The University of Texas Medical Branch
Department of Biochemistry and Molecular Biology Sealy Center for Structural Biology Computational Biology


SDAP Home Page
SDAP Overview

Search SDAP
SDAP All
SDAP Food

SDAP Tools
AllergenAI
FAO/WHO Allergenicity Test
FASTA Search in SDAP
Peptide Match
Peptide Similarity
Peptide-Protein PD Index
Aller_ML, Allergen Markup Language
List SDAP

About SDAP
General Information
Manual
FAQ
Publications
Who Are We
Advisory Board
New Allergen Submission form

Allergy Links

Our Software Tools
MPACK
FANTOM
GETAREA
InterProSurf
EpiSearch

Allergen Databases
WHO/IUIS Allergen Nomenclature database
FARRP Allergen Protein Database (University of Nebraska)
Allergen Database for Food Safety (ADFS)
COMPARE database
ALLFAM (Medical University of Vienna)
Allermatch (Wageninen University)
Allergome Database

Protein Databases
PDB
MMDB - Entrez
SWISS-PROT
NCBI - Entrez
PIR

Protein Classification
CATH
FSSP
iProClass
ProtoMap
SCOP
VAST

Bioinformatics Servers
BLAST @ NCBI
FASTA @ EMBL-EBI
Peptide Match @ PIR
ClustalW @ EMBL - EBI


                SDAP 2.0 - Structural Database of Allergenic Proteins
Go to: SDAP All allergens       Go to: SDAP Food allergens
Send a comment to Werner Braun      Submit new allergen information to SDAP
  
Alphabetical listing of allergens: A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

Access to SDAP is available free of charge for Academic and non-profit use.< Licenses for commercial use can be obtained by contacting W. Braun (webraun@utmb.edu). Secure access to SDAP is available from https://fermi.utmb.edu/SDAP


Input Sequence

DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD
HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS
MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH
FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG
SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT
DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA
KKVAELTEKIEDLISGDLKDMFRDLKRE
Sequence Info Allergen Name Length Opt Bits Score E Value
ABQ59329 Cla c 9.0101 388 2497 575.6 1.3e-165
AAX14379 Cla h 9.0101 518 2443 563.2 9.5e-162
ACF19589 Cur l 4.0101 506 1921 444.2 6.1e-126
A0A0F6N3V8 Alt a 15.0101 507 1897 438.7 2.7e-124
AAG44478 Pen o 18 503 1837 425.1 3.5e-120
A0A0U1Y1N5 Fus p 9.0101 386 1834 424.4 4.2e-120
AAF71379 Pen ch 18 494 1753 405.9 2e-114
Y13338 Asp f 18.0101 495 1734 401.6 4.1e-113
Q32ZM1 Rho m 2.0101 342 1383 321.7 3.2e-89
AAD52013 Tri r 2.0101 412 687 163.0 2.3e-41
ADE74975 Asp v 13.0101 403 446 108.0 7.7e-25
P28296 Asp f 13 403 441 106.9 1.7e-24
AAD47202 Asp fl protease 403 409 99.6 2.7e-22
CAA35594 Asp o 13 403 409 99.6 2.7e-22
AAD25926 Pen c 13.0101 397 342 84.3 1e-17
AAF23726 Pen ch 13 397 339 83.6 1.7e-17
Please note: Alignment made with FASTA version 36.3.8. As explained in the FASTA manual, the bit score is equivalent to the bit score reported by BLAST. A 1 bit increase in score corresponds to a 2-fold reduction in expectation, and a 10-bit increase implies 1000-fold lower expectation. Sequences with E values < 0.01 are almost always homologous. All FASTA search sequence alignment are printed in Blast format where Query is input sequence, and Sbjct is sequence found in the database.

