
            GA + + LWIIF+++M I+L   L +   KTIDGRGA V + N G  ++  K  ++I+H 
Sbjct  109  GAAQNRPLWIIFARDMVIRLDRELAINNDKTIDGRGAKVEIINAGFAIYNVK--NIIIHN 166
Query  121  LHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTL 180
            + +H    +  G ++ S      P    DGDAI +   +  WIDH SLS   DGLID   
Sbjct  167  IIMHDIVVNP-GGLIKSHDGPPVPRKGSDGDAIGISGGSQIWIDHCSLSKAVDGLIDAKH 225
Query  181  GSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHV 240
            GST  T+SN  +F +H+ +LL  D    D++ M  TVAFN+F  N  QRMP  R+G+V+V
Sbjct  226  GSTHFTVSNC-LFTQHQYLLLFWDF---DERGMLCTVAFNKFTDNVDQRMPNLRHGFVQV 281
Query  241  ANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTR 300
             NNNY++W  YA+GGS+ PTILS+GN F A +   KKEV  R G    S   NW WRS  
Sbjct  282  VNNNYERWGSYALGGSAGPTILSQGNRFLASD--IKKEVVGRYGESAMSESINWNWRSYM 339
Query  301  DAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA 346
            D F NGA FV SG         +      E G A  +LT +AGV++
Sbjct  340  DVFENGAIFVPSGVDPVLTPEQNAGMIPAEPGEAVLRLTSSAGVLS 385

Sequence Alignment: 25. Allergen Name: Pen c 32.0101 Sequence ID: ABM60783

 Score = 70.3 bits 280,  Expect = 1e-13
 Identities = 78/276 28%, Positives = 133/276 48%, Gaps = 25/276 9%
Query  38   GEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGA 97
            G++ T  +SE+       G    G T   + +  F++ ++      ++V+G  +     A
Sbjct  2    GDVATGYASENGGTTGGSG----GTTTTVSSYAAFTEAVSGDDAKVVFVSGKISKTADQA 57
Query  98   VVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRN 157
             V    G     + K S+ IL G+   G       +V++  ++GVE V A +GDAI ++ 
Sbjct  58   RV----GSNTSIIGKDSNAILSGF---GVLVKEASNVII-RNLGVEKVLADNGDAIGIQK 109
Query  158  VTNAWIDHNSLS-------DCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTY-DD 209
              N W+DH  +S       D  DGLID+T  +  +T+SN    +H K  L+GH D+  D+
Sbjct  110  SNNVWVDHCDVSSDRDHDKDYYDGLIDITHAADYVTVSNTSIHDHWKACLIGHSDSNGDE 169
Query  210  DKS-MKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSF 268
            DK  + VT+  N +  N   R P  R+G  HV N+ Y   +   I        L E N+F
Sbjct  170  DKGHLHVTLN-NNYWYNINSRGPSFRFGTGHVYNSYYLDMS-DGINTRQGAQHLVESNTF 227
Query  269  TAPNES-YKKEVTKRIGCETT-SACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEA 326
            +   +  Y  +    +  +       N   + T  +      +V SGK +D  +  + + 
Sbjct  228  SGSKKPLYSTDDGYAVANDNDFGDGENNAEKGTLTSVPYSYDLVGSGKVKDAVVGTAGQT 287
Query  327  F 327
            +
Sbjct  288  L 288

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.