Sequence Alignment: 1. Allergen Name: Cla c 9.0101 Sequence ID: ABQ59329

 Score = 575.6 bits 2497,  Expect = 1e-165
 Identities = 388/388 100%, Positives = 388/388 100%, Gaps = 0/388 0%
Query  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
            DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD
Sbjct  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
Query  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
            HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS
Sbjct  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
Query  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
            MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH
Sbjct  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
Query  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
            FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG
Sbjct  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
Query  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
            SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT
Sbjct  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
Query  301  DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA 360
            DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA
Sbjct  301  DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA 360
Query  361  KKVAELTEKIEDLISGDLKDMFRDLKRE 388
            KKVAELTEKIEDLISGDLKDMFRDLKRE
Sbjct  361  KKVAELTEKIEDLISGDLKDMFRDLKRE 388

Sequence Alignment: 2. Allergen Name: Cla h 9.0101 Sequence ID: AAX14379

 Score = 563.2 bits 2443,  Expect = 1e-161
 Identities = 378/388 97%, Positives = 383/388 98%, Gaps = 0/388 0%
Query  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
            DQEVHVL SESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD
Sbjct  131  DQEVHVLGSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 190
Query  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
            HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS
Sbjct  191  HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 250
Query  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
            MSDVVKGVEYAAESHLEQVSI KKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH
Sbjct  251  MSDVVKGVEYAAESHLEQVSITKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 310
Query  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
            FAVAAGNDNADSCNYSPAAAENAVTVGASTL+DERAYFSNYGKCNDIFAPGLNIQSTWIG
Sbjct  311  FAVAAGNDNADSCNYSPAAAENAVTVGASTLADERAYFSNYGKCNDIFAPGLNIQSTWIG 370
Query  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
            SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT
Sbjct  371  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 430
Query  301  DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA 360
            DVPSNTANILAWNGGGESNYSAIVEKGGYKA  RPTMLEEIESEAKVASKKVYSEGDELA
Sbjct  431  DVPSNTANILAWNGGGESNYSAIVEKGGYKATHRPTMLEEIESEAKVASKKVYSEGDELA 490
Query  361  KKVAELTEKIEDLISGDLKDMFRDLKRE 388
             KVAELTEK+EDLI+G+LKDMFR+LKRE
Sbjct  491  HKVAELTEKVEDLIAGELKDMFRELKRE 518

Sequence Alignment: 3. Allergen Name: Cur l 4.0101 Sequence ID: ACF19589

 Score = 444.2 bits 1921,  Expect = 6e-126
 Identities = 296/377 78%, Positives = 324/377 85%, Gaps = 2/377 0%
Query  1    DQEVHVLKS-ESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNV 59
            D EV +L   E E E N+PWGLARISHRDSLSFGT+NKYLY  DGGEGVDVYV+DTGTNV
Sbjct  129  DSEVRILGGDEPETENNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNV 188
Query  60   DHVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSG 119
            DHVDFEGRA WGKTIP GDADEDGNGHGTHCSGTVAGKKYGVAKKAHV AVKVLRSNGSG
Sbjct  189  DHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 248
Query  120  SMSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGI 179
            +MSDVVKGVE+AA+SH E VS AK GK+KGFKGSTANMSLGGGKS  LD AVNAAVDAG+
Sbjct  249  TMSDVVKGVEFAAKSHSEAVSAAKNGKKKGFKGSTANMSLGGGKSTTLDMAVNAAVDAGL 308
Query  180  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWI 239
            HFAVAAGNDNADSCNYSPAAAENAVTVGASTL DERAYFSNYGKCNDIFAPGLNI STWI
Sbjct  309  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 368
Query  240  GSKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGAL 299
            GSK+A NTISGTSMASPH+AGLLAY+LSLQPAKDSA+AVADI+PKKLKANLI+I TVGAL
Sbjct  369  GSKHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLIAIGTVGAL 428
Query  300  TDVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDEL 359
            +DVPSNTAN+LAWNGGG SNY+ I+EKGGY      +  EE ESE ++    + SE ++ 
Sbjct  429  SDVPSNTANVLAWNGGGSSNYTDIIEKGGYTVKKAASKEEEKESEFRITIPSL-SELEDD 487
Query  360  AKKVAELTEKIEDLISGDL 378
             +K  E   +    + G L
Sbjct  488  FEKAKESAGRKAHHVGGKL 506

Sequence Alignment: 4. Allergen Name: Alt a 15.0101 Sequence ID: A0A0F6N3V8

 Score = 438.7 bits 1897,  Expect = 3e-124
 Identities = 302/386 78%, Positives = 333/386 86%, Gaps = 14/386 3%
Query  1    DQEVHVL-KSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNV 59
            D EVH L   E E+EKN+PWGLARISHRDSLSFGT+NKYLY  DGGEGVDVYV+DTGTN 
Sbjct  100  DSEVHTLGHDEPEIEKNSPWGLARISHRDSLSFGTWNKYLYAADGGEGVDVYVIDTGTNT 159
Query  60   DHVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSG 119
             HVDFEGRA WGKTIP GDADEDGNGHGTHCSGTVAGKKYGVAKKAHV AVKVLRSNGSG
Sbjct  160  KHVDFEGRAKWGKTIPNGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVYAVKVLRSNGSG 219
Query  120  SMSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGI 179
            +MSDVVKGVEYAA++H + V  AK GK+KGFKGS ANMSLGGGKS  LD AVNAAVDAGI
Sbjct  220  TMSDVVKGVEYAAKAHSDTVQAAKDGKKKGFKGSAANMSLGGGKSTTLDLAVNAAVDAGI 279
Query  180  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWI 239
            HFAVAAGNDNADSCNYSPAAAENAVTVGASTL DERAYFSNYGKCNDIFAPGLNI STWI
Sbjct  280  HFAVAAGNDNADSCNYSPAAAENAVTVGASTLLDERAYFSNYGKCNDIFAPGLNILSTWI 339
Query  240  GSKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGAL 299
            GS++A NTISGTSMASPH+AGLLAY+LSLQPAKDSA+AVADI+PKKLKANLIS+ATVGAL
Sbjct  340  GSEHATNTISGTSMASPHIAGLLAYMLSLQPAKDSAYAVADITPKKLKANLISVATVGAL 399
Query  300  TDVPSNTANILAWNGGGESNYSAIVEKGGY---KAA--------VRPTM--LEEIESEAK 346
            +DVP NT NILAWNGGG SNY+ IVEKGGY   KAA         R T+  L EIE + +
Sbjct  400  SDVPRNTKNILAWNGGGSSNYTEIVEKGGYTVKKAAEKNEEESEFRITIPSLSEIEDDFE 459
Query  347  VASKKVYSEGDELAKKVAELTEKIEDLISGDLKDMFRDLK 386
             A +        +  K+  L  +IED+I+ +++ MF  +K
Sbjct  460  KAKESAGRNAHRVGGKLQHLEAEIEDFIAEEMESMFEKVK 499

Sequence Alignment: 5. Allergen Name: Pen o 18 Sequence ID: AAG44478

 Score = 425.1 bits 1837,  Expect = 4e-120
 Identities = 276/374 73%, Positives = 317/374 84%, Gaps = 1/374 0%
Query  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
            D EVH ++  + +EKNAPWGLARISHRDSLSFG+FNKYLY EDGGEGVD YV+DTGTNVD
Sbjct  129  DSEVHHFEDPA-IEKNAPWGLARISHRDSLSFGSFNKYLYAEDGGEGVDAYVIDTGTNVD 187
Query  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
            HVDFEGRASWGKTIPQGD D DGNGHGTHCSGT+AGKKYGVAKKA+V AVKVLRSNGSG+
Sbjct  188  HVDFEGRASWGKTIPQGDQDVDGNGHGTHCSGTIAGKKYGVAKKANVYAVKVLRSNGSGT 247
Query  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
            MSDVVKGVE+AAE+H+++   AK GK KGFKGS ANMSLGGG S  LD AVNAAVDAG+H
Sbjct  248  MSDVVKGVEWAAEAHIKKSKAAKDGKAKGFKGSVANMSLGGGSSRTLDLAVNAAVDAGMH 307
Query  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
            FAVAAGNDNAD+CNYSPAAAE AVTVGASTL+DERAYFSNYGKC DIFAPGLNI STWIG
Sbjct  308  FAVAAGNDNADACNYSPAAAEKAVTVGASTLADERAYFSNYGKCTDIFAPGLNILSTWIG 367
Query  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
            SKYAVNTISGTSMASPH+AGLLAY +SLQPA DSA+AV +I+PKKLK  LI+IAT GAL+
Sbjct  368  SKYAVNTISGTSMASPHIAGLLAYYVSLQPASDSAYAVEEITPKKLKDALITIATSGALS 427
Query  301  DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEEIESEAKVASKKVYSEGDELA 360
            D+PS+T N+LAWNGGG SNY+ IV KGGYKA    +M + ++       + +  E   L+
Sbjct  428  DIPSDTPNLLAWNGGGSSNYTEIVSKGGYKAGASESMKKHLDELVGKVEEVIAKEQKVLS 487
Query  361  KKVAELTEKIEDLIS 375
             ++  +  +I+D +S
Sbjct  488  HELGAIYSEIKDAVS 502

Sequence Alignment: 6. Allergen Name: Fus p 9.0101 Sequence ID: A0A0U1Y1N5

 Score = 424.4 bits 1834,  Expect = 4e-120
 Identities = 278/378 73%, Positives = 317/378 83%, Gaps = 5/378 1%
Query  8    KSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGR 67
            K + E E+ APWGLARISHR++L+FGTFNKYLY+ DGGEGVD Y+VDTGTNVDHVDFEGR
Sbjct  2    KCDGETERQAPWGLARISHRNTLNFGTFNKYLYSSDGGEGVDAYIVDTGTNVDHVDFEGR 61
Query  68   ASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKG 127
            A WGKTIP GDADEDGNGHGTHCSGTVAGKKYGVAKKA+V AVKVLRSNGSGSMSDVVKG
Sbjct  62   AHWGKTIPSGDADEDGNGHGTHCSGTVAGKKYGVAKKANVYAVKVLRSNGSGSMSDVVKG 121
Query  128  VEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGN 187
            VE+AA SHLEQ   AK GKRKGFKGS ANMSLGGGK+  LD AVNAAV  GIHFAVAAGN
Sbjct  122  VEFAATSHLEQKKKAKDGKRKGFKGSVANMSLGGGKTQALDAAVNAAVRTGIHFAVAAGN 181
Query  188  DNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNT 247
            DNAD+CNYSPAAA   VTVGAS L D RAYFSNYGKC DIFAPGLNIQSTWIGSKYAVNT
Sbjct  182  DNADACNYSPAAASEPVTVGASALDDSRAYFSNYGKCTDIFAPGLNIQSTWIGSKYAVNT 241
Query  248  ISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTA 307
            ISGTSMASPH+AGLLAY LSLQPA+DS +A+A I+PKKLK NLIS+AT  AL+D+PS+T 
Sbjct  242  ISGTSMASPHIAGLLAYYLSLQPAEDSEYALASITPKKLKENLISVATEDALSDIPSDTP 301
Query  308  NILAWNGGGESNYSAIVEKGGYKAAVRPTM-LEEI----ESEAKVASKKVYSEGDELAKK 362
            N+LAWNGGG S+Y  IVE G YK    P+  +EEI    E E  + S K+ +   EL  K
Sbjct  302  NLLAWNGGGCSDYKKIVEAGSYKVKAAPSSRVEEIKHAVEQEVNLVSGKLTTGAKELGSK 361
Query  363  VAELTEKIEDLISGDLKDMFRDL 385
              ++++KI +L+  +L++ +++L
Sbjct  362  AEKFSKKIHELVDEELEEFLKEL 384

Sequence Alignment: 7. Allergen Name: Pen ch 18 Sequence ID: AAF71379

 Score = 405.9 bits 1753,  Expect = 2e-114
 Identities = 269/350 76%, Positives = 308/350 88%, Gaps = 13/350 3%
Query  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
            D EV  + SE  VEKNAPWGLARISHR+SLSFG FNKYLY E+GGEGVD YV+DTG NV 
Sbjct  130  DSEVRTM-SEGSVEKNAPWGLARISHRESLSFGNFNKYLYAEEGGEGVDAYVIDTGANVK 188
Query  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
            HVDFEGRA+WGKTIPQGDADEDGNGHGTHCSGT+AGKK+GVAKKA+V AVKVLRSNGSG+
Sbjct  189  HVDFEGRANWGKTIPQGDADEDGNGHGTHCSGTIAGKKFGVAKKANVYAVKVLRSNGSGT 248
Query  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
            MSDVVKGVE+AAE+H+++   +KKG +K FKGS ANMSLGGG S  LD AVNAAVDAGIH
Sbjct  249  MSDVVKGVEWAAEAHIKK---SKKGDKK-FKGSVANMSLGGGSSRTLDLAVNAAVDAGIH 304
Query  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
            FAVAAGNDNAD+CNYSPAAAE A+TVGASTL+DERAYFSNYGKC DIFAPGLNI STW+G
Sbjct  305  FAVAAGNDNADACNYSPAAAEKAITVGASTLADERAYFSNYGKCTDIFAPGLNILSTWVG 364
Query  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
            S +A NTISGTSMASPH+AGLLAY +SL PAKDSA+AVAD++PK+LKA LIS+AT G LT
Sbjct  365  SDHATNTISGTSMASPHIAGLLAYYVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLT 424
Query  301  DVPSNTANILAWNGGGESNYSAIVEKGGYKAAVRPTMLEE-----IESEAKVASKK---V 352
            D+PS+T N+LAWNGGG +NY+ I+  GGYKA    T +E+     I+S  K   K+   +
Sbjct  425  DIPSDTPNLLAWNGGGSANYTKILADGGYKAHNAETTVEDRIGIIIDSAEKAFHKELGAI 484
Query  353  YSE 355
            YSE
Sbjct  485  YSE 487

Sequence Alignment: 8. Allergen Name: Asp f 18.0101 Sequence ID: Y13338

 Score = 401.6 bits 1734,  Expect = 4e-113
 Identities = 260/354 73%, Positives = 305/354 86%, Gaps = 6/354 1%
Query  1    DQEVHVLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVD 60
            D EVH ++  + VEK+APWGLARISHRDSLSFGTFNKYLY  +GGEGVD Y +DTG NVD
Sbjct  130  DSEVHTMEDPT-VEKSAPWGLARISHRDSLSFGTFNKYLYASEGGEGVDAYTIDTGINVD 188
Query  61   HVDFEGRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGS 120
            HVDFEGRA WGKTIP  D D DGNGHGTHCSGT+AG+KYGVAKKA++ AVKVLRS+GSG+
Sbjct  189  HVDFEGRAQWGKTIPTDDEDADGNGHGTHCSGTIAGRKYGVAKKANLYAVKVLRSSGSGT 248
Query  121  MSDVVKGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIH 180
            MSDVV GVE+A +SHL++V  AK GK KGFKGS ANMSLGGGKS  L+ AVNA V+AG+H
Sbjct  249  MSDVVAGVEWAVKSHLKKVKDAKDGKIKGFKGSVANMSLGGGKSRTLEAAVNAGVEAGLH 308
Query  181  FAVAAGNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIG 240
            FAVAAGNDNAD+CNYSPAAAEN +TVGASTL DERAYFSNYGKC DIFAPGLNI STWIG
Sbjct  309  FAVAAGNDNADACNYSPAAAENPITVGASTLQDERAYFSNYGKCTDIFAPGLNILSTWIG 368
Query  241  SKYAVNTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALT 300
            SK+AVNTISGTSMASPH+AGLLAY++SLQP+KDSAFAV +++PKKLK ++I+IAT GALT
Sbjct  369  SKHAVNTISGTSMASPHIAGLLAYFVSLQPSKDSAFAVDELTPKKLKKDIIAIATQGALT 428
Query  301  DVPSNTANILAWNGGGESNYSAIVEKGGYK--AAVRPTMLEEIESEAKVASKK---VYSE 355
            D+PS+T N+LAWNGGG SNY+ I+  GGYK  A+V+      +    K+ +++   +YSE
Sbjct  429  DIPSDTPNLLAWNGGGSSNYTDIIASGGYKVNASVKDRFEGLVHKAEKLLTEELGAIYSE 488

Sequence Alignment: 9. Allergen Name: Rho m 2.0101 Sequence ID: Q32ZM1

 Score = 321.7 bits 1383,  Expect = 3e-89
 Identities = 213/307 69%, Positives = 247/307 80%, Gaps = 8/307 2%
Query  6    VLKSESEVEKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFE 65
            V  +E  V K APWGLARISHRD LS+G+F++YLY  +GG GV  YV+DTG NV H  FE
Sbjct  27   VHANEFTVAKGAPWGLARISHRDPLSLGSFDQYLYDSNGGTGVTSYVIDTGVNVHHEQFE 86
Query  66   GRASWGKTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVV 125
            GRA WGKTIPQGD DEDGNGHGTHC+GT+    YGVAK A + AVKVLRSNGSGSMSDV+
Sbjct  87   GRAKWGKTIPQGDEDEDGNGHGTHCAGTIGSNAYGVAKNAEIVAVKVLRSNGSGSMSDVI 146
Query  126  KGVEYAAESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAA 185
            KGVE+A +SH + V   KKGK   F  STANMSLGGGKSP LD AVNAAV AG+HFAVAA
Sbjct  147  KGVEFAVKSHQDSV---KKGK-NSF--STANMSLGGGKSPALDLAVNAAVKAGLHFAVAA 200
Query  186  GNDNADSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAV 245
            GN+N D+CN SPA+AENA+TVGAST+SD RAYFSNYGKC DIFAPGLNI ST+IGS  A 
Sbjct  201  GNENQDACNTSPASAENAITVGASTISDARAYFSNYGKCVDIFAPGLNILSTYIGSDAAT 260
Query  246  NTISGTSMASPHVAGLLAYLLSLQPAKDSAFAVA--DISPKKLKANLISIATVGALTDVP 303
              +SGTSMASPH+AGLL Y LSLQP+ DS F +    I+P +LK NLI+  T   L D+P
Sbjct  261  AYLSGTSMASPHIAGLLTYYLSLQPSSDSEFFIGAEGITPAQLKKNLIAFGTPDVLADIP 320
Query  304  SNTANILAWNGGGES 318
            ++T NILA+NG G++
Sbjct  321  ADTPNILAFNGAGQN 335

Sequence Alignment: 10. Allergen Name: Tri r 2.0101 Sequence ID: AAD52013

 Score = 163.0 bits 687,  Expect = 2e-41
 Identities = 134/282 47%, Positives = 176/282 62%, Gaps = 23/282 8%
Query  14   EKNAP-WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGK 72
            + N P WGLAR+  +     GT   Y Y    G+GV  Y++DTG ++DH DF+GRA WG+
Sbjct  130  QDNVPSWGLARVGSKKPG--GT--TYYYDPSAGKGVTAYIIDTGIDIDHEDFQGRAKWGE 185
Query  73   TIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAA 132
                   + D NGHGTH +GTV G KYG+AK   + AVKVL  +GSGS S V+KG+E+A 
Sbjct  186  NFVD-QQNTDCNGHGTHVAGTVGGTKYGLAKGVSLVAVKVLDCDGSGSNSGVIKGMEWA- 243
Query  133  ESHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADS 192
               + Q S    G  K    S  NMSLGG +S   ++A  A  DAGI  AVAAGN+N D+
Sbjct  244  ---MRQASGGGNGTAKAAGKSVMNMSLGGPRSEASNQAAKAISDAGIFMAVAAGNENMDA 300
Query  193  CNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTS 252
             + SPA+  +  TV AST  D +A FSNYG   D++APG +I S   G   + +T+SGTS
Sbjct  301  QHSSPASEPSVCTVAASTKDDGKADFSNYGAVVDVYAPGKDITSLKPGG--STDTLSGTS 358
Query  253  MASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAW 312
            MASPHV GL AYL+ L   K     + D + KK+  ++I     G        T   L +
Sbjct  359  MASPHVCGLGAYLIGL--GKQGGPGLCD-TIKKMANDVIQSPGEG--------TTGKLIY 407
Query  313  NGGGE 317
            NG G+
Sbjct  408  NGSGK 412

Sequence Alignment: 11. Allergen Name: Asp v 13.0101 Sequence ID: ADE74975

 Score = 108.0 bits 446,  Expect = 8e-25
 Identities = 137/276 49%, Positives = 181/276 65%, Gaps = 25/276 9%
Query  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
            + +APWGL  ISH+   S    + Y+Y    G     YVVDTG NVDH +F+GRAS    
Sbjct  126  QSDAPWGLGAISHQGDAS----SDYIYDTSAGADTYAYVVDTGINVDHSEFDGRASLAYN 181
Query  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
               G    D  GHGTH +GT+ GK +GV+KKA++ +VKV+    S S S ++ G  +AA 
Sbjct  182  AAGGQ-HVDSVGHGTHVAGTIGGKTFGVSKKANLLSVKVFEGE-SSSTSIILDGYNWAAN 239
Query  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
               + VS ++ GK      S  N+SLGGG S  +  AV +A D G+   VAAGN+N D+ 
Sbjct  240  ---DIVSKSRTGK------SAINLSLGGGYSYAFSNAVESAFDEGVLSVVAAGNENVDAS 290
Query  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
            N SPA+A NA+TV AST  + RA FSNYG+  DIFAPG +I S WIG   A NTISGTSM
Sbjct  291  NTSPASAPNALTVAASTERNARASFSNYGEVVDIFAPGEDILSAWIGGNSATNTISGTSM 350
Query  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
            A+PH+ GL  YL++L+            SP  + + +  +AT GAL+ V S + N LA+N
Sbjct  351  ATPHIVGLSLYLIALEGLS---------SPGDVTSRIKELATQGALSGV-SGSPNALAYN 400
Query  314  G 314
            G
Sbjct  401  G 401

Sequence Alignment: 12. Allergen Name: Asp f 13 Sequence ID: P28296

 Score = 106.9 bits 441,  Expect = 2e-24
 Identities = 136/276 49%, Positives = 176/276 63%, Gaps = 25/276 9%
Query  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
            +K APWGL  ISH+   S      Y+Y    G G   YVVD+G NV+HV+FE RAS    
Sbjct  126  QKGAPWGLGSISHKGQAS----TDYIYDTSAGAGTYAYVVDSGINVNHVEFESRASLAYN 181
Query  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
               G +  D  GHGTH +GT+ GK YGVAKK ++ +VKV++   S S S ++ G  +A  
Sbjct  182  AA-GGSHVDSIGHGTHVAGTIGGKTYGVAKKTNLLSVKVFQGE-SSSTSIILDGFNWAVN 239
Query  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
                   I  KG+ K    +  NMSLGGG S  ++ AV  A D G+   VAAGN+N+D+ 
Sbjct  240  D------IVSKGRTKK---AAINMSLGGGYSYAFNNAVENAFDEGVLSVVAAGNENSDAS 290
Query  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
            N SPA+A NA+TV A   S+ RA FSNYG   DIFAPG +I S WIGS  A NTISGTSM
Sbjct  291  NTSPASAPNALTVAAINKSNARASFSNYGSVVDIFAPGQDILSAWIGSTTATNTISGTSM 350
Query  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
            A+PH+ GL  YL+ L+             P  + A +  +AT G +T+V   + N LA+N
Sbjct  351  ATPHIVGLSVYLMGLENLS---------GPAAVTARIKELATNGVVTNV-KGSPNKLAYN 400
Query  314  G 314
            G
Sbjct  401  G 401

Sequence Alignment: 13. Allergen Name: Asp fl protease Sequence ID: AAD47202

 Score = 99.6 bits 409,  Expect = 3e-22
 Identities = 137/276 49%, Positives = 181/276 65%, Gaps = 25/276 9%
Query  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
            +K+APWGL  ISH+   S      Y+Y    GEG   YVVD+G NVDH +FEGRAS    
Sbjct  126  QKSAPWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYN 181
Query  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
               G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S S S ++ G  +AA 
Sbjct  182  AAGGQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGE-SSSTSVILDGFNWAAN 239
Query  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
                   ++KK   K    +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+ 
Sbjct  240  D-----IVSKKRTSK----AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAG 290
Query  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
              SPA+A +A+TV A   S+ RA FSN+GK  D+FAPG +I S WIGS  A NTISGTSM
Sbjct  291  QTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSM 350
Query  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
            A+PH+ GL  YL +L+   D   AV     K+++     +AT   + DV   + N+LA+N
Sbjct  351  ATPHIVGLSLYLAALENL-DGPAAVT----KRIEE----LATKDVVKDV-KGSPNLLAYN 400
Query  314  G 314
            G
Sbjct  401  G 401

Sequence Alignment: 14. Allergen Name: Asp o 13 Sequence ID: CAA35594

 Score = 99.6 bits 409,  Expect = 3e-22
 Identities = 138/276 50%, Positives = 181/276 65%, Gaps = 25/276 9%
Query  14   EKNAPWGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWGKT 73
            +K+APWGL  ISH+   S      Y+Y    GEG   YVVD+G NVDH +FEGRAS    
Sbjct  126  QKSAPWGLGSISHKGQQS----TDYIYDTSAGEGTYAYVVDSGVNVDHEEFEGRASKAYN 181
Query  74   IPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYAAE 133
               G    D  GHGTH SGT+AGK YG+AKKA + +VKV++   S S S ++ G  +AA 
Sbjct  182  AAGGQ-HVDSIGHGTHVSGTIAGKTYGIAKKASILSVKVFQGE-SSSTSVILDGFNWAAN 239
Query  134  SHLEQVSIAKKGKRKGFKGSTANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNADSC 193
                   ++KK   K    +  NMSLGGG S  ++ AV  A + G+   VAAGN+N+D+ 
Sbjct  240  D-----IVSKKRTSK----AAINMSLGGGYSKAFNDAVENAFEQGVLSVVAAGNENSDAG 290
Query  194  NYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISGTSM 253
              SPA+A +A+TV A   S+ RA FSN+GK  D+FAPG +I S WIGS  A NTISGTSM
Sbjct  291  QTSPASAPDAITVAAIQKSNNRASFSNFGKVVDVFAPGQDILSAWIGSSSATNTISGTSM 350
Query  254  ASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANILAWN 313
            A+PH+ GL  YL +L+   D   AV     K++K     +AT   + DV   + N+LA+N
Sbjct  351  ATPHIVGLSLYLAALENL-DGPAAVT----KRIKE----LATKDVVKDV-KGSPNLLAYN 400
Query  314  G 314
            G
Sbjct  401  G 401

Sequence Alignment: 15. Allergen Name: Pen c 13.0101 Sequence ID: AAD25926

 Score = 84.3 bits 342,  Expect = 1e-17
 Identities = 129/274 47%, Positives = 179/274 65%, Gaps = 30/274 10%
Query  13   VEKNAP-WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWG 71
            V+ N P WGLARIS + +   GT   Y Y    GEGV  Y VDTG ++ H DF GRA WG
Sbjct  119  VQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWG 174
Query  72   KTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYA 131
              +   D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG+ S V+ G+++A
Sbjct  175  TNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWA 233
Query  132  AESHLEQVSIAKKGKRKGFKGS-TANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNA 190
                       K  K +G  G    NMSLGG  S  ++ A    V +GI ++VAAGN+  
Sbjct  234  V----------KDAKSRGANGKYVMNMSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAE 283
Query  191  DSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISG 250
            ++ N SPA+A    T+ AST +D  A F+N+G   D++APG +I + + G      T+SG
Sbjct  284  NASNSSPASAAEVCTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSG 341
Query  251  TSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANIL 310
            TSMA+PHVAG+ AYL++L+           +S     A ++ +AT  +++  PS T + L
Sbjct  342  TSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSISRAPSGTTSKL 390
Query  311  AWNG 314
             +NG
Sbjct  391  LYNG 394

Sequence Alignment: 16. Allergen Name: Pen ch 13 Sequence ID: AAF23726

 Score = 83.6 bits 339,  Expect = 2e-17
 Identities = 129/274 47%, Positives = 179/274 65%, Gaps = 30/274 10%
Query  13   VEKNAP-WGLARISHRDSLSFGTFNKYLYTEDGGEGVDVYVVDTGTNVDHVDFEGRASWG 71
            V+ N P WGLARIS + +   GT   Y Y    GEGV  Y VDTG ++ H DF GRA WG
Sbjct  119  VQSNVPSWGLARISSKRT---GT-TSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWG 174
Query  72   KTIPQGDADEDGNGHGTHCSGTVAGKKYGVAKKAHVKAVKVLRSNGSGSMSDVVKGVEYA 131
              +   D + DGNGHGTH + T AG KYGVAKKA + AVKVL ++GSG+ S V+ G+++A
Sbjct  175  TNVVDND-NTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWA 233
Query  132  AESHLEQVSIAKKGKRKGFKGS-TANMSLGGGKSPILDKAVNAAVDAGIHFAVAAGNDNA 190
                       K  K +G  G    N SLGG  S  ++ A    V +GI ++VAAGN+  
Sbjct  234  V----------KDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAE 283
Query  191  DSCNYSPAAAENAVTVGASTLSDERAYFSNYGKCNDIFAPGLNIQSTWIGSKYAVNTISG 250
            ++ N SPA+A  A T+ AST +D  A F+N+G   D++APG +I + + G      T+SG
Sbjct  284  NASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGG--GSKTLSG 341
Query  251  TSMASPHVAGLLAYLLSLQPAKDSAFAVADISPKKLKANLISIATVGALTDVPSNTANIL 310
            TSMA+PHVAG+ AYL++L+           +S     A ++ +AT  +++  PS T + L
Sbjct  342  TSMAAPHVAGVAAYLMALE----------GVSAGNACARIVQLAT-SSISRAPSGTTSKL 390
Query  311  AWNG 314
             +NG
Sbjct  391  LYNG 394

SDAP Home Page | Search SDAP | SDAP Manual | SDAP FAQ | Contact  
UTMB | Search | Directories | UTMB Map | News | Employment | Sitemap 
This site published by Surendra Negi
Copyright   2001-2023  The University of Texas Medical Branch. Please review our privacy policy and Internet guidelines.